4XSVA

Human ctp: phosphoethanolamine cytidylyltransferase in complex with ctp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
334
structure length
306
Chain Sequence
GRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ethanolamine-phosphate cytidylyltransferase
publication title Human CTP: Phosphoethanolamine Cytidylyltransferase
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 101
structure length 306
sequence length 334
ec nomenclature ec 2.7.7.14: Ethanolamine-phosphate cytidylyltransferase.
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4xsvA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4xsvA01
3LOQA 1N77A 2QJFA 4MUNA 3C8ZA 4GRIA 3RJZA 1VBMA 1IQUA 1TYBE 1LI5A 4MW7A 2DXIA 1Q19A 1TYAE 2PZAA 2QJTA 3IMCA 1JZQA 1WKBA 3MMXA 3DPIA 1QRUA 2ZUEA 1GTSA 1MB2A 2DETA 2R5WA 2OQ2A 2CFOA 1WXIA 4Q16A 1WZ2A 1RQGA 2XRYA 5JBNA 5J58A 3AG6A 1J1ZA 1KR2A 2QTMA 1OBHA 2WB2A 1OWPA 2QUJA 4U63A 2E89A 1PFUA 3FOCA 3MUEA 1OWLA 2J4DA 3N9IA 4NATA 1EXDA 5HUHA 5HUJA 2HMAA 3FNRA 2CT8A 4L2IA 1BS2A 1V47A 4MUFA 1QJCA 3MLBA 4XSVA 4ZCPA 3IODA 1H3NA 4WNYA 3IH5A 1NSYA 2A84A 4EF6A 4KR7A 4MWDA 3NBAA 2CSXA 1MB9A 3IMEA 3ILVA 1XNGA 1YUNA 4MUIA 1WJGA 4K03A 4L2IB 1I6LA 4F4HA 1VLHA 2D13A 3AIIA 1M8GA 1X8XA 3LE8A 4DE5A 1N1DA 1JEEA 4WSOA 4MVWA 4ZCQA 1KAMA 2V0CA 1Q11A 5HG0A 1K92A 1M83A 2A4MA 3A04A 5H7XA 3PNVA 3IMGA 5DK4A 3G6KA 1MC1A 1YIDA 2D54A 2PZ8A 4DDMA 1PG2A 3SP1A 5LM3A 1O95C 1O95D 1GLNA 4HJRA 3ND5A 4TS1A 4JZYA 5F23A 1QTQA 2D5BA 4AS1A 2QTRA 3CLTD 5EKDA 1VL2A 5AHWA 5IHXA 1M8JA 1NUPA 3CA8A 4QRDA 1PFWA 1KP2A 1T9GS 1O94C 2J09A 3HMQA 1H3EA 4EFKA 1PFVA 3IOBA 3VU8A 1F7UA 3FDXA 2A1UB 4ND6A 1O0CA 3FETA 3CR8A 4NAUA 3SYTA 2DLCX 3E27A 3GLVA 1NP7A 2DERA 1WOYA 4U7JA 4MWEA 1MAUA 4KKVA 1ZJWA 4YP5A 1YUMA 1IQ0A 4RPIA 1G59A 1J20A 3N8HA 3RFFA 1O0BA 1OWMA 3ZJVA 1O97C 1JZSA 3AG5A 2O8VA 4MUHA 1JIIA 4X0EA 4PBTA 1NURA 3L92A 1PG0A 3COYA 3P0HA 1KKUA 4DJAA 4MVYA 1JILA 2CYCA 1EFPB 1TYDE 3KT3A 4YBRA 2IELA 2PFSA 4HK4A 1HYBA 4MVXA 2HGZA 4MQ6A 1NUSA 1OBCA 4PBRA 3U1VA 3RK0A 1ZH0A 1T6XA 3K32A 3A05A 4EG1A 2EL7A 1MJHA 3PNYA 4GU5A 3FG9A 2CYAA 2PG3A 4YP6A 4JFAA 1MOPA 5FO1A 1MAWA 4DLPA 3Q10A 2IJGX 3D6VA 3QTBA 3S3TA 1GAXA 4HJXA 3FHJA 3PNBA 3Q4GA 3CLUC 1ILEA 4PY2A 2I1LA 3CLRD 1H1TA 3IDFA 2CV1A 3H99A 3VRHA 4ZT2A 2BTEA 3IUBA 1J09A 3PXUA 3G5AA 2GOYA 4UZEA 2ZUFA 4ZCRA 3HV0A 4G6ZA 4MW6A 1EUQA 1IH8A 3BL5A 1IHOA 2J08A 1N78A 1JHDA 4MW1A 1Q77A 2A1UA 1OWNA 3P0JA 4NZPA 4ARCA 3SEQA 3X1MA 3NBKA 5FNZA 1U7XA 3CLSC 2A88A 3COZA 1N2JA 1EE1A 4DDKA 2ZP1A 3RK1A 1J70A 1YULA 1KQNA 1QU2A 3Q12A 1IRXA 4QBTA 3X1KA 2YWCA 1JECA 1B6TA 4EG3A 2O5RA 2H2AA 1ZUNA 3COWA 5J5AA 4YMIA 1N2GA 5KWVA 1X6VA 3UY4A 4Q93A 4EG4A 2GM3A 1G8HA 3ND6A 5K0TA 1QRTA 4XFJA 1KORA 3IVCA 2E0IA 3ZUGA 3D6UA 5KCMA 1MBZA 1EUYA 1I6KA 4MW0A 2WQ7A 3GUZA 1GTRA 2IP1A 3KT6A 3QTTA 1NI5A 2X3FA 1VBNA 3COVA 2A7XA 4ZCSA 4A91A 1I2DA 3TQOA 3UC5A 3QE4A 2VTBB 2AZXA 3H97A 3KT8A 3DO8A 1O97D 4MULA 3SZGA 3CLRC 1OD6A 2DEUA 4CDNA 3X1JA 4KR6A 3FIUA 1O5TA 1A8HA 3SDBA 3P52A 4R2LA 2RE8A 1NYLA 3UK2A 1K4MA 5TEVA 3CVWA 4U8HA 3N2YA 3RBAA 4EG6A 2J5BA 2YY5A 2A1TR 3CVUA 1M8FA 2X0KA 4I6JA 1SURA 1O94D 4MVCA 3UMVA 4BWVA 4KPUB 2YXNA 3INNA 4F3RA 1N75A 1N2OA 1M8KA 3HGMA 1G8GA 2WSIA 1NUQA 1QU3A 1N2HA 4I6EA 5DEOA 1M1ZA 1IFXA 4ZT3A 1T9GR 3FWKA 3IVXA 4MUEA 4E1AA 3KT0A 2PIDA 4XFDA 5J59A 3PRHA 4ZT4A 5K0SA 4G5FA 2WQ6A 5FO0A 3P0IA 3HZRA 3SZ3A 3H05A 1D2RA 1U7DA 1FYDA 3IUEA 2H29A 1NUTA 1Q15A 3F3MA 1N2EA 4MUKA 1LI7A 4MW4A 4ZCTA 1T6YA 5TS2A 4KPUA 1WQ3A 2QTNA 1F4LA 5TGTA 1KH3A 1EFVB 1K97A 3TNJA 2E21A 4G5YA 1F9AA 2AG6A 2RD2A 4NX2A 1N3LA 2PZBA 1S4MA 4DNXA 1U3DA 5LFAA 3OTWA 3ZXIA 1VBKA 4NAHA 1FFYA 2AKEA 4JYZA 4OUDB 3ND7A 1GZUA 1KH1A 1QRSA 1IVSA 1PFYA 1N2BA 1OWOA 3M5WA 1WXHA 2J07A 3IOCA 5DB4A 1I6MA 3DLAA 1YI8A 1QQTA 2A1TS 5BNZA 3SEZA 4MUJA 1O6BA 1K4KA 3N05A 3UOWA 2JANA 1EFVA 2QUKA 2Z09A 1JGTA 1WXFA 5LLTA 1H3FA 4NDAA 1LW7A 1GN8A 3ZIUA 3HFJA 2NZ2A 4KR9A 2E18A 1P7PA 3AL0C 2DPLA 4J75A 1WY5A 4MW2A 4OJMX 4ND7A 4JXXA 1NZJA 3IOEA 3FI0A 3CVYA 1ZH6A 3FY4A 2Z08A 3H9CA 1M8PA 2X1MA 4MLPA 4EG5A 4K0RA 4ZT5A 4EG8A 1XNJA 1J21A 4QREA 3LCJA 4JXZA 1XJQA 2V0GA 2HZ7A 1COZA 1KP3A 3H9BA 4I6GA 2NSYA 3TZLA 1JIKA 1JIJA 3JXEA 2QJOA 3RHSA 3I05A 1ULHA 4UZFA 2EJCA 2G36A 2PXHA 4R2MA 1YIAA 4H3SA 1KH2A 4MUGA 4MW9A 3L93A 4MW5A 4R0NA 2YWBA 3AFHA 1XNHA 3ISJA 3MLAA 3CVXA 4FZJA 5IJXA 1MRZA 1TQ8A 4MWBA 2JA2A 2CV0A 1WXEA 1JMVA 4EG7A 4ZT6A 1GPMA 3KFLA 1J1UA 2VTBA 3OP1A 2CYBA 1R6TA 1EFPA 3G59A 1R6XA 4HPWA 3CLUD 2TS1A 2VXOA 4ARIA 1O96A 4RUKA 1WXGA 1T6ZA 4EGAA 1TYCA 2QUHA 2X1LA 3CLTC 3TS1A 4P2BA 1O96B 3ZXSA 3CVVA 3A2KA 5DASA 4OUDA 3CLSD 2Z3VA 2XRZA 1EJ2A 1TEZA 3GMIA 5KHAA 4CQNA 3NV7A 1KQOA 3TQIA 5TEWA 3AKZA 3TZEA 3HL4A 1U3CA 2GKSA 4S1OA 2CUZA 4YP7A 1NUUA 1V8FA 1UFVA 3K9WA 4MAFA 3ZGZA 1R6UA 2JAXA 1DNPA 2DR2A 3VGJA 1IQRA 2OV4A 1Y42X 1KQPA 2B7LA 1F7VA 2CV2A 1U0BB 1CT9A 4CDMA 4DDHA 3ELBA 2A86A 1TFUA 3FH0A 1G8FA 4PBSA 1QNFA 2BYTA 5H16A 3IVGA 4J76A 2QUIA 3DV2A 4ZT7A 3ZJUA 1WQ4A 3ZJTA 4AQ7A 3MXTA 4MWCA 4CT0A 2DUMA 1KAQA 3A4IA 1JEDA 2C5SA 1N2IA
