4XYLA

Ca. korarchaeum cryptofilum acd1 in complex with coenzyme a
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
463
structure length
463
Chain Sequence
NDLERLFNPSAIAVVGASKDPSKIGSQILRNLLSYGFKGKVYPINPTADELMGLKCYPKVSDVPDKVDVAVISVPSDKVLGVIDDCGKAGVKFAVVITSGFKEVGNEELEEELVRRAHSYGMRVLGPNIFGYLYAPARLNATFGPKDVLSGNVAFISQSGALGIALMGYTVVENIGISSIVSVGNKADLDDVDLLDFFDKDPNTGVIMIYLEGIAPGRGRMFIDVASRVSLRKPIIVIKAGRTEVGARAAASHTGSIAGSVAIYESAFKQSGILMAKSVEDAFDWTKALSWNPIPEGERLIVLTNGGGAGVQSTDTFADNGIYLSKPPESLIQEIKKFVPPFASFANPIDITGMAPDDWYYMGTLAALKNPDVDALTVLYCQTAVTTPIGVAKGIVDAIKEAGNSKPVTVGMVGGPEVAEAVSFLNKQRIAAYPTPERASSAMSALYAYARARSYVMKSLAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 168
structure length 463
sequence length 463
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
A PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4xylA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4xylA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xylA01
3HZZA 1QYDA 4J16A 4D7AA 2BMAA 1RYDA 5CG1A 5A02A 2G17A 4UVIA 1FDTA 1LC0A 2Y1FA 4NBWA 2ZJ1A 2PD6A 3RQSA 2Y99A 2JD0A 1V3TA 2OGUA 4E2WA 4ND1A 4RPHA 2BHLA 1R0LA 2YFQA 3QHAA 2CUKA 1I24A 2EKLA 4KUHA 4FCCA 1JKFA 4GQAA 1LQUA 3U5TA 3M1LA 3QVSA 2AHRA 4O5OA 1CJCA 3QVTA 3GG2A 5JE8A 4XCVA 1HDYA 5KWEA 2C0CA 3JQGA 1CQJA 1E1NA 1JN0A 1OMOA 4J7UA 2I66A 2YQ4A 1B26A 4E2ZA 1F14A 3NRCA 3E9MA 3VZPA 3VZQA 4IS2A 1H6CA 4TMFA 3ORFA 5IDQA 3BIOA 1WPQA 4N54A 1WDLA 3FRJA 1IY8A 2O3SA 2NU7B 2G82A 2EW2A 2HMSA 4IGEA 2NSDA 4KWIA 3DDNA 5EQFA 2JCVA 3WGZA 3F1KA 1C1XA 4F6LA 2EKQA 3AM3A 3UCXA 3ZI0A 1M75A 1WP4A 3FI9A 1PL8A 3V1TC 1GCOA 4YJFA 2FSSA 3NJ8A 1PL7A 3JQCA 1KS9A 1ZEMA 3U3XA 1O8CA 7MDHA 3DFUA 3ONDA 4J9UE 4QO7A 5L4SA 1T2CA 3ZNNA 1I3MA 3GGOA 2PZMA 1QYCA 4I5DA 2FN7A 2JHFA 1AXGA 1B8VA 4EGFA 2P91A 3GOHA 5IDXA 2IZ0A 1HZZA 3PFWO 3PYLA 3VKUA 3ZWXA 5JDIA 3EVNA 3H3JA 4XQ9A 1DIHA 2PLAA 3QVWA 3QVXA 4YRAA 3GHYA 5DCYA 4ZRNA 2Q1WA 1Y7TA 4TZTA 5A9TA 2O3UA 5G4KB 5I9LA 1BVRA 1R4MA 2CFCA 5I7EA 3TF5A 4OGWA 4FS3A 1EUDB 2RCYA 3ETDA 7ADHA 5JXWA 4QX6A 1B3RA 1Y8QB 5K0ZA 2CNBA 1JWAB 1XR3A 1E5LA 3R3JA 2Y1OA 4JLWA 1L7EA 3A14A 1VSUA 4PLZA 2GN4A 3DHNA 3AK4A 4PLHA 3EVTA 4XA8A 1UXIA 3A06A 1GEGA 4GX2A 5HS4A 1U3WA 3KBOA 4Q39A 1EFKA 2Q46A 3BYZA 3OA0A 3TFOA 4E0BA 3QY9A 2V7PA 3GG9A 3TL2A 1IHYA 2V6FA 4A73A 1J5PA 4LVCA 4BV8A 3HDYA 3MEQA 4IXTA 2VYNA 5JO9A 5IJZA 3A4VA 1J4AA 4ROSA 4GGPA 4N5LA 4Q3DA 4WECA 5EERA 4NJMA 4DLBA 2YUTA 3W4IA 3VPSA 2CDBA 2O4CA 1HT0A 2C82A 4D43A 2Y66A 5EINA 1D1TA 2WYWA 2O50A 1A72A 5ADHA 3LT1A 2HRZA 4FIZA 2I6TA 4E6PA 4ZGWA 1UZLA 2NVUA 2QHXA 3WMXA 2JFFA 3PLRA 2X5OA 3OSUA 4UVHA 1O95A 1LX6A 1O6ZA 2DTEA 3R0IA 4ALNA 4BS9A 2PGJA 1UP6A 1ADCA 3DEYX 4YJGB 3TN7A 3GRPA 1NHWA 1XCBA 3BXXA 2BI8A 3FR7A 3JQ7B 4ZU3A 3DBRA 4DTIA 2AE1A 5FFFA 5HWSA 4GMFA 1RM0A 3EDMA 4BO5A 1LSJA 4B4OA 3S8MA 2FMUA 3ANNA 1X7GA 4BNTA 4ZQFA 2P4QA 3JYOA 4J43A 4URFA 3AU9A 4WEQA 5A06A 3ZWCA 4NJMB 3LSYA 4RCVA 4I08A 2FPIA 3FPCA 1GUYA 4DGSA 3GUYA 3HWRA 3ZWVA 5JSFA 3GFGA 1DIGA 1IL0A 1JAXA 4Y9DA 1NVMB 5BSFA 3AUAA 2QZZA 1DRWA 3D3WB 3TQHA 2GCGA 1E3LA 2FY8A 1R4NB 2EV9A 4BO4A 3D4OA 3PJFA 3S2FA 1P1JA 3JD4A 3K8ZA 4YT5A 4F6CA 4NFYA 4ZVVA 1N9GA 4DYVA 4JNKA 2HMTA 1U7HA 1DJQA 1ADGA 2PR2A 3JQAA 5A03A 3PLNA 4DC0A 1HE5A 2B83A 2I76A 1CERA 2Z5LA 2G76A 3P7MA 1H5QA 3I9KA 3OIDA 3TRIA 5L95A 1E7WA 3H5AA 1ZK3A 3ZV4A 2FOIA 3TWOA 2DFVA 3AU8A 5TF4A 2FHSA 3ADPA 2X6TA 1O89A 3F9IA 2P68A 4II3A 4J4HA 3IC5A 1CQIB 1JQBA 2DTXA 2WD7B 3DQPA 4UVDA 4D79A 3FNFA 3HN2A 4Z0HO 3VZSA 3FNHA 3ZNQA 5CDSA 4ID9A 4GSKA 4R9SA 5HTOA 4JJIA 1SOWA 4CLEA 4XGNA 2C5EA 1JLLA 2B0JA 4Q9NA 8LDHA 4FR5A 1VPDA 1MFPA 2PY6A 1CQJB 4ZD6A 1HL3A 4J1NA 5KCZA 5ENVA 4ALIA 3AOGA 4S1VA 5ICMA 2ZB7A 4PRLA 4GKVA 3OIGA 4ALLA 1EVIA 3INRA 1Q7BA 4L9RA 4YYZA 4AL4A 4RF5A 3AY3A 1QYXA 5IZ4A 1T2EA 4UULA 3OFSA 2ZKLA 3PHGA 3VOSA 3OEWA 3PIDA 2SCUB 4BO9A 1PEDA 1PWZA 1DRVA 1GYPA 4GPD1 3EMKA 4ZQBA 1HXHA 3CXRA 4GAEA 1R37A 3OHSX 4S3MA 3ITDA 5DT9A 3NKLA 1ONPA 2A35A 1E0DA 1K0UA 1BMDA 4L4SA 3RBXA 2VZ9A 1PGQA 4YAJA 5CPBA 4TRMA 2VRCA 3ASUA 3WIEA 5A4DA 3D64A 3S1LA 4J90A 1MXHA 4P38A 4WCFA 4I1IA 3RUFA 2XPCA 2EIHA 1YB1A 4NZ9A 5HA5A 1YVEI 1MGOA 1ZXBA 3GFBA 1V3UA 3IKVA 4O63O 4YDRA 2DT5A 4QO8A 3GZNB 1L1FA 4PLPA 1W6UA 1SB8A 5KJ6A 3PZRA 3BMQB 1U9JA 3IJPA 1WLYA 3GEMA 4IXWA 5JAMA 3QWBA 1YKFA 1LUAA 2VWHA 3WNVA 2YDXA 2OORA 4CLRA 4QECA 4XGKA 3CTMA 2W8ZA 3BZUA 3F46A 1HSOA 4W9NA 1O0SA 4HP8A 3DHEA 1GDHA 3KXDA 4IJWA 4E33A 3K5PA 3JV7A 4GX5A 3ZU2A 5TGDA 1R15A 4WLNA 5COBA 5DZSA 3ROKA 4WCFC 4CQLB 1KOLA 4JJFA 4RF4A 5GZ3A 1UZMA 3QJ5A 3W6ZA 3U4CA 3PGJA 3OEYA 4OSOA 1D8AA 3DZIA 4L4XA 1ID1A 3WICA 5MDHA 4J7CA 2ZB8A 3JYPA 3VTZA 1R0KA 1KEWA 1YDEA 4EW6A 4RDIA 3RC9A 3OF2A 3GEGA 2OXIA 4IY1A 5DN9A 3WMWA 2F00A 4LK3A 4NI5A 3CZRA 4IIUA 4B8WA 2POQX 3EZYA 4R68A 3GC6A 4B4VA 3G1TA 1DBVO 4RF2A 4XZ3A 1XEAA 4J9VA 3WYBA 4IZIA 1MA0A 4YWJA 4FOSA 1QYWA 3MTGA 1CRWG 4H7PA 4U0JA 1D1SA 1U5AA 3FN4A 3UCFA 1VL6A 2BD0A 3MJTA 4WLVA 1LQTA 1ADBA 4Q3CA 1NQAO 1ENOA 3GHHA 1KVSA 1SOVA 2BF7A 3P19A 4NDNE 3ZNPA 5J23A 2OP0A 4AJOA 3CEAA 2NVWA 2VNSA 3AFNA 3RUEA 2VUUA 4J91A 4IINA 3ZWBA 2PWZA 5ES3A 4BO7A 3SVTA 3W8EA 4JROA 4MPDA 1KEVA 2ET6A 2VOJA 1P1IA 2DU8A 2YV3A 3VPFA 2B5VA 1OI7A 1BTOA 4MP3A 1NQ5A 1IOLA 1ENYA 2EP5A 2Q50A 3ZW8A 2UDPA 1A9ZA 4MVJP 3KSDO 1ISHA 1QLJA 3QSGA 4FGWA 3LYLA 4RVUA 1GCUA 1DB3A 1YWGO 1WDMA 1W73A 2AQHA 5JCJD 6LDHA 4JGBA 2J3HA 1OOEA 5HBRA 3JQ9C 4B3IA 3Q3CA 3F6YA 5F1KA 4DIBA 3S2GA 3WBFA 4TQGA 1GYQA 4BO6A 2PD4A 4CQMD 1NQOA 3ZHYA 2HMUA 3AI1A 4NK4A 5DOVA 4A0SA 2VT3A 1U8FO 3B1JA 1NNUA 2YJZA 2FR8A 4IJVA 1HLPA 4BQRA 2CMDA 5TNXA 2QW8A 2HRBA 2VHWA 4IGFA 4ND2A 3RC1A 5CDUA 3ZV3A 2J3KA 4R1UA 3AM4A 1Y9AA 3C7DB 4YCAA 4NHEA 2X0NA 2I67A 1Z7BA 3DONA 4M54A 3ZH2A 1Q0QA 1XU9A 2IRWA 2PKRA 3GF4A 4IJKA 4K26A 1BWSA 3DR3A 2NUAA 2JD2A 3IIEA 4AJPA 1O9BA 3TPCA 1WDKA 3DB2A 3K30A 5DP1A 3H7AA 2WTBA 2AXQA 2GUGA 3JCZA 3V2HA 3DOJA 2D1YA 1TB4A 5JBIA 1JTVA 3F5QA 1CEQA 5JNLA 4NR0A 4F45A 4W7HA 3ZHZA 4FOOA 5CFZA 3Q1LA 4CM5A 4KQWA 5TIIA 2Y0EA 4U8GA 3V2UA 3T4XA 4BNUA 4B3JA 2Q2VA 2IEDA 1LRJA 2UUOA 3WOHA 4FQ8A 4EUEA 1M2WA 2C29D 2CD9A 4XX0A 4CMEC 5L45A 4G81A 4DXHA 5K9ZA 1YRLA 2PZJA 1M66A 3Q6IA 1BW9B 3L4SO 4P4GA 2WSBA 1H93A 4NU6A 2FR0A 4PLWA 2OFPA 2TMDA 1ZSNA 2JFHA 3RFXA 4DLAA 3D1LA 4CV3A 3GR6A 1XQ6A 2DAPA 1YOVA 3K9QO 3L4BA 5JS6A 1EVYA 3N7UA 4FFPA 4AJHA 4CLDA 4EUFA 1PWXA 2NACA 4G65A 1EDZA 1FMCA 2J5QA 3GZ4A 4ND4A 3K2BA 3WLEA 4E2XA 1I01A 3FPLA 4TKMA 3LT4A 4RLSA 5G0WA 4WGGA 5COAA 1H6BA 3UW3A 4DC1A 2X58A 3QW2A 2QZ9A 3JQ8B 2PV7A 5ITVA 3WJAA 1TEHA 2UV8A 1PX0A 1PGNA 4M89A 5F5LA 2NU9B 5BSEA 2H9IA 3H9JA 4CLHA 3TNLA 1EQUA 3I4FA 5ENDA 1ZK2A 2D3TA 5TS3A 4ALJA 3UH1A 4R9RA 4FJ2A 4TKLA 5L9AA 5LDGA 1EQ2A 2AEFA 2P9EA 1X7DA 4U6SA 1PJBA 5U9CA 2ZTMA 2OBNA 1UP7A 3JQ9A 5BR7A 3EY4A 4DVJA 4KUEA 3ZNOA 4FC6A 3QVOA 3LLVA 5G0VA 4FPXA 4BNMA 5KJ1A 1X13A 4UEOA 2DKNA 5IN5A 1U28A 2HJRA 1LI4A 3LF2A 3GRKA 1M6WA 2DVMA 4J6FA 4F46A 5JDCC 1UAGA 4HWKA 4IDCA 4XIJA 4RORA 4EUHA 4BNNA 5I9MA 4GWGA 3WIDA 3HN7A 1LLCA 2BGLA 4XYLA 1UUFA 1GUFA 5TT0A 