chains in the Genus database with same CATH superfamily
4URFA 4EI8A 4BX8A 2GJ4A 5LWQA 4GAEA 1ZIDA 2EERA 2QJFA 3CZ9A 4H3KB 4BNVA 5F12A 3MERA 4ZV7A 3N58A 5IW8A 4H18A 1CQPA 2ZB2A 1KEPA 1OAKA 2QAIA 1HLGA 2NX2A 2VP6A 3BCHA 1CP2A 1E1QA 2OLJA 4G24A 4WNAB 4IFBA 3AUSA 4GXTA 2C2YA 1PFGA 2DQ4A 1GQQA 3CT4A 1AKUA 1V7CA 3B2EA 1Z7GA 5CU7A 5LYJB 1H2WA 1T5SA 1YDMA 4NKRA 3OPYA 3F5SA 4ZU6X 3NHYA 4RULA 1MNQA 2VPYA 2E6KA 2HNKA 3AETB 3CKMA 1L5KA 2DPMA 2DWQA 1OGJA 3O4RA 1EUDB 2CW5A 2NXEA 1AU9A 1FSGA 4F1WA 2VBFA 3ERCA 1QV7A 3H6HA 4CUJA 3WBFA 1OBFO 1DT5A 3KTAA 2VT6A 2AFIA 1U11A 1QFSA 3VC7A 1NF9A 3IMFA 4KVFA 5G4LA 4C7JA 1OWLA 5KSYA 1SIUA 2B83A 3JWGA 1HTTA 2P4SA 3EQ2A 2NZVG 1O7JA 4P80A 3WLTA 1BIFA 2G9UA 2XBLA 3PEEA 1TGVA 4C6SA 6ABPA 2QX4A 2AOUB 2FUG6 5ARCA 2ZDQA 1AIPA 4LC0A 4B6SA 5FTKA 3C41J 3QBTA 4JJZA 4B7AA 5KEIA 3ORSA 3TH5A 2IQ5A 4CFSA 2NADA 4I5EA 1BMTA 1T8TA 3WBKA 3CNBA 3PJEA 1NE2A 2EEZA 1M8GA 2OCLA 3IJPA 3DG9A 3L6RA 5KVSA 3K70B 1V35A 3Q5EA 2F1RA 3HFRA 2OB1A 1NJ8A 3ODGA 1XEFA 4QNMA 3TZKA 4E3ZA 2WHYA 4PR0A 3GJ8A 3GN2A 2FRXA 4AF8A 1ICIA 3C3PA 2E7ZA 4Q6BA 1QFJA 2P0AA 2F7SA 2GILA 1PG2A 4C6HA 3A31A 2O8DA 2ZWOA 1N6RA 4PZUA 2QX6A 1A1SA 2RH8A 2Z04A 4ZAYA 4L51A 5GJCA 4R9RA 5F23A 3OPYB 3NETA 4IO0A 2FMTA 2V98A 3EGDA 1AHIA 4GMKA 4YMVA 3K09A 1C9NA 2ZRBA 3RHFA 1U0TA 5E6SA 1W93A 2RBGA 2B5VA 1U5CA 3K3PA 3LRXA 4FFBB 1DRUA 1PNTA 3SIRA 1FNDA 4W1PA 3SQNA 2YJ4A 1XJCA 4XIJA 1RCTE 4LF7B 1ONPA 1OIWA 3CCBA 3HI6A 4JB8A 3U62A 1HE8B 1QDLB 5B55A 2I91A 3QQ5A 2JJ8A 4ZZ2A 4CETA 1XF9A 5ALQA 2PRYA 3H9UA 4ND6A 4Z9AA 1VHJA 4Q1DA 4DG9A 1K9SA 1U3TA 1P39A 5E7MA 5JSZB 4D2IA 1OA1A 1QG4A 2YINC 3U7QA 4YT2A 2CSUA 2DKFA 3U7FB 4D79A 4BO0A 2H1OA 1BDJA 5F1OA 3T3MB 3V8QA 2FEKA 1O2DA 3GBSA 3VUEA 3EG9B 4ZAFA 3LT2A 4YRLA 1C1YA 1F0YA 1HYEA 3H7IA 1HFJA 3INGA 4L07A 5IFKA 1B6RA 2Y9MB 5IKEA 2I80A 2PMWB 1TLLA 3GJYA 4R8SA 4XR4A 3AHGA 4OBBA 3GLQA 1Z9BA 3GQBB 2IWHA 1YRAA 1GPJA 1KK1A 1YBFA 3D5TA 3NVAA 4DA4A 4F04A 4JKYA 1YQEA 4XGRA 2Z83A 3L8EA 3W77A 1U1GA 3VH4A 4TTRA 1EE2A 3EMVA 1P1HA 2VVTA 1GDDA 3AZPA 3Q85A 4GKAA 3UHAA 3UUGA 4N01A 3WZLA 2VPPA 3EFOA 2HAEA 4V0NA 2W2MA 2GCOB 3E82A 3GRKA 2HMYB 2GPBA 1TE2A 2WF9A 3DYIA 3V55A 1OH8A 1MABA 1BWPA 3U1VA 2PXCA 4L5IA 3O82A 1M6YA 4XUEA 4EH1A 3SVZA 5COAA 4HN2A 5CM2Z 4B79A 4F3NA 4EG1A 4F11A 4A15A 2F4NA 4WZBE 3S2GA 4YTEA 2VRNA 3R5JA 4JFAA 5G3YA 3FTPA 1SK9A 4C2UA 3AM3A 4JGBA 5DHAA 1QGOA 4D4KA 1H4SA 2I71A 4R1TA 1JHQA 4S0ZA 1P4AA 1ZCBA 2AFIE 3UB4A 1AKVA 3JQRA 4CMKA 1UIRA 2MSEB 3CLRD 3HYNA 5KJ1A 3WQHA 1KZ1A 1R0LA 1RLIA 2YJNA 5TT0A 1U1CA 3I5MA 5A5FA 5JS8A 3OZEA 4JV5B 2BBSA 2H5JA 4N8SA 5EE3A 3MELA 3J7AC 4MHTA 3IXMA 3OIUA 3VR4D 1D1SA 2Z98A 3V42A 3IAUA 2WJ6A 3GW8A 1XBTA 1Q14A 1RAFA 3MTEA 3WHKA 2FJPA 5AW3A 3KCQA 4LNUB 1FS4A 2FZEA 4XXHA 1PNRA 3FUTA 4IX9A 3UMMA 2PKYX 4H6PA 1NW4A 3VKGA 2P2LA 2NSDA 1VPEA 4H2DA 4RHCA 4RZHA 2JFHA 1J2JA 3GUVA 5G0UA 3OKAA 4QLOA 3K9HA 3N1UA 3SEQA 1XFDA 2OBLA 1XTBA 2A88A 3IQGX 3ICPA 1LJ8A 3G49A 5ERGB 5JYBA 4MJ3A 1CZNA 1E1RD 2OZKA 4J8PA 5DWVA 1RXYA 4FBLA 1IHXA 3DLPX 4OX9B 2ZZKA 2WKRA 1CDDA 5K0NA 4B4WA 5J2UA 4ZALA 5AJWA 1L5SA 1SHZA 5FUXA 1TM5E 4EUFA 3AERB 2V1XA 4GEKA 4LXHA 2XVAA 4YMIA 1YDHA 3R40A 4GM1A 3BXFA 5ELLA 2FN4A 2W7TA 4B76A 1VLMA 1XRJA 3LDUA 4PZCA 3KB2A 5IUJC 2FPGA 3V1NA 3PUKA 3IBSA 3TKLA 4I19A 5IJWA 1SO8A 4REOA 4CBVA 3D6HA 1NQAO 4G23A 3SS7X 5C1PA 3OD5A 1XA3A 2HYDA 5I01A 5F9HA 4QLAA 2PSHA 2XIQA 3FI9A 4HXGA 2WSSA 5TB5A 1LTQA 3ZV3A 2PUAA 3QG1A 4K9RA 3GLIE 3CG0A 1ZH2A 2ZTVA 3MTBA 5BOSB 4LISA 2GWHA 4LCBA 4R6WA 2G17A 4BZWA 4C07A 1X1SA 2AL7A 2HBZA 5DP1A 4ESHA 4OCZA 4N0QA 4WK4B 4WOJA 4IDPA 1E7WA 2PL9A 2RCYA 2W2QA 3DTVB 1Y3DE 3CUVA 1YDEA 1UBHS 4D7AA 4EELA 2YWXA 2DEUA 3HWRA 4CN8A 1T35A 4PYKA 4QODA 3GGGA 3I2IA 1DBWA 4KLZA 3RVSA 3VV2A 4B75A 1QV6A 2FZCA 3ZIAD 6REQB 3IE2A 3DF7A 1I9CA 3B1ZA 4F84A 1JMYA 3NNDA 2W2TA 2XWBF 3LMKA 4UBIA 2B4YA 3LDAA 5IS2A 2VHXA 1G0OA 3E23A 2Y0EA 5DHRA 3ABRB 3NGMA 5TEVA 2W70A 4RTLA 3VZQA 1A9QA 3A1SA 5ETJA 1HL7A 1NFRA 1I4WA 3AHEA 1TFRA 3AR9A 1T9CA 1KYTA 4CU2A 5K03A 3U31A 3KE8A 4NEHB 2O8FB 4RJTA 2WV7A 5JO9A 2QG6A 4BKRA 1P7YA 3GEPA 4TMVA 3TLEA 5JDIC 5EZ5A 3NBFA 5BSUA 1QS0B 4B9AA 1A9XA 1GGNA 1Q1BA 4IDNA 4ZODA 4IGFA 1JLLB 3TK1A 1SA0B 4KGZA 4FCWA 5A4KA 2B5WA 2BZSA 4MEJA 4BE7B 2G88A 2DWOA 3FDJA 1JIVA 1SUIA 3KJHA 3KKNA 1A9XB 3R09A 2ZT8A 4M0PA 2WQ6A 1C0IA 3W1WA 4FQ5A 4PWYA 2WYVA 2CVQA 1B23P 4UTOA 3RT7A 5ICCA 4O4LA 1XN1A 1DG3A 5ALNA 2JJYA 4ZC1A 2HU8A 5ILGA 4EEZA 1XTSA 3N59A 3TE7A 1Y9ZA 5ICFA 1LI7A 4P58A 1CYDA 5HNKA 1W6UA 1NBMD 3FFAA 1DOZA 3D6AA 2VF7A 2HJGA 4S3MA 1LDMA 3OOWA 3O8BA 3QVWA 2BFDA 2P7HA 2P7IA 1PYGA 5TGTA 5AK4A 3T94A 2JH9A 2DHCA 4FOLA 1CZLA 4R3WA 2OCAA 5IFLA 2BH2A 3K6JA 5AESA 1G0NA 2DG2A 2GRJA 4FMCB 5BR1A 1N3LA 1C4XA 1RXEA 4CFYA 3WWZA 2L69A 3WFJA 2XYVA 5I9NA 4J16A 5C8YF 4J7XA 3J81A 3GMDA 2BMJA 1GGVA 4KWCA 2PX5A 2KBFA 2GK3A 4TSFA 1L8LA 2WMYA 3E2PA 3PC8A 2RGGA 1KEVA 3R0VA 3BK2A 1QGUB 4IIUA 2Q9CA 1KDVA 1Z0SA 4OJTA 3SE0A 5JATA 5FHQA 3WNCA 1AA9A 2IIVA 1E7RA 1ZNZA 3OE1A 4RSMA 5JWHA 1SHKA 5LL6P 4NOLA 3ZGXA 3ZIAA 3CX3A 2PH5A 1TCUA 1R0KA 3GZNA 3LKVA 4LMAA 3W2FA 5KHLB 1I6MA 3QI7A 5HF9A 3WLRA 