1M76A 2D8AA 3RC2A 3JQFA 4CM7A 1FDUA 1BHSA 2FSVA 4HXYA 1AN9A 3GZNA 2X7HA 3TDKA 3E03A 2P4HX 4G2NA 3O8QB 4MIYA 4BO1A 3IQDB 3OJFA 4LMRA 4Y6PA 1ZFNA 2CSUA 1W4ZA 5MGBA 1ISJA 2CVZA 3D4NA 3Q0EA 5L51A 5IDYA 2B35A 3K31A 4WLUA 2QRLA 3MTJA 1HYHA 2X0IA 4Z0PA 2HLPA 4KUGA 1YGYA 3BTOA 4CUJA 3SJUA 4LW8A 2CVQA 3BMOA 1OFGA 3E1KA 3PK0A 5FF9A 1NHGA 3I4CA 2I3GA 1ISFA 1WZIA 3GVIA 1A4UA 3X2FA 2CF5A 4NBTA 4JJGA 3EK2A 3VPGA 2IZ1A 3WGYA 2C5AA 2YYYA 3ZU5A 5CEJA 3WX0A 1LDEA 3H9GA 3Q2KA 3HB5X 5GZ1A 4GVXA 4E5PA 4B7UA 3JQBC 1A5ZA 2HK9A 2H1SA 5EMHA 3K73O 1QORA 4M49A 3UHAA 1LLQA 1K89A 4E30A 3KLPX 4P8RA 3WGGA 4E5MA 1VKNA 2FPIB 1U3VA 2D4AA 4MKXA 4DPKA 2B69A 1VM6A 2VQ3A 4LN1A 5TT1A 3X2EA 4JN6B 1KIFA 2OO5A 4LVUA 3UCEA 5A5EA 1P74A 1EBUA 3KRTA 1QYVA 5CHEA 2H63A 3HE3A 2X0JA 2XAAA 1MXFA 3GVXA 2PTGA 4E12A 4ZHSA 5CEEA 4ND3A 4EEZA 3DFZA 4FGSA 4LISA 2GRAA 4HFNA 5JCJA 5L53A 1TT5B 1FF9A 5JYEA 1LDYA 1KY5A 3C3XA 3E9QA 2P5YA 3GY0A 3TFQA 4CM8A 3E9NA 2AEJA 3U9LA 4RO0A 2GPTA 4CM3A 5BSGA 5KJCA 1C0PA 1JVSA 5GMOA 5KIAA 4YJGA 3ABIA 1UDBA 1R0SA 4A27A 1K6JA 2Y1GA 1ZJZA 1ISIA 3C1AA 2O4UX 3L4BC 5AXAA 1KVUA 3B1KA 4R51A 4CMGA 1PS8A 5DF1A 2D0IA 4YT8A 1PTJA 3V8BA 4W6ZA 2C7GA 5T5QA 4KMSA 1PS0A 1JA9A 1H9AA 1AGNA 1RYEA 3DAFA 1I10A 2Q49A 3KZVA 1JAYA 4HUJA 4IQ8A 4RVSA 5I7SA 1UJMA 1F12A 3E5MA 4MVJI 3VH4A 1C14A 2HK8A 2RH4A 1NBOA 3JQ7A 3JQEA 4HFJA 1S6YA 3NTOA 3UFXA 3L6EA 2NVUB 3MJEA 2QIOA 4IDBA 3UKOA 3QIVA 1NPDA 4AJEA 3FNEA 1E7MA 3IUSA 1HWYA 2XXBA 3AUSA 3WWYA 1SO8A 2X4GA 3C7AA 4IMPA 4TWRA 3WGQA 1A71A 3WGTA 2OZPA 3GK3A 2AQ8A 1ONOA 2HUNA 4UVEA 4BKQA 1GYRA 4XQCA 4IBOA 4MVJM 2VHXA 4NPCA 5K6AA 5ILGA 5B12A 3V1UA 5B4UA 4R54A 4E31A 4UAGA 2JCXA 4GMGA 2R6JA 3VH2A 1ULUA 1KERA 2J3IA 3BMCA 4IZHA 3WDSA 3S55A 4AJIA 5L7TA 1E7QA 3GN1A 4NQZA 4DWVA 2GGSA 4AJJA 1UP4A 2W90A 1B0AA 1X0XA 4CM6A 4WE3A 2DBZA 3B1FA 1LU9A 4CODB 1N5DA 3DZFA 4A26A 3O03A 5LDHA 3RIHA 3RUIA 3L6DA 5I9NA 3ETEA 1XELA 4H15A 4BNHA 4W9NC 1NFRA 1T1RA 2IEBA 3OICA 1GY8A 4FD3A 4J3FA 3PFFA 4P22A 3DXFA 5IAAA 5CDTA 4AJLA 4D45A 2O7QA 4RJTA 4R01A 1W8DA 4XRGA 3ONEA 4FDAA 3IOYA 3UOGA 3ONFA 1GPJA 3K96A 4N5NA 1EUZA 3C85A 2BGKA 4XYMA 1E3SA 4JBGA 4CLOB 1I32A 2UVDA 4HX5A 1ZCJA 4PFJA 4H3VA 4P4NA 3L9WA 4GLLA 1UAYA 4L75A 5DBFA 3VAZA 1EUCB 1GUZA 2JFGA 1SCUA 2PKQP 3ANMA 1U1IA 3GVHA 1ORRA 1Z82A 2I5PO 3DL2A 3H2SA 4NFSA 4OXNA 2QG4A 5L3ZA 2X9VA 5BQFA 1HDCA 1TI7A 4FN4A 5BNIA 5JC1A 4XQEA 1HDXA 2P9CA 3CSDA 4Z6KA 3NDJA 1HTBA 1EEHA 5TJHA 1R6DA 1O94A 4CM4A 2G5CA 1X1EA 4RGBA 3DBLA 3JYLA 4EJMA 3BHMA 4G5HA 1DLIA 2R00A 1T24A 1YQXA 4KWHA 1EDOA 1GQYA 5B37A 3SBOA 4FFOA 4FFNA 3F1LA 3DOOA 4N7RA 1ZJYA 3GVCA 3OH8A 3R1IA 4ZQHA 2I9PA 2NM0A 1H2BA 4YACA 4R1SA 5JYDA 1E7YA 3BMNB 2TMGA 2WD8A 3E18A 4INAA 4NG5A 1W0CA 4R69A 3RJ5A 3ZWNA 1P1RA 5HRUA 3DZJA 1KEPA 2BFMA 2WWRA 2ZTUA 2PK3A 3JQBA 1E7SA 3NTQA 1NVGA 5L7YA 1B7GO 3NT4A 3VDQA 3RUAA 3ZV6A 2NTJA 4J1QA 1ZVMA 1YBVA 4P4LA 4R5HA 3KYCB 2AEMA 1N1GA 1HEUA 5ITWA 5F1OA 2J6IA 4CQMB 3D4PA 1Z73A 1WW8A 4JBIA 4U6QA 3WS7A 1JVBA 1ZK4A 2GASA 3GEDA 4I5EA 5EESA 5A5FA 1YJQA 5BNFA 4D44A 4CJXA 1KEUA 4O1MA 1Y8RB 4CQMA 2D59A 1NPTO 2RAFA 5EIOA 4H16A 4Y6RA 4AICA 4KP7A 3CKYA 3I23A 3LC7O 2ZYAA 5FI3A 5C37A 2RH8A 1UZNA 2V6GA 1EUDA 3V5NA 2Q1UA 4HADA 4CLRB 2RHCA 3AJRA 4YB8A 1SPXA 3KSUA 4CMEA 2Y05A 3OIFA 4CM8B 4CMJA 3AI2A 5U4QA 3VVBA 4MJLA 4M87A 2WYVA 4IQGA 2XF8A 1F0YA 3W8DA 2X9GA 4RVHA 3IS3A 5TJ9A 5AXCA 3HFSA 1PGJA 4MINA 4CQLA 1MB4A 1OBFO 3GUCA 1PJTA 1WVGA 2AG5A 3DBHB 3DC2A 1HDZA 3GPIA 4YAKA 1DFHA 3PWSA 4BNWA 1E3JA 1EK6A 3H4VA 