3LC1O 4YQZA 1WTCA 1JEJA 2RH5A 1PX0A 1Y8QB 5EZQA 1TKAA 4LNAA 1RS0A 2P9ZA 2ZRPA 3TLZA 4X93A 1U8TA 3MGBA 4P36A 5BWMA 5E9AA 5CT4A 1LJUA 1RI4A 2X2OA 3CUTA 3I6YA 1G3MA 2ID9A 3KWFA 1Z5PA 3PX2A 121PA 1WPXA 3FMGA 5F5XA 3THOA 3WIOA 2YWEA 5IAKA 3HZHA 3CYFA 5CH8A 3HFJA 4PVDA 5ENZA 4A92A 4C0SA 2WD7A 1P7PA 3FPHA 4YJGB 1UBKS 4YJ3B 4DCCA 3PDHA 3AL0C 4OL0A 1JEQB 4DTCA 2JFPA 1B8PA 3HXPA 3U17A 1NHGA 4POOA 5B4TA 4GECA 4QFMA 1XD2B 3HCOA 1U7PA 5E4JA 3COPA 3RS8A 3P9IA 3RHZA 2FEPA 2BFDB 2GD2A 5JHHB 2ZAYA 2BBTA 3TF5A 4MLPA 4TZ6A 1DJLA 2IYQA 1DAGA 4GICA 3LSTA 3U56A 4YROA 4DA7A 4E7OA 4O2AB 4RMIA 4M0DA 4YDSA 5FLXA 1DRWA 1U4SA 4XYBA 3WGMA 1ZY2A 1RIIA 3CPJB 2C8KA 4BFZA 1ZW6A 2A1IA 2C2XA 4I55A 3T9BA 3ZTWA 4LZAA 1NJ1A 1AGXA 2EX1A 3LHSA 5K8VA 1V71A 2VZEA 2GA9A 4O2BF 3VV3A 2ZREA 3DGFC 3E0XA 3QE0A 3UA3A 5ADWA 2WTBA 1X42A 4R7ZA 1ZKDA 2Q99A 1G64A 1EU1A 1EGAA 2PMCA 1DUSA 1WP4A 5CFQA 4Y6OA 1VZ2A 1VPDA 4HB0A 1P4RA 1IOLA 3Q98A 4M8SA 4EECA 5I7OA 3KZKA 2D06A 2X0IA 4XYGA 1GSIA 1R8JA 3NEYA 4BNUA 4MLCA 5EJAA 2FSIA 1QIFA 3WK5A 1ZOPA 1QC5A 1BGXT 2I76A 3AVTA 1LXCA 1PS0A 2CVOA 4UHKA 3OCXA 2RB4A 3TRHA 3TBHA 4IV5A 4M46A 4CQLA 1OXTA 4WJLA 1XNHA 5F7ZA 2OYRA 5AMXA 2GVZC 3SKXA 4BNTA 4BTVA 1FTSA 5D8DA 3ZE0B 4DYHA 4KAAA 4WVFA 4OSPA 5IK2D 3GRVA 3M70A 4L85A 1V3TA 2JGFA 4EG7A 4XQ9A 1Y5RA 2DC1A 2H11A 4Q9JA 4X1KB 4WDQA 4UVEA 3P94A 4X7BA 1ZMTA 1MFZA 2NNLD 2P2SA 2C0CA 4IZHA 3ROXA 1QG2A 2BW0A 1IM5A 2J3EA 3CSSA 1Z4OA 2GJAA 1DIRA 4LOJA 2C9ZA 5KNBA 1B2RA 3RYHA 4YDQA 5FOUA 4ARIA 1RP1A 4IIJA 4KIFA 2ZJ2A 1VLZA 1Z6GA 2BEVB 2G28A 4WFKA 3TJZA 3WA7A 2X23A 3KKPA 4FE4A 5LMNB 3BRCA 4QIHA 5IASA 2I67A 3GCGA 3K70C 1CR4A 1SY7A 3B3QA 1MG0A 3GCWA 3W5CA 1LD3A 1EWYA 2CZQA 2F48A 2HLDD 1HQYE 2VSNA 4NJEA 4P2BA 1TD9A 3HHEA 3P2EA 4NE7A 2W4MA 3SKYA 1ZGCA 3VJMA 1ZSYA 4URWR 4DV6B 4D80A 4JVNA 4EW3A 4YRPA 3RTAA 3CX7A 3LZCA 3TTXA 5DW0A 2GWRA 3PQ4A 3U40A 3WJAA 2OCXA 1TD1A 1BVUA 1E92A 1XWWA 3F7NA 1VMDA 2JZOA 1MHPA 3BRWA 3PQ8A 4F8YA 2I9PA 1C30A 1RWOA 1R2QA 2W00A 1UFVA 4GI5A 3LOUA 1WBJB 3CH7A 2R3SA 3SLRA 3AEUB 5KOHB 2P3QA 4DM3A 3PVSA 5DM1A 1QC5B 2HHJA 1TTQB 4E46A 2YV4A 3LP6A 1ZU4A 2O06A 3H9EO 3K94A 3CW2A 3L7AA 3OOJA 4M54A 5IUKC 3WMRA 1EQAA 1U3GA 3LY7A 3USZA 3ZNOA 3P0EA 1ZBDA 3AJDA 2WNSA 3L8ZA 1ADCA 5CXQA 2IPAB 5JNUA 5F9MA 1DIGA 1WDTA 4OREX 4AUNA 1HBJA 4YB8A 4Y6QA 1SUDA 1UDAA 3ZKAA 3WRVA 3DV2A 1XU9A 1JIXA 2NTNA 4NOKA 1WQ4A 1DL5A 1V1RA 3IUQA 3N3BC 3QFHA 1WEKA 4FDAA 3R7WB 2QE7A 3WLNA 4Z1MD 5JXGA 3MXTA 3VKWA 1KFEB 3GJ4A 2F3QA 4OF4A 3A4IA 4LBVA 3A11A 1N2IA 4FPXA 1OROA 2NTVA 3I6IA 4H4CA 1Z6TA 4LYHA 2PE5A 1ZR4A 4HL6A 2KM1A 5LQSA 3TFWA 2H2FA 1NZFA 1R6VA 1HFWA 2C5GA 2WIKA 5JDIA 1R27A 4YMGA 3EWSA 2CWDA 4I36A 4FCCA 4IVPA 1Q19A 3FVRA 5HK8A 3RRYA 1PDOA 3KEQA 4RA6A 2O7RA 5BMVA 2QJTA 2AVNA 4DTIA 1B1CA 2X1VA 4IUCS 1E9DA 2GEUA 2WM9B 1P1IA 2EKDA 2H7CA 3H11A 2ZUEA 2IK8A 1GTSA 4KPEC 3WR5A 4LJ6A 1PZNA 1Z6ZA 1PV1A 2FW9A 4PRKA 4TL6A 1LLDA 1DFIA 2PZLA 4RPJA 5EEGA 5BT9A 4YPOA 2GCGA 1RPNA 1H2RS 2EVWX 1EBBA 1FDSA 1JS1X 2RG1A 3FPFA 3E3LA 3K16A 3QHAA 4PAOA 1SHJA 4ZREA 4OHXA 5F78A 2J0EA 1GTG1 1NVVQ 4PRYA 1OYYA 2WJIA 1NYTA 1T2UA 3AQ4A 3H6GA 3H8SA 1CG6A 1M76A 2E85A 1Y0BA 3K05A 3OJWA 4FYVA 4RHTA 4N5IX 4LQLA 4XD7A 3RABA 1DC5A 1U5BA 1U2RA 3DZ8A 4LHVA 1GSAA 3P9PA 3RVPA 4GKJB 3Q3CA 3A6DA 5FOTA 1PO7A 3CRMA 4K8OA 5CM9C 3T5BA 3F9IA 4PC7A 5AICA 1S9DA 3B7PA 4EGFA 2WWGA 4AJ9A 3IALA 2PLFA 3E53A 5CDTA 4GWGA 4OXKA 2D13A 4KQXA 3H2HA 3UMFA 3IJ5A 2IXTA 2W8ZA 4I1UA 4WSOA 3V00A 2YVKA 1W1UA 3HGQA 2V0CA 3CF2A 1Q11A 5HG0A 1R16A 4FX2A 1DTSA 4FN4A 3WLPA 1R64A 1UKYA 4HS4A 2AWNA 4OB7A 3EBOA 2PH7A 3NVDA 2WSBA 1BGVA 2CJXA 4WASA 2DQYA 1EM8A 2A0WA 3CUEF 3E2MA 4ZQBA 3QUSA 2GCIA 3E1SA 3IQEA 4H1VA 2VJBA 4RXUA 3RE1A 3S2YA 3WIDA 4ZOEA 5C9ZA 1GLNA 5MN4A 4WAUA 2WTAA 1K6JA 3DZIA 2WY2D 1ZHOA 1GCIA 1ODFA 1OXSC 3AF2A 3E7FA 1XT6A 3PHIA 3NZEA 4JXJA 3R7WA 3SKVA 3WSVA 4CIDA 2PO5A 5HQ3B 2PUBA 4EEKA 1EINA 4KWHA 4RO0A 3RU9A 2HA5A 1YR1A 2WSMA 1ZONA 3W8RA 3KLBA 4JKIA 4KRGA 4RTMA 1X1DA 2CE2X 4J94A 4HAVA 1EVIA 4DSAA 1XZQA 2JGAA 2O0MA 4HDCA 2J6HA 1KP9A 2Y77A 4M55A 4LYEA 1I13A 2H7VA 1X92A 2L2QA 2NV6A 3FYUC 1W0JA 1PHPA 4PYQA 4DLUA 2NM0A 1M5RA 4H7KA 3ZE1B 2IXEA 5BV2P 3PKZA 3DQQA 3C5HA 1RFGE 4DMFA 5BQ3A 3MAJA 5CCXA 4YCDA 2J4FA 1GFZA 1GPBA 3WLKX 3ESRA 2O2XA 2OGSA 1F06A 3PEUA 1M75A 4MXDA 4RZIA 2YWHA 1X9IA 4DCPA 5JJCA 2IYNA 3FJ1A 4TZKA 4IJUA 5IVHA 3KUUA 2R6AA 3N8HA 4NXNB 1PL0A 1UAYA 4ML3A 4CIXA 4ZYTA 2Z1DA 3V4RA 1QUFA 4Z54A 3O74A 4LRTB 4DFDA 3DNMA 3UPTA 1AO3A 4KRXA 4BGUA 2VEOA 2OUIA 4JFRA 2UVPA 1YB4A 4PAQA 3GJ0A 1Y1TA 1HE5A 4JLJA 1BHJA 2GN8A 2I65A 2J6CA 2ONKA 4NPAA 3G7UA 4A16A 4E4RA 3QKRA 2YFQA 4TQAA 5A9TA 4LMRA 2SNIE 4MVXA 2I2FA 2V5VA 1MZPA 2IPXA 1YQTA 1ENYA 1ZH0A 4NBWA 4NCIA 3DE3X 4QFBA 5JMTA 2SKEA 3OKPA 4WE3A 2KBEA 1Y8AA 1XZEA 4DMMA 4X6XA 1OT3A 3IO5A 3Q10A 2V5UA 2A78A 2CVPA 1P0FA 3BF8A 3OC6A 2KQUA 3CURA 5L6LB 2IHKA 1U99A 3B9PA 1QHHA 2OKCA 3FHJA 4ND3A 4LHEA 3CLUC 4AW9A 4WTOA 1Q0RA 2CDRA 1JDTA 1SQFA 4PY2A 5AJUA 5B3KA 2PUFA 3PXGA 1POWA 3ZR4B 3DAFA 4UTZA 4ZVUA 1UUFA 1ABEA 1XX6A 4CMCA 2CV1A 2O8BB 2ZT6A 3AI7A 3OC0A 1PV4A 3NGLA 4CLOA 