5A9SA 1D4FA 4E5KA 2HAEA 5AXBA 2P9GA 1HYEA 1YB4A 1E92A 3TZCA 1I2ZA 1LSUA 1YBMA 3U4HA 3UF0A 4PG5A 3VZRA 4B79A 4RQTA 4XX0B 3PHIA 3BMNA 3P2YA 2CY0A 3MOIA 1V8BA 2UYYA 1X15A 4U0KA 5IXSA 4DPLA 4BV9A 3VH3A 3PWKA 3QE3A 2CDCA 1ZEJA 3ENNA 3U4DA 3ZN2A 1NQTA 1YB5A 1C3VA 1Y5MA 1LNQA 2YV1A 1I2CA 4HNGA 3HQ4O 3KUXA 3LT2A 3C7CB 5L40A 2FP4A 1B8UA 2Q4BA 4ZRMA 5HS6A 1NWHA 3H5RA 3HDJA 3IL2A 3KLMX 1BW9A 2VUTA 5KJEA 3HDHA 4WLEA 3TJRA 1HRDA 1V9LA 3I9MA 2O3RA 4N5MA 1D3AA 2W2LD 3FF4A 3TOXA 1UH5A 3A9WA 2I99A 1IE3A 3D3WA 4OOFA 3PI7A 4N18A 3E6AA 3ZWPA 1CQIA 2WD7A 3WNQA 3LU1A 4ONEA 2PH5A 4BNLA 1FK8A 1UR5A 1MG5A 1B15A 3PJEA 1DFIA 3UVEA 1E6UA 4ALMA 4UVGA 1SC6A 5DCWA 4BNYA 4D42A 2W2KA 3JQFC 3TZ6A 3L77A 3JYNA 4CMAA 1EE2A 1I2BA 1E1MA 2C20A 4RLHA 4CM9D 3PYXA 4IDGA 3ZV5A 2WMDA 3OJLA 4EBFA 1DO8A 1LDGA 4PG8A 1PQUA 1X14A 3WGOA 2I65A 1YQDA 4IS3A 3RFTA 1EVZA 1Z6ZA 1L7DA 3NUGA 3RD5A 2C2YA 3E82A 4IIVA 3PP8A 5KKAA 5THQA 4EDFA 4MIOA 1FJHA 4O6VA 1ADFA 4BKPA 1GAEO 5KNLA 4BNFA 4I9HA 3NJ4A 2B5WA 2VTDA 4AJ2A 5HM8A 1MFZA 1YBAA 4IMRA 3AFMA 4JCOA 3WQRA 1VJ1A 1VI2A 3RSHA 3ZU4A 4DMLA 4WLFA 3OBBA 1HYGA 2ZQYA 2QRJA 3P2OA 3NTRA 2GERA 4J0FA 2ZYDA 3ANLA 1ZK1A 4IDFA 3AY6A 2QYTA 4MVJH 1M6HA 3DHYA 3RU9A 4QXMA 2DQ4A 3L07A 2NLOA 4UUMA 1P9LA 5L4LA 3KYCA 4KDEA 1MC4A 3I9JA 4XDYA 4YJFB 4YVFA 2ZB4A 4JBHA 1WZEA 4RVGA 3PDJA 1LBEA 2HSDA 3T7EA 5KOIA 3EW7A 1YH3A 3K6JA 4CR8A 1QRRA 5TX7A 5JDIC 3RASA 2GN9A 1PR3A 4PZCA 3UXYA 2DC1A 2RHRA 3VVCA 1TT7A 1C1DA 1XHLA 3HFGA 4FW8A 1IPEA 3HB4X 1T4BA 1Z75A 3E48A 3PGXA 5A3JA 1DC5A 1KY4A 2G0TA 3BTUA 2IYOA 3GNSA 4FFLA 8ADHA 4E4YA 2Y0CA 1JWBB 2WM3A 5TSDA 4FBGA 2A94A 3FHLA 3PHJA 2BFPA 4XQGA 2E82A 4U7WA 3H5NA 3ZWMA 3NAQA 1BXZA 5F3RA 2R00C 1RWBA 3W8FA 4OMUA 4AJ4A 4FFMA 2WYUA 5DULA 2E48A 3DAGA 3LK7A 4YAEA 3U0BA 1LLUA 2VZ0A 1S7CA 4UEJA 1N92A 3ICCA 1PS9A 3TL3A 2Q1SA 4MKRA 2O3TA 1WWKA 3WSWA 2W4QA 5KTKA 3RFVA 3KV3O 4TVOA 4A03A 2X0RA 3ADOA 4BNGA 4B7CA 5I7FA 1PJ3A 4LSMA 5G0SA 4C7KA 5BSHA 1ZSYA 3BHJA 1PQPA 2YV2A 3KHUA 2EERA 1C1DB 1JU9A 3C24A 2AW5A 1IULA 2V65A 4YJHB 1I3LA 1A27A 3OA2A 1ZO8A 2RIRA 1SCUB 4TVBA 4RF3A 5JDCA 2QYSA 4XEHA 4E2YA 2W2LA 4RPLA 1R12A 4Z9YA 3GN2A 3KTDA 2CVOA 3O26A 5CEFA 3WGIA 4LMPA 4XIYA 1LDMA 3W4KA 1XWFA 3QP9A 4IJUA 4E3ZA 5KVSA 1PJ4A 3JQAB 4CL8A 1N7HA 2FPPB 2PA3A 3ITKA 4GH5A 2Z1NA 2YDYA 2DPGA 4Q3EA 1XKQA 3BTVA 3PJGA 5GZ6A 2NU6B 5T6BA 3WQQA 2UUPA 3DMTC 4F3YA 1C0IA 2NADA 4IDEA 1T25A 2B4RO 4TZKA 5C3MA 4NFHA 2FPPA 3BMOB 1ZSVA 2Q1TA 2ZQZA 3QWIA 1VC2A 1I5RA 3COSA 4BNXA 1GR0A 3M2PA 1KVRA 3KEQA 1P45A 2Q2WA 1XU7A 1Y8QA 1EZ4A 1GZ4A 2DBRA 1AE1A 1DOHA 1CWUA 3GA0A 2CZCA 1H0KA 3DMTA 1HSZA 3H8VA 4U5QA 4BGIA 5H81A 1NPYA 1QXSA 4LCEA 3RI3A 3PIIA 2X5JO 3DZHA 1H6AA 1QMGA 3DZGA 3HADA 3H9UA 5FEUA 2J5KA 5CPFA 5IXYA 4PVDA 2EF1A 1BVUA 1I8TA 1LDBA 2HJSA 2JAHA 3QA9A 4EEXA 1HDGO 1T1SA 4BO0A 4TRRA 3GDOA 1K2WA 4RZHA 2OOSA 3VTFA 4M55A 3M6IA 1QV6A 3OMLA 1PJ2A 2NVBA 1IZ9A 1BXGA 4L73A 2DLDA 1YE3A 5A04A 1P0CA 1P1FA 2EXXA 5TRTA 3WLFA 2VYND 4WNCA 5IF3A 4K1LA 4L4RA 1DHTA 5DDIP 4RL6A 2B36A 1JDJA 5DBIA 2Q4EA 3AI3A 4OM8A 4YRBA 2XOXA 4WASA 5C7OO 4MKZA 3JYQA 3RAJA 2IZZA 1NWCA 1NFFA 4WK6A 1MX3A 3FTPA 1DC4A 1GV0A 1T4DA 1DHRA 2VYVA 3EZLA 1CDOA 5EJ2A 1Y1PA 4BIIA 4YXFA 2HU2A 1EUCA 1LRKA 2NU9A 2GO1A 3QWFA 3HSKA 3N58A 1DAOA 2BI7A 1A7AA 3PVZA 4CLXA 4TRJA 1SZJG 4K6CA 4DIFA 1U4SA 1NFQA 4W82A 4WLOA 3I6QA 2EP7A 1RPNA 1GTMA 3GQVA 4MP6A 4PZEA 2JKVA 2V6MA 3QLJA 2DM6A 1PZHA 1NVTA 4BO8A 1X0VA 1ISMA 3PJDA 5JLAA 4GI2A 1VL0A 1H9BA 3H9EO 3RWBA 4OIMA 2IXBA 1GU7A 1JW9B 2J8ZA 3BA1A 1B3BA 1PQWA 1XLTA 3KEOA 4KZPA 5IN4A 3ST7A 4YQYA 1WNTA 1DPGA 1YL6A 4BB5A 3CUKA 1F8FA 1ZNQO 1ISGA 1J49A 3IP3A 4OO3A 1CF2O 3AM5A 2P5UA 5AVOA 3T4EA 1VE9A 1DAPA 2XXJA 3C1OA 3FWNA 3TZHA 1YL5A 1NASA 1ONNA 4GL4A 5A1TA 2BELA 3SC4A 1YQGA 2YHIB 2YHUA 3MJVA 1VL8A 2BH9A 3I83A 3IUPA 3MOGA 4JP2A 4YAGA 1YOVB 3E5RA 1N2SA 1GL3A 3QV1A 2VYVD 4YAIA 1P31A 1A7KA 2PH3A 2ZCUA 4GGOA 4BL5A 2Q45A 3I9NA 3FNGA 3ASVA 5T67A 4EYEA 4ZICA 1GQ2A 3D3EA 2DBQA 5ICSA 1J6UA 4BUCA 3UAGA 3DAPA 1Y8RA 3U4IA 5KVQA 3NT5A 1JKJB 2O7SA 3AUTA 3WGHA 1C0LA 3W6UA 1QLHA 1PJCA 4R3WA 4UUNA 3OJ0A 3W4JA 4LCJA 5G4KA 5BNTA 3INTA 4YT2A 4YJHA 4D3SA 2VHVA 4GKBA 2NTVA 1TA4A 5L7WA 1ZXLA 4M86A 5DOZA 1EBFA 3DTTA 2PZLA 1KETA 2IDZA 4DMMA 1PJLA 4R3NA 1RM3A 4WOJA 1MC5A 1B14A 5LCXA 2Y1EA 5KKCA 4PLFA 4CMBA 4D46A 1PZGA 1E3IA 3S2IA 1EK5A 1G6KA 4BNJA 2O23A 2QX7A 2YFHA 1EFLA 2EKPA 5AOVA 1ZMOA 4OH1A 4KDFA 2Y68A 4RPGA 4E5NA 4R4JA 3SJ7A 2NU7A 2EHDA 4R1NA 2PGLA 4DRYA 1TT5A 4NMHA 2NU8B 4MVJE 3JD2A 1JKIA 4CUZA 4D0SA 4HY3A 1NXQA 5JAQA 1VLLA 3I6IA 3AW9A 4A10A 1NAIA 2A9FA 5A3VA 1UXHA 2Q2QA 1U7TA 3BMQA 3ZHXA 3EHEA 4BNZA 4WNIA 1QKIA 5G4LA 2FZWA 2FRDA 4AJNA 5IG2A 3I9LA 3FBGA 3MZ0A 1P1KA 4BKUA 1LEHA 5JAZA 3OQBA 2O2YA 4JX8A 1CYDA 1H2HA 2X5KO 3F4BA 4MIEA 2QRKA 2WEKA 4YA6A 2OL4A 4A2CA 4D0RA 4MOWA 4DYDA 2JD1A 4PLTA 4J4TA 1TVEA 2YQ5A 4EZBA 1Y81A 4Z9XA 2EW8A 2HDHA 2GN6A 5L4NA 1E5QA 3RBVA 1LRLA 3PYMA 4PLYA 5DNAA 1DLJA 2DFDA 5ILOA 4R16A 4PLVA 2HCTA 3GMDA 1M67A 5A9SB 1LTHR 3PHLA 4X54A 1R4MB 4FC7A 3VKVA 4OYRA 4BKOA 1PJQA 1A4IA 2NV6A 4UEKA 9LDBA 4JXKA 2BFAA 5B4VA 3BMCB 3QRWA 2VWPA 4PCVA 3ZGYA 1LJ8A 1P77A 3JTMA 4BHTA 1EE9A 4MDHA 4GWKA 3RU7A 4RZIA 3FTNA 1C1XB 1GFSA 2DBVO 3MCVA 1E3WB 1LSOA 1YS4A 3RJ9A 3S2EA 4NH4A 3U62A 5IZCA 3SEFA 5JFOA 3CMMA 4WPGA 3EUWA 2IODA 1ULSA 3RCBA 4DQUA 1Q1NA 3MWEB 3F4LA 1XA0A 3KOUA 3PQEA 2ZYGA 3RBZA 4PLGA 4B8ZA 1YL7A 3NYWA 5TQVA 1X7HA 1HE4A 2O48X 1E77A 3AY7A 3LC1O 3WWZA 1T26A 3UGKA 3RUCA 3I1JA 2ZATA 3VDRA 1K6XA 2C2XA 2NQTA 3G79A 2VT2A 3TZKA 3IKTA 2EGGA 4I5GA 4J1TA 4QQRA 1NM5A 1SEPA 1V0JA 4GX1A 2VRBA 1V35A 2B4TO 3MJCA 4JIGA 5T8KA 2NNLD 2Y93A 4AJ1A 2J5RA 4XWYA 1F06A 1HDOA 3I9OA 3EC7A 1P44A 4II2A 4PVCA 2GDZA 2C54A 4R5MA 2GZ3A 1IPFA 3MJ4A 3INGA 1VRWA 1B16A 5CG2A 2EJWA 1E6WA 4Q3NA 3GGGA 1XQ1A 3RC7A 4XDZA 5ER9A 4I9NA 2LDBA 3DBHA 4AJKA 3U09A 3PDUA 4O0LA 2B37A 1EMDA 1B2LA 2VCYA 4NBUA 2PFGA 1U5CA 4E13A 4OHUA 3VPXA 3FR8A 4XJTA 1DFGA 1BXKA 1J0XO 3RVDA 2YHIA 3Q9UA 3ROMA 3M1AA 5C7LO 2HMWA 3GT0A 3T7CA 4Y8VA 3SLGA 3UN1A 5FYDA 3WB9A 5KVCA 4XYGA 1UXJA 3KB6A 1NX6A 4Q3AA 1GQQA 4PIVA 1Q0HA 3EAGA 2P2SA 3JQAD 4DQXA 1C0KA 4ZQGA 3KM0A 5C5IA 3JD3A 3A1NA 2E4AA 2GZ1A 1DC3A 4L74A 1DIBA 1HE2A 3F5SA 4QEDA 2Q3EA 4J2HA 2VUSA 4CMIA 9LDTA 3U49A 3B20A 5F21A 4GBJA 3V2GA 5DP2A 3PWZA 1G0OA 4Q3BA 1Z45A 4NJOA 3D0OA 2ZJ0A 3K92A 4BVAA 3GLQA 4QSMA 4C7JA 2BLLA 5H82A 4A7PA 4BB6A 3CINA 4ZQEA 2SCUA 5CP8A 3A28A 2GD1O 4LGVA 2J3JA 3WTBA 5COQA 4CV0A 5K6AC 2LDXA 4E5YA 4XR4A 1QP8A 1F8GA 1GZ6A 3NX4A 4GX0A 4PRKA 4D41A 1UXGA 5KJFA 4QTZA 1P33A 2JL1A 5BT9A 3WQSB 4WCFB 4W99A 2Z1MA 3IDSA 2EJVA 3WG9A 4CMKA 1MG0A 2AMFA 4MVJF 4NBRA 4BOYA 1KVTA 2ZB3A 2AE2A 4D3FA 4OXKA 1R16A 5A9RA 1DXYA 4BQPA 3KETA 5JAIA 4BO3A 1GD1O 1IZ0A 4DQVA 4OSPA 1U4OA 2ZTVA 2NU8A 4GLOA 1ZKMA 3D5QA 5T57A 1ZK0A 1Y9EA 2ZK7A 2R2GA 2PD3A 5T8KC 1RM4A 1WAMA 3LVFO 3OQ6A 3KO8A 3DWFA 3ZWWA 3HNPA 4BGUA 3Q11A 3WFIA 1NP3A 4NK5A 2FWMX 1G1AA 2D5CA 3RUDA 1PIWA 1E7RA 1XDWA 4I9UA 4W4TA 3WBBA 1ML3A 3KSZO 4CM4B 2C7VA 3FBTA 1CETA 1DJNA 2H5LA 3RKRA 3EGOA 