2QE7D 1WUHS 3MQ4A 1OXMA 3C6ZA 3IEXA 4CMHA 1HE3A 2PLNA 3S5UA 1BW9A 1H9AA 1S1MA 2IDKA 4ID9A 2EV9A 2QLMA 4F38A 5I3ZA 1QX4A 2CGEA 2GSWA 2ZRIA 1M34E 2CXHA 3AHIA 4GR4A 5J2TF 4BQIA 1JYEA 3QVKA 1G21A 1UEJA 4OQFA 4DSTA 1UM9B 4K26A 3KOUA 1B42A 2ZETA 1YVDA 2NO1A 4BWYA 2R84A 4R1LA 1MZVA 1JHMA 3FMFA 4Q3AA 3HB1A 5CM8B 1AUQA 1WCWA 2IHNA 1UBJS 3B48A 5GINE 1BXGA 1JKMA 1II9A 5P21A 5G0VA 5A4JA 4G1MB 3SJ7A 1K3UB 5FWYA 4CL3A 3KTDA 1MW9X 1PU2A 5AI9A 1NQXA 3F2VA 2QTWB 3D2LA 5TQVA 2NU8B 2XXAA 2J3KA 1GARA 4ETMA 3NI2A 2FPIB 4K9SA 1USWA 2IT1A 3GGJA 2VZ8A 1Y7HA 2JK0A 2K6GA 1MO5A 4FTWA 1MP0A 1S8OA 1TKBA 3C3MA 5E6UB 5IBQA 3TLJA 4CMIA 3TOCA 1YSCA 4LDNA 3U3OA 3X1ZA 2PMEA 4Q1FA 4UCWA 2GSDA 3O8NA 5HEKA 1LBIA 1V11B 3FCXA 1YJ8A 5CTJA 2R97A 3NBZC 2X4IA 1GGJA 1AURA 2BEUB 2OFPA 1BRTA 5BYKA 4TL9A 1VQ1A 3DLIA 5E4YA 1FRZA 5DFAA 1X2EA 4IXTA 1Q44A 3N8IA 4DRZA 4TPKA 1P72A 2ASEA 2GHIA 2ZYDA 3D3JA 4EYGA 1YS7A 2DE0X 1OJ7A 1W87A 3F6YA 3QPCA 1H2XA 3KOZA 4MW0A 2Z4RA 4Q9IA 4MLZA 3ABOB 4KK4A 1PBTA 3KT6A 1S4QA 3ASUA 1RZVA 2GCOA 3ZZMA 2HJHA 3OPYI 4PAGA 3FTNA 1YXMA 3C8UA 4RQTA 5BN3A 4DV0B 2BTQA 3LQRA 3I0NA 4J03A 2HFJA 1UBLS 5KKNB 4Z7NB 2HPVA 3A58B 4P4GA 2IHZA 2RONA 5FBKA 2GXSA 2WM3A 3CEAA 3H97A 4X6UA 3V7NA 1NIPA 3NBUA 2I8CA 2WFZA 2WKPA 3EVDA 4PPQA 1OXBB 4EB6B 5K8TA 2OP0A 3AR8A 4FX5A 4P5EA 3GFRA 1NW9B 5HCUA 1ABBA 1KVQA 4BZPA 5CHYA 4M4SA 3R3YA 1X94A 3C7CB 3REQA 4YPVA 4WINA 2UVDA 3LY8A 4P0TA 3DBIA 4MQBA 4CU5A 1Z29A 3QYJA 1LDGA 4HEA6 4Q7EA 4Q9AA 3RW9A 4JBLA 1BH6A 1S01A 2JAWA 4LPKA 2WM2A 4ENUA 1AGNA 4RC9A 2ZYSA 1R3UA 2PJZA 3RAFC 1RM4A 4NMMA 2I2AA 3N2YA 1XPUA 3QXSA 1CBUA 4QNNA 2IPNA 2QRPA 4KI7A 4HPXB 4CM9A 4N76A 2P30A 2R79A 1JA9A 2EOAA 1DIOB 1G2OA 3S0JA 2I7CA 1EB9A 3OM0A 1NL3A 3M5PA 3V48A 3RSOA 4UM8B 1Z2DA 2MU1A 3LW7A 4KE7A 3W5VA 3ZWAA 3I64A 4HUQB 1RJWA 2ZR0A 5AT1A 3V9AA 5BYBA 1JV2B 2BFNA 2RAPA 1TTPB 3QKIA 3DJYA 1XEAA 4BVBA 3AVWA 3QPBA 1RQ7A 1AOXA 2DFKB 3I73A 3HCDA 1DAFA 3Q3GE 1S8NA 1YJXA 4IEFB 5F1KA 3T7RA 2WWXA 4D26A 4NMLA 3SZ3A 2UDPA 2WF6A 2ZJYA 3L5KA 1I4LD 4WPGA 4R8RA 5BUSA 1PFKA 1FYDA 3GFOA 4ZRDA 3PXAA 3HJCA 3T3NA 1Q1EA 2C92A 2H5LA 2C9BA 3GDFA 3I58A 1E0JA 4PAWA 2C5FA 5LLSA 3U81A 2UYHA 1GNSA 2G4VA 4QT4A 3RAGA 1T2DA 3ROPA 1RWWA 3DQZA 1QYCA 4H35A 3RPEA 4YFYA 4ZCTA 1NKSA 1T6YA 1RRMA 3IESA 1NVBA 4HH1A 1NVAA 2RHTA 4KEAA 3FKSD 4NBVA 1YDWA 1G20B 3QVGA 1CIPA 3R5HA 3OFVA 5EFZA 4A3SA 3VI3B 3VI4B 4MB2A 4ZV4A 5IF9A 5JY1A 3D3NA 1PUIA 2ZJ1A 2E82A 4G5YA 3W4KA 4BMDA 4Y9SA 5ELMA 3NCHA 5C5EA 3ORYA 4EHFA 6Q21A 1L7PA 5EIBC 4P3YA 1BHO1 1CQIB 1ESMA 2CDAA 2PCJA 3CTMA 4LTDA 3OTWA 3C8HA 3WLQA 3GLFB 5EKUA 2QQGA 4UOZA 4MK4A 1N7IA 3WDSA 3QEJA 5FBZA 2XNHA 3PDIB 4GI7A 3GLUA 4ND5A 2JJ1D 3BZBA 3EWIA 4E2XA 3BQ9A 4CIVA 1EFDN 5DBEX 2XB2A 5AH0A 5FNVB 13PKA 1UMDA 4KQKA 4NU8X 2BONA 4BU1A 2ZWMA 1MV5A 3R23A 4PCAA 5DNCA 1QQTA 2OAEA 1SWVA 2A1TS 1Z7EA 1ZN9A 3KOYA 4MKRA 3OEHA 3ZDZB 1K7SN 2OV6A 4OJNA 4EYQA 4L8FA 5BNTA 4YRNA 3ANNA 1OW3B 3TEFA 1XTPA 2JANA 1RDFA 4NNJA 3G2QA 1XRNA 3N2NA 3TW6A 3A4LA 3HCFA 3VVMA 1MKYA 3ZDFA 4FMPA 4C05A 1SOMA 1FMLA 1BX1A 5COBA 1MENA 2HT1A 3FNHA 3R5TA 2E18A 5DTEA 1KY2A 2EZ8A 5B1SA 3AQIA 3C1UA 1AMNA 1A0OA 1Q7TA 5AKHA 3QMMA 2HHCA 1RRFA 3ACDA 1XDGA 1PD0A 2WJWA 2XZPA 3LQFA 3VOBA 2Q0XA 5B64A 1V8PA 3DAOA 2JFXA 4UUMA 1C7EA 4CZ2A 4CXMA 3PX3A 2JLBA 1ULSA 4RLHA 4Z9XA 4HY3A 1KR5A 5AJHA 3TOVA 3WNBA 1IPFA 1RXIA 2YV1A 4KVAA 4EG5A 3N76A 5ITVA 3ACBA 3GF4A 2ZJ6A 4MLDA 4E1BA 1NW8A 2DYKA 2WPDD 4C6TB 1F8XA 3CUWA 1XCLA 3RS5A 4DQ0A 2OQIA 4F97A 5L7TA 1RKXA 4YALA 1SVWA 4XM0A 3THYB 4JLNA 3EDOA 4UEOA 3VR2A 4LXYA 3DPUA 4BFLA 3L49A 3SF8A 3TZLA 3DBRA 1UMBA 2FWJA 4GUAA 1M33A 4UPEA 4ZHSA 3FHTA 1S2MA 3OMLA 3TMYA 3C97A 3RHSA 4EI7A 4IJMA 1XZCA 1EFHA 1KXJA 2KJQA 3BXHA 4OHMA 4BV2A 3HKCA 1KIMA 4CEJB 1QPBA 1DX4A 2YJ5A 1IEVA 4B48A 5C7OO 3HYSA 1RYHA 3C6KA 4KBYA 1SHTX 1HOTA 4MI1A 5TVKA 4N6OA 2B8TA 3NHKA 4DWWA 2FMKA 1DHRA 4YUWA 3MWEA 4OMFG 4EQZA 3GGSA 2BFFB 1RLOA 1T5IA 1UWVA 1WB4A 2ZRCA 3T12A 4G4IA 3AFGA 4YO7A 4EA8A 3B2NA 5KVQA 4QUAA 4Y0AA 3ANSA 1XZDA 1U9CA 5EJ9A 1P2TA 2OP1A 3A1UA 4GM0A 4R54A 5HJ2A 2B4RO 3K1AB 3NG1A 3HPRA 5A71A 1OFVA 1TT5A 5ITWA 1W9MA 2UAGA 2VDVE 1RQPA 4R2HA 3MOGA 2HT6A 2TMKA 3WC4A 2QM0A 5K0GA 9ATCA 1TM1E 1R6XA 3L79A 3DL0A 3WGYA 2HW8A 4RIFA 1XNRB 4HGYA 1GL6A 1E5TA 4Z0HO 1QUEA 1YJ5A 2VXOA 2V7QD 2DRIA 1CWUA 4JL8A 4RUKA 3AR2A 3JD4A 4XDYA 5I7AA 4EGAA 5AKJA 2D8AA 1Y8QA 5KQMA 1YBMA 3NAZA 4RHYA 5AK6A 1GZVA 1P4JA 4C89A 1K5PA 1E7YA 4H9GA 2NU7A 3I0ZA 2AQHA 1EK2A 1T0IA 1XHEA 1KOLA 1YE8A 3MCVA 1RAHA 1J33A 3ONNA 4N9QA 3WS7A 3O90A 3U60B 4LTMA 3ICQB 1GVNB 1AQYA 1EQ2A 2IL1A 2B4QA 2QQ0A 3R5FA 1O54A 2CF5A 2JLAA 3RUAA 5JH7B 1USVA 5JC8A 2Q3FA 3W3ZB 5AUNB 1YQQA 4R9SA 2Y05A 3GUHA 4M1WA 5J9FA 3E18A 3EZFA 3C3WA 3U9TA 3ZHBA 1XLUA 3P1JA 1V8DA 2JFUA 3WLLA 3NTXA 3PRKE 3UWDA 4FFLA 4WA8A 4ETIA 2HU2A 4LS3A 4QOIA 4FHEA 4AXBA 3OE7D 4Q4HB 1Y42X 3F7TA 2DECA 3KEFA 2PIAA 3O0DA 4B3GA 1KQPA 1UDRA 5TNXA 2NV2B 2P91A 5FOXA 3I3SR 1WDLA 1ZD8A 1RMYA 3HH8A 4I1PA 4QYMA 1G5FA 4IL5A 4N3BA 5KTSA 4E70A 1OF1A 2A86A 2F8SA 2ICAA 4TV8F 3L0DA 3K1AA 4JLDA 2QAGA 2WUEA 1VRWA 1E3MA 1QF6A 4KP7A 