5IZCC 1BDBA 1I30A 4UUOA 4PN3A 3O8QA 2OMEA 1T2DA 1ZH8A 3KVOA 4LSWA 4YTEA 4OQZA 2C07A 4BMNA 4KQXA 4HNHA 1YO6A 2DTDA 4BGVA 1CIVA 2JHGA 4Z3KA 4DBVO 4QT0A 1HE3A 2E49A 4YPOA 4CR6A 1MV8A 2X9NA 4ESOA 5AQ1A 2D2IA 3NGLA 1BSVA 3GAFA 1U2DA 4E21A 5DBGA 4XB2A 3STHA 1NYTA 2E37A 2IE0A 2NU6A 1WMBA 4B7XA 1BDMA 4PZDA 2PZKA 2BRUA 3C1TA 3H65A 3B70A 1E1LA 2I3AA 3K2EA 4OAQA 4DL9A 4OOEA 4WKGA 3MWDB 3UICA 4CM9A 1PZFA 1LDNA 2EG9A 1BG6A 4GSLA 3CH6A 4Z9FA 3SX2A 2FPGB 1DIRA 3L0DA 2GSDA 4IPTA 4I5FA 4XGIA 1TXGA 3OECA 4K9DA 2VOEA 4DIOA 1NR7A 3DO5A 1R4NA 3ON5A 3BHIA 1KC3A 3G17A 5FI5A 3GDFA 1PR9A 4IUYA 1H6DA 1WMAA 2BFOA 4AG3A 4XRRA 3JQDA 3GNQA 5U1PA 1QV7A 2A92A 3PTZA 2HK7A 1PJSA 3QQPA 4L8VA 5EN4A 1XIVA 3JSAA 4HBGA 3O38A 2NWQA 3JD1A 5CAEA 4RPJA 3R3SA 3ZZNA 2DPHA 5AYVA 5B1YA 3WFJA 2FPGA 1I3NA 2Y1CA 3G0OA 3GPDG 3N74A 4OQYA 3H2ZA 5A05A 1DEHA 5JO0A 3DBRB 4ITUA 3PEFA 3G49A 2NUAB 1TLTA 2VHZA 2EWMA 4PG4A 3UFXB 1LXCA 1WXDA 3FCOA 3W1VA 4CMHA 2B4QA 4Z0TA 2H6EA 3WXBA 3HG7A 4OL9A 3CIFA 3EYWA 5TC4A 5C7IO 1U2GA 3IP1A 3TOZA 2Z95A 3BAZA 3GVPA 1LA2A 3G1UA 4IDAA 1E3EA 3IMFA 4BNIA 2HO5A 2ILTA 1DC6A 4WCDA 1DSSG 1GEEA 5I8ZA 4ND5A 2PKQO 1ARZA 3RKUA 2VTEA 5T64A 5G0TA 3DZKA 1G0NA 4YBZA 3ZWOA 1DRUA 1ZW1A 1ENPA 3GGPA 2WJPA 2O3QA 2AA3A 1Z7EA 5AXDA 3SLKA 3ZU3A 1LLDA 5FWNA 2ZIZA 2NQ8A 4FSHA 1VJTA 4WEOA 3ROQA 5IDWA 1K6IA 1HKUA 1I0ZA 4JK3A 3ZHBA 5CDYA 2BKAA 4KTTE 1OC4A 4UREA 4JP3A 3ZWYA 4J0EA 2CDAA 3GH3A 3NDIA 1R66A 5JMWA 3I3OA 2OBYA 4ALKA 2OHXA 1GV1A 4J2OA 4HV4A 1U3UA 4TSKA 4AFNA 4L76A 4WJZA 4XKJA 3SC6A 1HLDA 1T2FA 3G3EA 2O2SA 1MLDA 3JQ6A 3BTSA 1KVQA 3DMYA 4PGFA 4ILKA 4PG6A 3IJRA 4OXYA 2YZ7A 4OJNA 3M2TA 4NBVA 1VSVA 2E6UX 1PGOA 4R1TA 4FB5A 3PRJA 1KYQA 4TROA 4YRDA 1AUPA 1E1KA 2CF6A 5LC1A 5JY1A 3JD0A 4LRTB 4A5OA 1SAYA 4RQUA 3I52A 3IAHA 5EQDA 3CZMA 3GAZA 2V6BA 3FD8A 3LDHA 3ULKA 3HJAA 1N9GB 3O4RA 1T2AA 5DCUA 3V1YA 2JCYA 2JJYA 5JCXA 3KYBA 2OUIA 1IUKA 4TRNA 4YEDA 3OP4A 1HZJA 1AXEA 3E8XA 4OKIA 5G2OA 1FDWA 2AQIA 4O59O 1XGKA 3CE6A 4J4BA 3NGXA 4R41A 2EEZA 3AOEA 4DREA 4BGEA 1PU2A 4HFRA 3JQGB 4I8XA 1FDSA 4KOAA 4ZN6A 1SMKA 5THKA 1UDAA 3JQ8A 4RVFA 1AHHA 4MO2A 4CMIB 3F47A 4XD2A 3L6OO 2VRCD 3UUWA 1PL6A 2FR1A 1YONA 1F17A 2OP1A 4YJDA 2Y0DA 3GNTA 4MVJG 3OJOA 3DZBA 3WYEA 1EVJA 1Q0LA 4XJSA 4BKRA 1JLLB 3PPIA 4EJ0A 3D5TA 1MUUA 4YR9A 3VPHA 5IFLA 4XR9A 3VHRA 4CV1A 4YT4A 1SEVA 2O3JA 3R6DA 4ZJUA 4D3DA 2DUUA 4RDHA 1QG6A 3FWZA 1ZZEA 3OQ1A 4PLCA 1XSEA 3SXPA 1IHXA 1LC3A 5F5NA 4FJ0A 4DA9A 1XYGA 2VNAA 2IXAA 3TSCA 2GN8A 3DTYA 1VKOA 2X22A 4DUPA 3LF1A 2GLXA 2UAGA 2VZ8A 4CMCA 3FSRA 2BGMA 1ZMTA 2EGHA 3AOEC 1OZAA 3NV9A 3OJEA 5I8WA 1DIAA 2DUWA 2Q99A 4BO2A 3OETA 1YDWA 3HHPA 4MVJA 1GADO 3OM9A 2D5AA 3WYCA 3LZ6A 3WR5A 2QQ5A 2GYYA 4ZA2A 1V3VA 1P0FA 2X86A 4J49A 4K28A 2G1UA 1FXSA 3ETGA 1HETA 3MWDA 1LSSA 4IM7A 5G0UA 3F3SA 1OC2A 3Q2IA 2Y67A 1Q2XA 4GVLA 2GF2A 2VWGA 1Y6JA 1UXKA 4Y6SA 3DBLB 1E3WA 3GMSA 2AQKA 4DBZA 1V6AA 1Y5RA 2C59A 2PNFA 4NIMA 1SBYA 5F1PA 3D7LA 1IB6A 5KVVA 1U3TA 4XYBA 1JKJA 1BRMA 3ZCXA 1IYZA 5JMPA 4B4UA 1GZ3A 3AWDA 3QWAA 2GZ2A 1ZIDA 2GNAA 1OAAA 1ZUD1 5JW6A 1N7GA 3Q9NA 3WTCA 3PXXA 1I33A 4WUVA 6ADHA 3CMCO 1Z74A 4MP8A 4EI2A 1BGVA 1RM5A 4M8SA 1XG5A 3I5MA 3LLSA 3TZQA 4AVYA 4NNJA 3WJ7A 4C4OA 2NTNA 4B4WA 1HDRA 3QWHA 2GR9A 4FJ1A 4E32A 1PSDA 4WOKA 2A4KA 1Q7CA 2IYPA 1FDVA 4KTVE 1RKXA 1GPDG 4BNKA 3HDQA 4L0QA 4Y98A 4BNVA 5B4TA 1U8XX 3GDGA 1KC1A 3H9QA 4MVJD 5CAEB 3LT0A 3AUUA 2W98A 4XYEA 1H94A 3RUHA 1NTOA 3CPSA 2FZEA 4Z3DA 4J1SA 4CR7A 2Y1DA 4LRSB 5H83A 1YJ8A 2HQ1A 3ICPA 3B6ZA 1ZBQA 