5K9ZA 3WK6A 5LNK1 3DZCA 5CR9A 4B87A 2A8YA 1FTGA 4CHGA 1VSVA 2VNAA 3Q0EA 3FHLA 1GDHA 2C1EA 3TTWA 3CB4A 1Y9AA 2MYUA 1YVEI 5JPIA 4B45A 4D3YA 2DUMA 1WM1A 2R8EA 1ZWLA 2W2LD 1E3EA 1GNRA 3ANTA 3AHDA 4U0JA 3U7RA 2OPHA 1VPTA 2BJWA 2XWPA 4ZDJA 3U7EB 5DNDA 2OGUA 3GJZA 5D2CA 4GQAA 1VJRA 5AI8A 2REBA 4WESB 3KBOA 2WWVD 3SN6A 2GKGA 4UUQA 5H4HA 1UT6A 1ES9A 3C5VA 2DT5A 4DLTA 1H1LB 2QRZA 2QGNA 1AE1A 4F3YA 5JCOC 1B6GA 1HDEA 2B2XA 2AZDA 3MT9A 4GVPA 3ZI0A 1V7ZA 4M9ZA 5HR5A 2DPXA 1OUMA 1I1HA 1UXIA 1WKBA 4NP6A 3RODA 1SUWA 2HA2A 2E3JA 3ICWA 4O0MA 1L4GA 1JX6A 1D07A 1MB2A 3QF7A 1GL9B 3FMPB 5EZYA 2C04A 5FUVA 3RJMA 5BWLA 3FWYA 2ZYVX 1HYHA 1UP6A 3G02A 3HDQA 1CF9A 4WOBA 5TMEA 4BPRA 2Y1CA 1W0KD 1ZP6A 3T15A 2QTMA 4DT1A 5AQ1A 5G53C 3PX7A 3VNBA 3PUVA 4QTXA 3BA1A 3BFVA 1W85B 1VIMA 3D2AA 1ZK3A 3KV1A 5SY6A 2WFAA 3PNSA 1T26A 3V1YA 4YV2A 3EZLA 1K7FB 1DE0A 2B0CA 4B8ZA 1CUVA 5HUJA 5K01A 1FX0B 2YICA 2R1TB 4JZKA 3UAZA 5C8XA 2BM8A 1R4MB 3PNPA 1JR6A 2LNDA 4UOEA 2C1XA 1GU0A 1T2NA 3GP5A 2NSHA 3OCUA 3DD1A 4N6NA 3L1VA 4DL9A 1I1QB 3A26A 3GAMA 4KITB 4K1XA 1WMBA 2JFOA 3JRNA 2W5UA 3FCYA 3IBCA 3VZRA 1W4BA 1DT3A 1JSXA 1G6KA 2YXDA 3BGDA 3FZEA 3WTBA 5U9CA 5KYUA 3KJGA 2ZWVA 1U0SY 2P6UA 1M2WA 2IVFA 2EZ9A 4MUBA 3UAGA 3V6MA 4UAUA 3QUQA 3QG5A 3SOPA 5BSKA 3WFIA 5KTMA 5DK4A 3IIEA 3SG0A 4KN9S 4C04A 2ZPUA 2CXSA 4C7XA 1L9KA 1YIDA 2D54A 3LUBA 1Q2XA 5EXXA 1LVHA 1OXUA 4C30A 1L5WA 2VJKA 3OQOA 1WRBA 1ZHFA 2WVAA 1WMAA 1BD4A 2ON6A 3MMSA 3ND5A 1GAWA 3HVKA 4REMA 5JLAA 4JI1B 1RE0A 2R96A 3O9ZA 1IIBA 1S2DA 2FCAA 4JZYA 4MPRA 5DNYB 2R8BA 2AF4C 2ZAMA 3H11B 4D5EA 3CKKA 4RK6A 4EMTA 4OH1A 2Y9PB 2ZLBA 2FSFA 4MEBA 2V4UA 2VP3A 1L5FA 4AY4A 3NOVA 2H2DA 4CWAA 5IAEA 3W2EA 2PGAA 2PRJA 1FQJA 2C7QA 4Z0NA 1PFWA 4BBAA 2BHTA 5BWNA 5LU9A 3O2JA 5HYVA 4DYDA 3KLPX 3MZ0A 4MQFA 2REOA 3BH6A 4XIIA 3HO6A 2JVKA 3QJYA 4RD4A 3LU1A 4M0EA 2A1UB 4G89A 5F3RA 1XCOA 4CMAA 3ML1A 5HZMA 2GZSA 3LV8A 5JU6A 1QCZA 3RJ5A 5P8WA 4OQQA 4KUEA 3PEYA 4P08A 3RLIA 1A3CA 4W5HA 1ZXBA 3E7XA 3MHPA 1N6NA 3DWFA 3MTGA 5AW2A 4XWTA 2Y1FA 3LK7A 3RAJA 4CHTA 3R0JA 3WL3A 5HRUA 1I2BA 4QQ8A 4KQ1A 2AXQA 3IDZA 4BX3A 2GK7A 2C0QA 3EQ7A 5F98A 1DJPA 3L40A 4PZYA 4KFUA 2ARKA 1ZCJA 2OFOA 4CKEA 4E30A 4MCJA 3S8EA 1X3SA 3SZUA 2DFLA 1E1NA 1X38A 2RHDA 1JIIA 2II6A 3QPDA 1IMOA 1E2FA 3KL4A 4PLGA 2J6BA 4L5JA 3UTCA 4BQQA 1NPDA 5SYAA 4LBWA 2FPXA 3A14A 1N57A 2ZBRA 3WRYA 3H1PA 1UFOA 3OLXA 5IBRA 4A03A 1YZFA 1V6CA 2Q28A 3EXFA 2H1WA 2HWXA 4XTCS 3ZHOA 5B1IA 4B83A 2FZ4A 3NQ41 1V5GA 2HCFA 3EN0A 1Z06A 3NWPA 1RXSA 2NUAB 4JMLA 3F2IA 4URXR 5D6NA 1MV8A 4PYJA 1Z0JA 2EBHX 1UBTS 1FFCA 1QOQB 2AN9A 3MK31 3WHLA 3QTBA 1ZCZA 2CL0X 3FM9A 3VTAA 5AW8A 1G21E 1G7SA 3HCEA 3K9BA 1HDXA 4PZ0A 4RVFA 1WU7A 4Z3DA 1CUHA 1OFUX 3U49A 1FSZA 4QPPA 1SELA 3G82C 4JC0A 4R51A 1QG6A 1NXQA 3M1AA 4XJVA 1ZNWA 3UW1A 1CFZA 1YCDA 1LS6A 2HREA 2LR0A 4QEDA 5L4SA 1YRHA 4L5BA 1E63A 2EGHA 4ZO8A 2RK6A 3IBYA 5KB3A 2WICA 2GB4A 3G13A 4DR4B 2YRFA 1BKDR 5HZKA 2IZ0A 4IQGA 1IH8A 3FWNA 4RZ2A 3TN7A 1B8VA 1ZL2A 2H18A 2QQEA 3QEOA 4K9DA 1KZ9A 1KL7A 2FAXA 2WUWE 1JWBB 2ZE8A 2P1DA 3DVSX 3QBDA 4X1IA 1CR0A 1ZRNA 3IP8A 3P0JA 3BORA 2QQFA 1QHXA 2QR3A 2VQEB 1FMCA 2BN4A 2I6QA 2WUDA 1N5OX 2EARA 1SKYB 3CLSC 3P2YA 3JTMA 3TUJC 5K3AA 5TQ0B 2FE4A 3FDZB 4UARA 4EP1A 2NXNA 1KO4A 5EIXA 1NMSA 1IWOA 4PPNA 2PWPA 4ZHQA 3X1KA 4Y3UA 2WE8A 4JLKA 2AQ8A 4EVRA 2JIZD 1ZUNA 1OLOA 4LYAA 1L1RA 5EZYF 4UNRA 3CBQA 3GLFE 1QYRA 5J5AA 4RACA 1U8CB 1E62A 1MX1A 1GZ6A 3S4YA 3RC1A 3RS7A 1CUIA 4FBMA 2VQ3A 2Y66A 5DV9A 1PQWA 1ZGJA 2FR0A 4GPZA 1WPGA 3MD0A 5CLJA 3WAGA 4IOKA 4RK7A 1U9ZA 2HMWA 2BJHA 2YQ5A 4HYEA 4JHLA 3RSQA 3IUJA 2C9MA 3OX2A 1BMFA 3MQFA 4LC9A 4MTCA 4ZAWA 1TW3A 2OHJA 3G0HA 2FVXA 2WV9A 5DE3A 4IHJB 2QPAA 1AGYA 4DNPA 1P9NA 2YMPA 3NDRA 3BMQB 4RENA 3ETDA 4A9AA 4QDUA 2ABWA 1T24A 5KDDA 1JVBA 3SYLA 1PJ4A 3BB1A 2PRIA 2WJHA 5A62A 3H5OA 3L01A 1TLFA 4WLEA 2D1TA 4IIJB 3FYSA 5CITA 4QYTA 2FMFA 3O91A 3K9CA 4J6FA 1QK3A 2C77A 4J0JA 2F64A 3H4VA 4K8RB 3VFDA 3S2ZA 4IXWA 3VTFA 2QWXA 2O1WA 3KQVA 4JGGA 4PX5A 1RVV1 2QUZA 5AI0A 3X1JA 4QZVA 3NIWA 3THRA 1O5TA 3SBEA 3P27A 2IYVA 1E6WA 2QRUA 3UUFA 4XEHA 2RHOA 1GZHB 3KIPA 2V9ZA 4JCOA 2ZCUA 5THKA 4F6RA 2O4UX 4PXAA 5C37A 2FV8A 1VE7A 3L1UA 3KAQA 1M1UA 4NCNA 5DK6A 3JZIA 1TADA 3PVCA 2EFEB 4IDDA 2R8ZA 4WACA 3RBAA 4A0SA 2FW1A 2GO7A 3H8JA 4F45A 1K88A 1B41A 3CVUA 4TYWA 1C9EA 5T67A 4V0ME 1RACA 2DU8A 3R4VA 1D7OA 4IHAA 3QVXA 5CG1A 4ER0A 5KUTA 1N2OA 4NTZA 2C2BA 4ALJA 5JNTA 2WUFA 4LA4A 4UDXX 3VPDA 1BDIA 5BSRA 1QRDA 1ZOOA 3SBOA 1PT6A 2EDAA 5CEEA 4JP3A 2C5LA 4QGFA 5EINA 4RHFA 3KT0A 4LI3X 3SEFA 1BN7A 3B9BA 1N5MA 1RHMA 4G65A 5DLPA 1AQIA 4QRHA 3ZEIA 3HSYA 4UZSA 1L4NA 1EX7A 3H05A 4WMLA 1UJBA 4DQXA 5KU1A 4RW0A 2JHPA 3NHZA 1XRMA 4XLLA 3AILA 3HCWA 3QNMA 4TWRA 4V0SA 2PSJA 5BV0A 1J39A 3EIHA 2Q4EA 4Q15A 3GEEA 5KVAA 4E2FA 2C9YA 4KPUA 3EPKA 3BKXA 1KH3A 3QXJA 5FPPA 3HDGA 4MJLA 4RLFA 4AMYA 2E21A 1NJ5A 4FILA 4PQRA 3M82A 2K4MA 2OSVA 4GWLA 2O2GA 2H07A 2PZBA 4WNIA 2JI6A 1E8NA 2FRDA 3BWXA 1W36B 1BOOA 2XT9A 1XAIA 1NBME 3GNQA 1E2IA 1G9TA 1OH7A 1VHQA 1T5DX 1VE9A 2QN6A 5SZKB 1IUKA 3L7OA 2ZYRA 4Q37A 4P3NA 1ULTA 4XKJA 3STHA 4W5TA 2HK7A 2WFMA 2J33A 4BB9A 1YKFA 3U9LA 1RKQA 1P2BA 4TKVB 4XARA 5DYTA 4WBSA 2HY7A 1L1EA 2OXEA 1EB8A 1ZICA 1NXOA 1VLQA 4ALIA 3OIWA 1O6FA 4PCVA 4WADA 3P45A 1M10A 4TTAA 1J0XO 4PG7A 4MUJA 1J5PA 1I3LA 2FF5A 2IUSA 2Q2WA 3DKRA 3UFXA 4BUJA 2HJSA 3ELDA 1BDMA 1GV0A 3LZDA 1EEHA 3RUPA 2X2PA 5FI5A 3BE8A 4OK5A 2CNLA 1J90A 4YUZA 1M2KA 1AK1A 4BO8A 1HDYA 5HQJA 2Z5GA 4LF6B 4NCXA 4F1KA 1JH8A 1F48A 3PQ2A 4NS1A 1N8SA 4A6PA 5LJIA 4MVJI 3T0GA 2GPSA 2NYUA 3EH2A 2VRCD 1XXHA 1Y34E 1V7PC 2TMYA 4J75A 3C0KA 4MCAA 4OP3A 4B3SB 3NT4A 1TRHA 2GAAA 1YRLA 4ZTUB 1DBRA 3BIFA 2R6JA 1M2EA 3H2SA 2FPPB 3BGIA 4RA9A 3M34A 3V9PA 1HV8A 2H9IA 4BGEA 2WILA 3FUCA 5LBTA 3ZCTA 4E0BA 3K6SA 1QR2A 3HYLA 2IXDA 4M0KA 1J42A 5LMUB 3L9WA 2P62A 2HF2A 1DPFA 1P17A 4HLUC 3G1TA 1WX1A 5C32A 1SULA 1SC4A 4JODA 3CV3A 2BD0A 2JRCA 1HRDA 3BWCA 3GZ4A 4JP1A 4C0AC 4F3CA 3GLGE 4NFYA 4V39A 3AF4A 1XJQA 5LJLA 1R9GA 5J2UB 3WBBA 4BOYA 3DVAB 1RWBA 5AHRA 1AZTA 2XTJA 3E9QA 3VU9A 4DIUA 1NRWA 1KIAA 1RJ9B 3ABIA 2IDZA 3PFNA 3RYIA 3PWKA 4NYJR 1EJBA 4NSNA 4E33A 2Y0PA 3I9LA 5E6SB 5SYNA 3BGVA 4MMYB 4BCDA 1FFSA 1QDUA 3CW8X 3CSDA 2COKA 4GEGA 3L1JA 4K7JA 5EPOA 4QTYA 2P35A 4WKPA 1KVTA 5LZ5A 4CL2A 1G7RA 2OD2A 3C14C 3C5CA 3MWLA 5AD1A 3L93A 5ILOA 4CPDA 1G38A 2NAPA 5DMXA 3M4ZA 4H60A 5B3JA 1Y81A 3OJ0A 1NNSA 3PB3A 4M1EA 4O1HA 4PC1A 5KJ6A 2C96A 5HKLA 3CC8A 1QX3A 3JASB 4RVHA 1TQ8A 2X1HA 2E1RA 4AKHA 1NG9A 4QWWA 1W59A 3PJFA 1J1UA 3N5CA 1X1CA 5FNVA 1M9NA 2YV2A 3PICA 3OP1A 5AJZA 2CZGA 4PZDA 1WQ1R 2C0PA 4I3GA 1OIXA 4FGKA 4A82A 3AINA 4FYPA 3OTOB 1QIKA 1AXEA 5LU8A 5F76A 4NZ9A 3O9VA 2XUKA 3WHPA 3WK7A 1U7WA 4IDEA 2B21A 3SVLA 1BXZA 4GGOA 2FA9A 5DHQA 2MCFA 4OI4A 4QARA 4A8JB 4YHHB 1IXRC 1YZNA 5G40A 1PSZA 1R1DA 1UMDB 2A5DA 2DFVA 3OE5A 1YOVA 1NAHA 2I4MA 1ZJ4A 1G20A 1ZSVA 2F55A 4FHGA 4UVGA 3PHHA 2UZ4A 3GMIA 3BB3A 4N7JA 3W2GA 1TGYA 2XZLA 5JRZA 3IJRA 2EP7A 3NTVA 2G72A 3HL4A 3KQYA 3QBVA 4RK0A 4YFVA 3UXHA 5K4GA 1T1JA 4HHEA 3D9QX 5FA8A 1E2HA 2RCNA 3C4JA 1K5GA 3GK3A 4RK1A 3PHJA 3EB9A 4M1SA 2ECQA 5JCJA 2BT4A 4C21A 1FDRA 1TXGA 3HLYA 3ZGZA 4QGHA 4NK4A 3G7NA 2ZR9A 4N8EA 1VSUA 4DVJA 4D25A 1K8RA 1RM5A 1ADFA 1P5ZB 5IVDA 3RFXA 4DDHA 1DG9A 3W8NA 4EENA 2QVLA 1TFUA 3R7LA 3UT6A 2E4AA 3K2EA 1A5AB 4IGAA 3DA8A 3FN4A 4O4LB 2O2HA 3CTPA 4QBKA 3IVGA 4M9RA 1XCGB 1SQ5A 4D99A 1OZAA 1Q2UA 1X74A 2G70A 2W6JD 1F5NA 5BO5A 4ZMBA 3WRXC 3BOSA 3GJ7A 1JJBA 3LWDA 2JEOA 2IZ7A 3ESDA 1AVTA 1M7BA 3LO5A 4L3WA 4R40A 3SJBA 4CT0A 4ZIRB 2ZJZA 4LF5B 1RHUA 4R68A 2DTXA 5KJEA 4U3JA 4AX4A 4AJKA 2Q6KA 3HCBA 2MR6A 3DNPA 4WZAE 1J2YA 3R3JA 2A6PA 5BSFA 4Z7OB 5IHPA 1U3FA 2DXIA 1T4MA 3C16C 1G8SA 1Z6XA 1TKRA 2LCFA 5FYDA 3RSHA 5A5EA 2QYOA 1XROA 2WF7A 3WYGA 4V2IA 3IDOA 1TUEA 2QROA 3PQFA 4TX1A 1XP5A 4A8TA 1XTZA 1JDVA 9ABPA 2P79A 4XWGA 1NJGA 3PPXA 5JAUA 3V2IA 4ESVA 1GCOA 1T1IA 2CFOA 4Q16A 4KW7A 3T3IA 2F8TA 1IUPA 1K06A 3JATB 1J2EA 1JT9A 4RM2A 5AJXA 3RWOA 2XGGA 4B3XA 1RRPA 4F2HA 3ACCA 3AG6A 4FB5A 2Y92A 4CRWB 5DHSA 3W6OA 4P7GA 3QPVA 4UMDA 2QENA 3EX7C 4NYMQ 1QYIA 5K3CA 5IPFA 1WOMA 1JHUA 3KCNA 4P5DA 3RKRA 1Z28A 3T7DA 4BP1A 1DEAA 3TW8A 3DTVA 4IGEA 3IP9A 1JJVA 2CXPA 1CJTC 3IVAA 3JQGA 4H7FA 5BQOA 4YCNA 3ZW8A 1JHAA 1UBSB 1E2GA 1TQ6A 1RAIA 3W0LB 4JC4A 1KNQA 2A84A 2QPTA 1OLUB 2WT9A 4TWZA 2FHPA 7GPBA 2EKZA 1QGYA 1E6UA 4QULA 2Q2OA 5DZSA 4O59O 2YWJA 2JVIA 2ZRJA 3LYLA 2ORVA 3OEYA 4LJ4A 1ZIYA 2AHOA 3ND8A 4M9UA 3WL8A 4PYRA 1TEVA 2DH5A 3R9IA 1E9EA 2QD4A 1J5XA 1CJVC 3IXLA 2B9VA 3L6UA 2PRZA 2A4MA 3PJGA 4KO3S 4P35A 4ENPA 2AKEA 4GKBA 3DCIA 5AKLA 3OFKA 5CH5A 2QLLA 1RTKA 3FPKA 4YRDA 3VBCA 4YRGA 1ZOLA 3JWPA 4QUEA 1Z2EA 4E4YA 4F0JA 3P26A 4XDZA 2VFAA 2H1FA 2XUIA 2Y6VA 5FL7A 2GEFA 1MXHA 1DXOA 4N7RA 5DIFA 5KJFA 2V7BA 4QICA 2DM6A 1J8DA 5JLJA 3S68A 5HKAA 2GUWA 1M72A 2XTNA 4BQSA 1A2QA 1DIBA 4BO2A 2H8GA 5FTLA 2RMKA 4I9FA 2QHXA 4LECA 2BFCA 5H02A 4L5YA 4UW9A 2WEKA 1PJRA 1DO2A 1JJ7A 2W6IA 1WUKS 4N4AA 4QXQA 4A2CA 2IBSA 2GN4A 1L7EA 3WK4A 1NMEA 1B8OA 1X86B 1LRJA 4J07A 1PDVA 4DV3B 4YJ3F 4C03A 1X13A 4DLXA 4EJ2A 2P11A 4QYSA 1SB8A 2ECOA 1QK4A 2YJGA 4FD2A 4YJ2B 5BVGA 1JT2A 5LQMA 2FU5C 1UBNA 4HRVA 3FETA 1OXVA 3D02A 3SYTA 2FG7C 1VXOA 1XD2A 3GLVA 3OJLA 4N3AA 2DCMA 2IYWA 2JCXA 3F74A 2UZ3A 1IAVA 1I32A 3OCZA 3W2TA 4OYLA 1BHQ1 4D1YA 5JVDA 1WV0A 3OTQA 4MYTA 5DGHA 3KXLA 1GZ3A 2BI8A 2FPUA 3BICA 3OM1A 3W2IA 1NUAA 4YP5A 1TAHA 1CUWA 2ET6A 2HV8A 1ML4A 4XM1A 1CETA 1P61B 1SBNE 2H4WA 1GTL1 5FF9A 5H3HA 5IEBA 1O0BA 3ZJVA 4KR3A 5DCYA 2ZUCA 3F3SA 4R5MA 1SFRA 2MYTA 521PA 4AN0A 3T3OA 1G8MA 5DISB 4BFXA 1SKBA 3DBHA 4HAOA 4Q01A 2VXYA 4X0EA 4NJEB 1IJFA 3WLJA 3ZPXA 3CBGA 1YJQA 2X2FA 1C7JA 4MVJF 3G9TA 1S02A 3KPUA 5FYQA 1K7EB 3H2YA 3UQYS 5LP6F 1Y1SA 1QIEA 5F2KA 4AJ1A 5EEHA 2ZYAA 2CKMA 1B16A 2WSSD 1LLCA 4AUKA 2B34A 2XBMA 3G0OA 5A9SA 1XZHA 5JQGA 4GE3A 4CQMB 3BK7A 4BFYA 1RTTA 3GXOA 3R0XA 1TOAA 1ZYUA 3KO8A 3PFHA 3KSBC 2YJTD 2JD2A 3FG9A 3ER6A 1B7GO 4DEYA 3K70D 2O7VA 2EFCB 1TQDA 5JFTA 1V16B 3D6VA 3PD1A 4BMPB 2P9TA 1HFEL 2X7HA 4RABA 4RQUA 5KAMA 5CDGA 1S8AA 3FLBA 1P45A 3LCRA 3OOEA 1TZ2A 4TV8B 3V4LA 4AG3A 1RLUA 3SX0A 4CVNA 3J7TA 2A0KA 2D59A 1YR3A 2O8CA 3FFWA 4U2FA 2NWQA 1U2GC 3WNVA 1T4CA 4F4UA 2GA8A 1BD3A 