5I7VA 3HUDA 2PGDA 2X1HA 3RROA 1PGPA 2ZTLA 3MJSA 3NDRA 4RV9A 3ROPA 5JC8A 5EPOA 1NAHA 2FP4B 1P3DA 1VJ0A 4UUPA 1QSGA 3MWEA 3KYDA 3NEPX 4RPKA 4IDDA 5JY6A 4CV2A 4W7IA 3C8MA 3PZBA 3L9XA 3ZDFA 2WDZA 2VWQA 2RBEA 4BMSA 1BXGB 3PQDA 4HFMA 4IQ0A 4CUKA 4QUKA 4YQZA 4CM1A 1UDCA 3LQFA 4DPMA 3H6KA 3NT2A 3WSVA 1B8PA 1I36A 4JQCA 5TLSA 2HKIA 4K6FA 5ER6A 4EJ6A 1K5HA 2X23A 4HKTA 3LC2O 1MP0A 2W2KB 1ENZA 4CPDA 1N1EA 2JAPA 4XB1A 5EL0A 1QR6A 4QFDA 1K3TA 3O9ZA 1SB9A 3VH1A 1NR1A 2VN8A 1X1TA 3P5SA 4EITA 2X8LA 1DDOA 3KYDB 1O5IA 1RJWA 3DOCA 2AG8A 4M1QA 1Q7GA 1E6EA 4DLLA 1P1HA 3PQFA 1SNYA 5GY7A 2YW9A 1A9YA 2ZCVA 4PG7A 2F1KA 1D7OA 5JPIA 1N8KA 2WE8A 2WE7A 4Y67A 4BMVA 4CL3A 4B3HA 4J7XA 3PHHA 2YY7A 4OKNA 1YXMA 1KBZA 3ZWAA 5CDGA 3H3FA 1I3KA 3ENKA 4QFCA 4CLOA 2VHYA 1AHIA 1PZEA 1HF3A 4NU5A 4RVDA 4FFRA 3DBVO 3VC7A 3ZW9A 2HMVA
chains in the Genus database with same CATH superfamily
1U4NA 1U8EA 2IYTA 3LLCA 2RAPA 2CXQA 4J16A 5KU1A 1GFIA 4KXQA 1ZD5A 4M37A 2IXTA 1I2AA 1E0JA 4NBWA 2DQZA 5CA1F 1WO8A 1UBGA 2ZBPA 2Y99A 2CHUA 4GR9A 3K9WA 3DM5A 4BBPA 2OGUA 2V7BA 2O8FA 1UMCA 3F9CA 4ITRC 4UU7A 1L8AA 3VNAA 1R0LA 3QHAA 2ZIAA 1CUDA 2FPUA 2N9UA 3T34A 1NURA 1I24A 5IWAB 1TJPB 1CUBA 1JLKA 2FK7A 2ENUA 1LQUA 3EDCA 1C4XA 1KEZA 3IALA 3T15A 3U5TA 4TYYA 1U81A 2YZNA 1RQGA 2O2GA 3PX3A 5FUWA 2F1OA 3G0IA 1CZNA 1GUDA 2J3MA 5JE8A 3VI3B 1HDYA 5KWEA 4QPZA 4WHMA 4PGGA 2JI4A 2HTFA 2VNKA 4QRHA 3UG6A 4BQIA 3MAGA 4JELA 1U94A 3DE1X 4J7UA 5CVEA 2I66A 1B26A 4E2ZA 1F14A 4INPA 4IX9A 1AZLA 5NLLA 3E9MA 3VZQA 5AM3A 4MR9B 4C3ZA 4PC7A 4OHPA 1VHJA 4RM2A 3ORFA 4KDCA 3HL4A 2FQQA 1TCUA 5AVWA 5J4KA 3SHQA 5JSZA 1O6GA 4NLLA 1PQYA 1J07A 3EGVA 3UPUA 3PC3A 4KWIA 4IGEA 1E2BA 3EPPA 2X8JA 1FMTA 1XZPA 1EG2A 1KDTA 1BN6A 2GJ4A 4O3MA 3RYFA 3WGZA 2C0PA 3F1KA 1X6VA 3W2IA 1LVUA 1XDSA 3U40A 2QP9X 2IZ7A 3OPYA 4HDNB 3P0JA 1AK9A 1PL8A 1USKA 3LCRA 4II7A 3NJ8A 4PZAA 3EGCA 4KB5A 2G0NA 1NBMD 2IEGA 1JXQA 1ZEMA 1TTPB 1Y6ZA 2PUGA 2YOFA 1GNPA 4DT1A 4DG8A 1SCJA 3ONDA 3AKZA 1T2CA 3CEPB 3Q7TA 4Z86A 3E35A 3N8IA 2OHOA 5SV2A 3PNLA 3PPWA 1CY7A 2PMEA 5JRZA 4I5DA 2FN7A 3MGCA 4GZ5A 3AR2A 2A6PA 1E2UA 3C16C 3CUTA 4MX8A 3V55A 4KVAA 1B8VA 5IDXA 1J42A 5KS2A 5JDIA 3EVNA 2C83A 3H3JA 1L1QA 3IE0A 2PLAA 2VDMB 3ICOA 3QVWA 3BXZA 2DR3A 1YIDA 3CW8X 3GHYA 3QVXA 1XXLA 3MJDA 5KU7A 2HLDD 4S04A 2ZJFA 3EVGA 3GAAA 2A0WA 3FZQA 4JXXA 3T7KA 2XDWA 3ADDA 1R50A 3V9AA 2JGAA 5GV7A 5GJBA 4ZT3A 1RZ3A 2ZW9A 4X8LA 4OGWA 1OBVA 4FS3A 1EUDB 7ADHA 4B7AA 1FMFA 1CK4A 3W5DA 4XWOA 4WFKA 1T4GA 2N0SA 2H00A 2GESA 3VMFA 3WDKA 3GPCA 2H17A 2XT0A 1CRZA 4PLZA 1SXIA 1P6UA 2GN4A 1H1LA 2OG1A 3R6TA 4R3UC 2WP8J 3LMKA 4XA8A 2WK1A 1UXIA 4FDMA 4FUQA 5AP9A 4Z54A 3INNA 2H54A 2ZIWB 5HS4A 1QVRA 1KO1A 3EVEA 1HOXA 1U3WA 3KBOA 3MNFA 4LV8B 3MG9A 5FX2A 2XMCA 2D2FA 3KG2A 3FSJX 3OZDA 1YA4A 3OF3A 4V0NA 1JRLA 1LPSA 1ODSA 1QQ7A 1V39A 1V25A 2H5EA 3BCSA 3Q9SA 3HEMA 3I32A 5IVPA 1TM7E 2KW5A 4K6OA 1A9XA 1NW6A 1SU7A 1IHYA 1JUDA 5DXAA 1J5PA 2VJYA 3LKDA 2HF8A 3OLQA 3MEQA 3OQMA 4IXTA 3GLTA 4AQYB 2Z98A 4KX3A 1TYDE 3K9GA 2Q3MA 3N86A 4NBNA 4GGPA 2VPPA 3LY9A 3THRA 3KQPA 4FKMA 3U3OA 1K92A 1MB0A 3OAAA 4NJMA 5DM0A 2WSMA 1JILA 3W4IA 1W4CA 1RE1A 2WZDA 2DFPA 3HJNA 1VE1A 4QRDA 4A82A 4UPDA 1H5UA 4D6YA 2HRZA 2WWVD 3VSAA 4DTCA 2A67A 1UZLA 1MVLA 3L18A 4BFTA 3TM5A 5D5PA 5C8XA 2I3DA 1ZC4A 1AGYA 2XT6A 3H3XA 3HH8A 3GGDA 3R0IA 5SYNA 1F8XA 1P29A 4RIFA 1IQRA 3QLVA 4HQRA 1ML4A 5JSQA 1BYIA 2BI8A 2DECA 3JQ7B 2QX4A 4EUSA 5FFFA 4OQNA 3SM9A 2ONJA 1IB0A 2FWJA 1JMKC 2WKWA 5FJJA 1T6YA 1Q1GA 2HHLA 3AUJB 1V1MA 