1E6MA 3VYWA 4IO1A 2RGNA 4M8KA 2YVQA 4C0KA 2FUG1 3G1UA 2PX3A 1BFDA 3TQSA 3VAAA 7AT1A 3PA8A 2BFWA 3FPGA 3ZWPA 4U7PB 2CLMB 3A3KA 4UBOA 1CVIA 2WJ4A 4RADA 5AK0A 5J4LA 1C5KA 2PZEA 2OVBA 4P9NA 4RPCA 4C5AA 3DXZA 3BMXA 3EC7A 2B61A 3N8GA 3HXQA 5BWBA 1SBQA 4FDUA 2FR8C 4R1QA 4EAQA 2O2JA 3X1MA 4AY2A 3UWPA 3PFCA 3AO0B 3TM5A 4GXRA 3BHJA 2M32A 4O2AA 4JI8B 2ECFA 2VDKB 3RUHA 3RK1A 3AI1A 5ALEA 1YULA 4HYQA 4P32A 1L3BA 2F4VB 2TSYB 3O4FA 3OFSA 3TO5A 5B7PA 4I66A 5KU7A 3Q12A 2ESRA 5HP4A 3A36A 1CF2O 4KN8A 2G80A 2G8LA 4R6XA 4BO7A 1B6TA 3HFGA 5AUPB 1XTVA 5KYTA 1GUZA 2W0MA 4Q5IA 5IT5A 1YV9A 4NFSA 3LKBA 4LJAA 3COWA 4ZJPA 1E20A 1PJ8A 1L4KA 2A7QA 3O31A 3TBFA 1T9KA 3LX4A 4LDJA 5JS6A 2QRKA 4Q9DA 3EXIA 3IMKA 3LZ6A 3P2MA 3C3JA 4XRRA 3KJNA 3T5CA 3FLMA 1IVNA 1KFKB 4EPRA 2LBPA 3LXMA 3MMZA 5JSYA 2BGTA 2VJOA 4MVJD 5EI5A 4MQUA 1QE5A 4YGYA 1K6MA 3V1LA 3VBEA 4BMCA 1A77A 4DM4A 3A1WA 3IRVA 3ZK8A 4OQEA 3HACA 2G5CA 4BX0A 5DGXA 1NP6A 3IQZA 3PR1A 2O07A 3EGOA 4GLLA 2Z6AA 4U7HA 5ECGC 2DVMA 1PUXA 3KUCA 3VISA 1FUIA 1KVRA 2P0YA 4HGPA 1HX7A 2LCQA 2JNWA 4XPZA 4DDUA 2QK4A 1J97A 4XWOA 3QPUA 1VB5A 2RHBA 3NKFA 1WUIS 3OPMA 3KKOA 5J2TA 3WKAA 1TC1A 5EKXA 1KBQA 5AW6A 2UXCB 2EJWA 4B4OA 4GLJA 3SWWA 3AB7A 5GV8A 3EGCA 1M6NA 1T1GA 1FL9A 1M54A 1F8GA 5K2MA 3HUEA 2YDXA 3TJMA 3OZRA 3DAPA 4B3CA 1Y5LA 2WJPA 1X80B 3TB6A 2A3RA 2LV8A 1WZEA 1QRRA 2ZIXA 4YP7A 5EY5B 2UZIR 1KEZA 3FIUA 4YCBA 1SHLA 5J5VA 1OAOA 3QITA 1FS6A 1ZM4A 4MUXA 2ZS8A 3AXSA 3PT5A 4GZ3A 4IRUB 4PHCA 4TMWA 5K8JB 4MR8B 3CVWA 5GP1A 3V2GA 2H4YA 4EUSA 2HMTA 1H94A 4PVCA 1PL7A 2A1TR 2JLZA 4D9GA 1M8FA 2VTKA 3OTHA 2H1LA 2Q6LA 1NOJA 2OAQ1 3ETCA 3P5BA 2O57A 2ID8A 2XWSA 1DPGA 3AHHA 1IIRA 4U7FA 3HGMA 3W7VA 3CNEA 3K0CC 4HNTA 2FG6C 2GDZA 4PYIA 4WZBA 3OT1B 1N2CB 2FPKA 3JQ8B 1E0AA 2HF9A 2JL1A 4R83A 1GPNA 4I4IA 4IIYA 4MH0R 4BGVA 3MG9A 3UWOA 4FGUA 1WBBA 1NUHA 3A10A 3RBXA 2ZGVA 3PUIA 5HIMA 5TQJA 1Z37A 1XQ9A 2C2WA 5CYGA 2FMHA 2WKQA 2O7NA 4QX6A 2VWHA 1GKLA 2DB3A 3Q2IA 3IHKA 2WSLA 3DC7A 3MB8A 4WXMA 1YH3A 3IEPA 2X0JA 5FUWA 2JKVA 5CVVA 1JFTA 2C61A 2HJ9A 1YFZA 4MGZR 1X77A 4BX2A 1MJGM 2VCYA 5CNIA 3KUXA 4NHOA 4AS3A 4MUMA 1JXQA 4B4UA 3OLVA 3HM9A 3B53X 1XYVA 2W6ZA 5JPDA 1V48A 2JGIA 3IR5A 3WK9A 1LPMA 4AYTA 5IABA 3ELUA 3U0BA 4KMMA 4FOSA 1NQVA 1XJ5A 2UUAB 3REQB 2NU6B 1LSOA 5CAEB 3R8CA 4BLRA 1XEWY 2CLDX 2V6MA 1A9ZA 4HGRA 3UT5B 4IDBA 3JQBA 5CD9A 1ACJA 2YYSA 3HP1A 1FFYA 3OM9A 2ZB3A 4RIHA 4BQNA 4BKQA 5JZVA 2VRCA 1Z2NX 4YJHB 2NZWA 3DMDA 2X42A 5ALPA 1Q1ZA 4N0EA 3LLVA 4YJ2F 3QMWA 4C0HA 4DA8A 3ZC3A 1XIVA 1E4VA 5KNLA 3PRJA 1PRYA 5JSQA 2ZI4A 4KREA 3FZYA 5EE0A 3RTGA 1RXVA 4EKIA 1NY5A 2GKOA 3NHUA 2VH5R 5EUCA 3I01M 2FHSA 1U28C 3HBMA 4Q19A 2GZRA 3H4TA 1O6BA 1K4KA 3ESYA 1RPTA 4FI3F 4JU8A 5BNFA 5LA6A 3ZOKA 3DMYA 1YZUA 2O2CA 2PKXA 3EZ9A 3HWX1 2Z09A 5ALJA 2WLTA 4Q3DA 1T1RA 1P1RA 1ZAKA 2OBMA 2AD1A 3GZTB 4A7PA 4B35A 3GRRA 5C5CA 4O8CA 5K0LA 4YCLA 2BJVA 2EEPA 1OOEA 4WXEA 4F9TA 3EWAA 3QNWA 2FZKA 2HF7A 5A02A 3N2LA 1AH2A 5D5PA 5NLLA 1MX3A 2ID4A 5DXAA 5FD8A 2O48X 4ZHQB 1WB5A 2HA7A 3RRZA 1ZLYA 4IIDA 2ZZNA 4NPCA 1AC5A 1BCSA 4FINA 4QGAA 4K9PA 1N2XA 1X9HA 5LZ8A 3H9CA 1PJSA 4KDEA 5CDHA 1XI2A 5JDCC 1QAOA 1OFTA 4P22A 4Q7QA 4B3RB 4GYKA 2GNOA 4HFMA 1W36C 1BROA 4YCAA 5C4IA 1Z56C 2V6JA 1G7TA 1X1BA 2HCTA 2WG0A 3P71T 1E4EB 1MU0A 4CM8B 5IC5A 2J3MA 2YFYA 1DBPA 4QOFA 4YJDA 7MHTA 1CB7A 3E8MA 1BFUA 2GZ1A 1W47A 4MKFA 2DULA 5EP2A 1AKYA 1CY0A 2WIDA 2X8AA 3H75A 2CK3A 3T9EA 4J0IA 2IHUA 5DKFA 2PXHA 2FPMA 5BPFA 2H5IA 4C76A 1YIAA 2ZQYA 4H3SA 1FE8A 4CR8A 1J2UA 4RJJA 2WU3A 3GAAA 3S5JA 4U2DA 5BUCA 4BJ1A 3VOSA 3BH0A 5JZOA 2BL4A 4BY9E 1GT91 2XJ4A 2BLNA 2Y1DA 2W8BA 2Z1NA 1JTFA 4K1LA 4DZZA 5CIYA 5MF6A 1MQAA 3EIXA 1OBOA 3NUQA 1YTLA 5I9LA 3V8BA 3IR6A 4OD0A 3URMA 1L4YA 5DCUA 4N1AA 2EBFX 5JYDA 1YR2A 5H5JA 4D82A 1L1QA 1CIVA 5TY0A 3IE1A 5BR4A 2ZTSA 3VDMA 2X8LA 3OPXA 1PD1A 1J0DA 5EXEA 1Q16A 4FI3C 4B44A 1L5NA 1JRLA 4FGJA 4H15A 2QF7A 5FWNA 2GESA 5A2GA 4OM8A 3LX5A 1R0XA 2X9LA 3OX4A 2H8KA 4JI2B 1ZNXA 1K8YB 2D2FA 1Q57A 3T54A 4PLWA 3BDAA 1P9WA 1EESA 1WAMA 3BMCA 3HCNA 2Z3VA 2FPSA 5TXGA 4H3HB 4DKJA 3H4IA 2WIGA 9GPBA 3OT4A 3L0OA 5JC1A 1EFRD 1UJ2A 3GVPA 3AETA 1H0HA 1P9RA 2ACKA 2G9VA 4J43A 2IU6A 3QRWA 1LRLA 3I2YX 4M36A 2FLVA 1HE1C 3KG2A 3KHSA 3KHKA 2HA6A 2VHUA 3ZJ5A 1N36B 1NUUA 2G1KA 1V8FA 1YE5A 5AXDA 3G85A 1SQ0A 3I2KA 4RL6A 1GQSA 2OTCA 2AH5A 3R7FA 4Z4CA 1VIAA 4EI9A 1IWBB 3GJ6A 3H5IA 2I4TA 3EXEA 4R69A 4DJEC 2B7LA 2V3WA 2B35A 4G0VA 4C9BA 2AJTA 2COUA 4MKIA 5T4EA 2OM2A 3K0AA 5LMCA 5LZ9A 1P3DA 3PPYA 9MHTA 1LQ2A 2F90A 1SRQA 4B3HA 3VKUA 1OTYA 2MDTA 4OQPA 1Q0TA 2BYTA 2XCTB 4OKIA 4LOIA 3QJ5A 1EVEA 2VI5A 4TT3A 1Q0QA 4O4HB 2J3HA 1XYYA 2PVSA 3CQ9A 4AMGA 1T5BA 4NYMR 3QOFA 2BOVA 5JVDF 2P9FA 5IN5A 2JBAA 2NSLA 4EPTA 2JJ2A 5CVJA 3JCZA 3RIGA 3AM4A 3JAMA 4B3MB 1CU1A 4CM4B 2ONYA 4ITVA 4AMVA 3V8MA 1VSBA 3QYPA 2Z3ZA 5MFPA 4ZTZB 3TB4A 1ECGA 4B7ZA 3NEJA 5L45A 2YZ2A 3BTUA 3OWOA 3TR0A 4TXJA 2E37A 2Y4NA 4HXYA 5E4FA 3KQWA 4OBWA 3ZY5A 5IC4A 3GRCA 3OE4A 3QKSB 4ZVNA 1H5NA 3DVLA 3DZDA 2WU0A 2W6QA 1DQRA 3PZBA 5B3LA 1CUZA 2I3GA 3UMYA 4EHNA 2VAWA 1FNSA 1JKJB 4RVGA 4ENQA 1TAUA 1L4HA 1G2PA 1DBQA 1L8OA 2XRYA 3B1XA 4NC9A 1ZGGA 1VE5A 4OL9A 2HYIC 1BWRA 2QVGA 3I5UA 3F78A 4OQ4A 2RK3A 1V7QA 2QRNA 3Q72A 4M1ZA 4NARA 1AZSC 4RPLA 4QHYA 1R5BA 4RIGA 2BVNA 1SZCA 2C88A 1IBCA 3RS0A 1M6HA 1O0SA 3ZDRA 3N9IA 1T13A 1YR7A 4F9FA 1QO9A 1UKZA 3W79A 4AUMA 3RRFA 3H16A 3K4QA 3DDWA 5F52A 4BWGA 2OMEA 4PYNA 3B3FA 3LL4A 1QKJA 2OPBA 2Y76A 3AW9A 1H2EA 3GA7A 3ITNA 4KR7A 2HHHB 3HU3A 3FWPA 4A26A 5DLYA 4RCVA 2FFAA 2X0DA 2ZU0C 2CBXA 3O9MA 3OCWA 3UGKA 3GEDA 5JSUA 1EVKA 4LGCA 3F67A 1QFMA 1X8XA 1NR5A 3JASA 2JIBA 1CQIA 2O0HA 2FP4A 4MVWA 2MSWA 1CERA 4MS1B 1E96A 5EWLA 4PQGA 2ZJ4A 3DF9A 4PSCA 3IMGA 3PRYA 2PGDA 3GR6A 4L0CA 4M3NA 4YIKA 2QRGA 3T4PA 1VHWA 3PV0A 2VG8A 4O2BB 2OL4A 3K2IA 4D9NA 2JC3A 1LBSA 4C4TA 4Z51A 4XPIA 1WETA 1S3SA 1AXRA 4CV0A 5AKIA 2W48A 3PU6A 3FTQA 2E4XA 5EIWA 1W1IA 4OQMA 3T99A 2RIPA 5DULA 4MP8A 4OB6A 2OE2A 1CY6A 2WWHA 3KTOA 4ZPJA 2IY8A 5D6OA 2ZB7A 2VJMB 1KVSA 4UD2A 3ZHYA 1A7KA 2Y2VA 4JYPA 1VPWA 4KQMA 3AKCA 2RGUA 4PG4A 1BMDA 4JC5A 1XV5A 1PL6A 3EQ8A 1FOEB 2XQIA 2ODEA 3KYIB 4RETA 1DBIA 1O94C 3KSZO 1ELOA 1U7HA 1AF7A 1A1VA 2PL3A 5I9IA 1P75A 3NHLA 4OU4A 2WZDA 1PZGA 4P33A 3T7SA 4OK6A 3TQQA 5I7RA 1KEEA 1RXWA 1QLHA 2EZUA 1ARZA 2KW5A 1R5OA 1E9CA 4J0QA 2CD9A 4KUHA 1FLDA 1T25A 3V4VB 3MRSA 3M1IA 3PQEA 4LZPA 4EY3A 1OH5A 1W7AA 4X00A 4NU0A 5FI3A 4M9CA 1HZZC 5THQA 4RS4A 4MZXA 4X41A 4XFKA 4A6EA 1ETUA 4ERNA 3B9RA 4O63O 1Q1QA 1UC9A 1EXMA 3NUZA 1P74A 1JLRA 3OBIA 3HI4A 4HSGA 1DQPA 1QLJA 4KXQA 3D0KA 2FEOA 2JFYA 2O7QA 3HJAA 4RVDA 4EJMA 1WZCA 2ERYA 2HK9A 2YUIA 3D4NA 3RV4A 4QD3A 3RWBA 4RIEA 2SCUA 4S12A 2HHAA 1NNLA 2RB5A 5CNJA 2GNPA 5ESRA 4AVYA 1KYVA 2CCKA 5JI3E 2RHGB 3E7PA 3M5CA 3LW8A 1KTVA 3PTLA 4XEUA 4EB6A 2AEJA 2I7DA 4YBZA 5B4VA 1ZH4A 2JEZA 3KT3A 1TYDE 5L3VA 1OPXA 2VQSA 3GAZA 1NWHA 3MGKA 4JNCA 2CJWA 5HCNA 2R00A 1KAHA 5ALFA 3D43A 3MRXA 4Z5XA 1X8JA 4JP2A 2EIXA 4AFNA 2J3QA 3WL5A 4DUGD 1KERA 4IKOA 4JQZA 4PO1A 1P9OA 3EVFA 2IUUA 3KFXA 1ESEA 5KBYA 4LJKA 4NU6A 1YL6A 3AYZB 2IJGX 2PWYA 3EBPA 2D2EA 2Z43A 1EFUA 1UXJA 2WB4A 1Z62A 2J5QA 4HF7A 3L0IB 4YK7A 4QJBA 3F6EX 2WTUA 4AS1A 4JP5A 3U4CA 4CQJA 1SBZA 1KYZA 1DJNA 4CW7A 3O4JA 1P60A 4WQMA 2HPAA 3MINB 4RKQA 4ROSA 3DR3A 2J9XB 1QRTA 3AUAA 5HS4A 2WG2A 1WZNA 2YZMA 2Q1XA 4RE5A 4TMFA 1PJ2A 4PG6A 1XVTA 2AUTA 3G5AA 1DWPA 1BGWA 3HV0A 1F2UA 1TTHA 3ZV6A 1KS2A 1YBAA 3HKDA 5BQXA 2RJOA 2QUAA 1GA6A 2E5WA 3JQAA 5DYYA 3CNQS 3IKVA 4Y67A 1OYOA 5IKMA 1VKRA 1ML3A 3ZTTA 3UMBA 3RR2A 2WIFA 1UBGA 4IG4A 4ARCA 4PU0A 2QTVA 2HR1A 1WS6A 2AOXA 2ZIZA 3AERA 1VG0B 5K3DA 3EEFA 3EF3A 1EWQA 5TIIA 1MGOA 1MT3A 1A7JA 4BQPA 4CLEA 5JMOA 1J70A 1N6IA 2DTDA 3F9RA 3TGWA 4HNSA 3TLCA 1F60A 4HQFA 3CE9A 1W46A 1FP4A 2QI9F 4RAQA 1I6WA 2QW1A 2ZBEA 1JECA 3LCUA 4QJ3A 1TTTA 4MJ7A 3REFA 1O9BA 4X94A 3N28A 1MDBA 1Z3CA 1N2GA 3AOEC 3GPDG 4MS4B 3TXYA 3IQIX 4US0R 1CJSA 2C99A 3GNLA 4OAQA 4Z2YA 3RIMA 4MRSA 2UYCA 2CF6A 2RHHA 4LNUA 3DVQX 2X6QA 4LHYA 4BV8A 5BSWA 4JBWA 5HM6A 4Y6GB 3RFCA 4MYDA 3ZS9A 1GWNA 2VUTA 3PI7A 3QWBA 3ZD9A 4F5EA 1SBCA 2ZSHA 2X0NA 2QN9A 1ODKA 2Y4OA 1K63A 1Y98A 4N48A 3H5TA 1FFHA 4JLPA 1GRVA 4YY3B 5CVTA 1N6OA 4WH0A 4PXYA 4CT5A 4L8VA 5HZGA 2Z95A 3OF5A 1RSZA 1ZMRA 1TPZA 5F2NA 3SIWA 3JQBC 2VTBB 1TCBA 2ROQA 2OGWA 2QNRA 5JRJA 3BQMB 4WXHA 1EHCA 2D4AA 3LKDA 3TL3A 5I7HA 3CKYA 2G5TA 3EDQA 3TSOA 1ZW1A 2EG9A 2OD9A 2VPWA 3F4KA 3NEAA 1BS9A 4P83A 2MINB 3USES 3JAWB 4KQ2A 5DT9A 3QOXA 4K6OA 3SXJA 5KKAA 4X1YB 3TX2A 4UTVA 4X66B 1KY5A 1AQLA 3GLHE 5E0KB 2NLOA 1NYLA 1PR6A 4HNHA 4MVJG 4RZQA 2AG1A 2D2VA 5JASA 3ZWOA 1E3WA 4BFUA 1C1XA 4D4LA 3K6KA 3V4OA 1RJFA 3ONFA 1S2GA 4DVGA 4MS3B 3EUEA 4CM5A 2PGNA 4PN7A 2PSSA 3UJHA 3UQZA 2VZ0A 3IUMA 2HEGA 2OZLA 3FUVA 3GJRA 3LPMA 4F3RA 4G5OA 2DBQA 4OPMA 1QVAA 4DLAA 4MQFB 2PL1A 4Y98A 1WMSA 4YASA 3HUTA 2LIVA 1ODSA 3CM0A 1KBOA 1NAIA 1U0GA 4FMDB 4JLWA 3SE7A 1PFQA 2DR3A 4BVAA 2N1BA 3ZYCA 1UJ6A 4ITUA 8ABPA 4ASUA 4DC0A 4US1R 4FUTA 5F64A 3LC0A 1FP1D 5J59A 1T0UA 5EUBA 3SQMA 3SQWA 5AXAA 2XDYA 4EFLA 4BVKA 1K8XB 4PFQA 1JN0A 1U0RA 3DV9A 3CVJA 2OZVA 2I33A 3A7DA 1JG1A 3WI7A 1XMQB 1H9BA 4GZMA 4XIFA 4AY3A 1IN4A 2POQX 6YASA 4KZPA 3RIYA 4RTOA 1JPVA 1U7UA 3N6VA 2QJWA 4ZYWA 2QXYA 2QL7A 4LW8A 2R68A 1S7GA 2JCYA 2X6RA 3DC2A 9LDBA 2WJYA 1B14A 3QENA 2COEA 4OGKA 3WQRA 2PVCA 1T6NA 2GEKA 3U4HA 2RD2A 1N5JA 1L7OA 2ZDGA 1SXPA 1S4MA 4AP5A 4ZCIA 5FWXA 2I87A 1G2QA 2B1QA 3OD1A 3A37A 5FCDA 2O7SA 3ZXIA 3DUFA 4NZZA 4MQ4A 3TM4A 1JHOA 5KWIA 3VPCA 1I5RA 2YIDA 1K6IA 4ZVSA 5F51A 5IP5A 5SY4A 3JSAA 3HHPA 1C4KA 1GPWB 4QOJA 1BJKA 3GOHA 1T43A 3NATA 1NVGA 3VAYA 2OCKA 4QVKA 4JNKA 1ORDA 4PICA 2GZMA 2YRXA 3WMGA 2JCSA 4IMIB 1N4AA 1VG9B 1X7XB 3AJ8A 1SWWA 1WG8A 3OX1A 3OZBA 5ESDA 4I2NA 4CEHA 3LJKA 4ZGBA 1KO1A 3P9NA 5DXFA 3RIEA 1S8FA 1X14A 2VOEA 2WIAA 3QFFA 4CKEB 3LHFA 5IWAB 2AJLI 1FBTA 3GVHA 3PT9A 1HDZA 4TM8A 5LQDA 3UJ6A 3KKKA 1FFAA 2P77A 4WCVA 1H69A 5FTMA 1FSPA 1BX3A 2FFHA 5K4HA 3HJRA 4COOA 2IYRA 2XMDA 4M0CA 3G8DA 3KLMX 4OJMX 1EFLA 2AYZA 2PH3A 1Z4JA 5KX5F 1URPA 3MQ2A 1YT5A 4IY1A 2RDMA 2QRQA 4R2XA 3IOYA 2WWFA 4A0GA 1J22A 1VHTA 2IZZA 2ZRMA 4FKZA 3K5IA 1J7KA 2ZVQX 1I7DA 4FKBA 4LYGA 4MRMA 3SSAA 4G63A 2QRVB 4C2BA 5LQAA 4BP9A 2H7XA 2NPIA 2F3PA 4Q18A