1CBUA 1T8WA 3ANNA 1QQ5A 2QDKA 3M6VA 1S96A 3I58A 4M1EA 4OQFA 1JLHA 2R97A 5IS2A 5ETJA 1E2EA 2B1GA 2HZBA 4J0KA 3W2EA 2E4WA 2FX5A 2H1FA 4WEQA 3ZWCA 1YZUA 2XWPA 3CKMA 1ACLA 4FHEA 4I08A 4RCVA 4HH4A 5H9WA 4DV7B 1BGWA 1U2GC 2C3MA 3ZWVA 4L9SA 1Z8HA 4HAWA 1A95A 3D02A 3F9RA 1JBEA 3CLRD 3QUAA 1L3IA 3IIJA 4WBSA 3A6ZA 2VJCA 1NVMB 2B6NA 1R8JA 2WWTA 1E5XA 1U90A 3LKVA 4K7JA 4KO1S 4QNMA 1DRWA 2BJHA 4J0CA 1RYNA 3F97A 1FYXA 2FY8A 1P8AA 2EV9A 5ELLA 4L8LA 4MUHA 4BO4A 2O6HA 1H5NA 2PRKA 3FNRA 1SCBA 3V4PB 4ARZA 2DJIA 3QYPA 1JMYA 3CN9A 3GARA 1MAHA 1P1JA 1QTIA 3KPWA 2WF9A 1J1UA 2IYWA 3W6NA 4F6CA 1JJAA 4U6NA 2OR3A 2ZUDA 3JWPA 2QE7D 4P08A 5GPBA 4BNDB 2GXSA 4RQAA 2OV4A 2J4FA 2SKEA 2G80A 2QUHA 1GPAA 1MHPA 2COEA 1U7HA 1ZH6A 3B8HA 3CGGA 3IMCA 4L57A 4TSRA 2GEDA 5A03A 3G1WA 5JQGA 2PBLA 3QFCA 1NOJA 4RH0A 1HE5A 2I76A 3HVRA 1CERA 2C9BA 5J5AA 1UBLS 2Z5LA 2L19A 1G21B 4UAUA 3R5XA 4E0BA 1V47A 4XX1A 5AVXA 3NAGA 4XTCS 2JGJA 3SBEA 2PANA 3TWOA 1P7CA 2BHSA 3I2GA 1GQFA 2O7NA 3AKCA 2AFIB 3CLKA 5KUTA 1GPH1 1N2BA 4J4HA 3ZE7A 2QMOA 4RWZA 2WPDD 3C4QA 4UD2A 4C0LA 3CLTC 4QJ4A 3CH5A 3HN2A 4QOSA 4Z0HO 1VYUA 3DUWA 3FNHA 3UC5A 5CDSA 1SKAA 4MDEA 2GDJA 5HTOA 3A6EA 3HLYA 4CLEA 4R8KA 2B0JA 4BRZA 1ORDA 3BXHA 4N3BA 6YASA 1VPDA 4J29A 4NYMQ 3FETA 1KJWA 2W37A 3ZV7A 4EG0A 1HL3A 3L2OB 3BE4A 1RCTE 5ICMA 2EU8A 1U2PA 4BMOB 1U3CA 2IHZA 5K45A 1M2VA 4PRYA 1YU9A 3OIGA 4ALLA 1EVIA 1Q7BA 1EFDN 4B17A 4ZI7B 4M60A 2GXAA 2BFCB 1GG5A 3X1YA 3IOEA 4YJ2B 5LP6A 1IG0A 1TK9A 3EXEB 3U3MA 4UULA 5L8VA 2W43A 2EIXA 2PKCA 3S81A 4XQ0A 3OEWA 1PL0A 3R2JA 1BROA 2E5FA 3L6RA 3DFFA 1X7WB 4IEFB 3L04A 1PEDA 4H1WA 2K5UA 5JXGA 1GYPA 4IRMA 5F4ZA 3DQQA 2ZQ5A 4CF3A 1O6BA 1A82A 5LPNA 1NXXA 5ALUA 3S2UA 4ZQBA 2QB5A 1YACA 1T5OA 1R37A 2RB4A 2VJMA 3PITA 4GAEA 4KLCA 4Q66C 1R0ZA 4S3MA 3K09A 5DT9A 1JJ7A 3DL7A 4ZCRA 5BSKA 1E0DA 3HFJA 3RBXA 4KYIB 1BCSA 3O6VA 4YAJA 5CPBA 4F92B 1FX0B 1XZ8A 3A9SA 4OFZA 4CCAA 1MJGA 1R2QA 1XTPA 3D64A 4WXRA 4G4IA 1U2RA 3B6KA 4ND7A 3DEZA 2IS1A 4QG3A 1Y89A 1Y42X 2AK3A 4IZOA 3VJKA 1YZHA 1RMTA 1S7GA 3A8TA 4I1IA 3HVHA 1RMYA 1HG1A 2XPCA 4P38A 4KV9A 5CHYA 4AG6A 4NZ9A 4YP0A 3FCYA 3M4JA 3GFBA 2XB4A 4G5YA 1Y3DE 3W7BA 5HZHA 4O63O 2ZRKA 4YDRA 4QO8A 4BFZA 1PV4A 1W6UA 1YS9A 1WB4A 5K6TA 3L7AA 3TVTA 3G7NA 4ZZ0A 4AWXA 3BMQB 3S3TA 2JLRA 4DR6B 3I2HA 2F43B 3IJPA 1SULA 1WLYA 5JAMA 1SHTX 1B74A 2DUNA 2JGFA 5ALRA 2WINI 3BE5A 1LUAA 2IPNA 2OV2A 4CLRA 4WW0A 2ZSHA 3D7NA 4KIWA 4MUXA 4QECA 1N77A 4K9KA 4DJDC 3ZY2A 4RZQA 2BEUB 3A32A 4RYDA 3I30X 4FTWA 4O29A 1ZM2A 1ST2A 1QFYA 5FUYA 1AGRA 3KQLA 5EUCA 3V80A 4LK2A 2FRXA 2YIJA 4OLFA 5TGDA 2OSBA 2IUUA 1J8VA 1R15A 1YK0A 2XVZA 2DWQA 3ROZA 1G7RA 4WCFC 4CQLB 3IAEA 1KOLA 1JHDA 4FHDA 4A0QA 4C6TB 5GZ3A 2FW9A 5AI4A 3EF1A 3RE1A 5JTUA 4QFMA 2K2WA 2VJNA 1QF6A 3OEHA 3PQ3A 4Q0MA 4MWSA 2WWGA 1YMVA 3HGMA 2F59A 4QOEA 4E7OA 3EUEA 3JVEA 3LECA 4QTUB 5AJHA 2ZB8A 4OCZA 3IB6A 4LZWA 3CNNA 4N5IX 1YC2A 1RRKA 3F6RA 4HQKA 4JQYA 2F8LA 3ZVRA 3FMIA 3RC9A 2D5IA 4MCAA 4LOIA 1ZI9A 8ADHA 2GBIA 3VZCA 4BEBA 1L5HB 2F00A 2ZRLA 3CZRA 1Z39A 1VJGA 3EZYA 3L4EA 4NI5A 5KNBD 5IJXA 4RHFA 5GQSA 1QONA 3QYFA 4WI1A 2WJIA 2Z2YA 1UT6A 1XEAA 3DLAA 4OK3A 5EYPB 1FP6A 1TMGE 4Q12A 2XZOA 1MA0A 4JBWA 2F1RA 5GIOE 1U5AA 3EDOA 3FN4A 3K9BA 3UCFA 2X3UA 4IXDA 1LQTA 4P3YA 1ENOA 1KVSA 1U9ZA 3P19A 1J24A 3UW1A 2G06A 2EYUA 1SBZA 3N87A 1GU1A 1NMZA 2ZJ6A 3DA8A 2QAGA 5BN5A 1MW8X 2FETA 2IUSA 4J91A 4RL4A 5ES3A 3DE5X 4LNUA 4BO7A 3SVTA 3ODGA 1JDSA 2REXB 1Q0UA 3IBFA 4JROA 2LGJA 3L7NA 4NATA 3VX4A 1TA9A 2V8OA 4NESA 1P1IA 1U11A 1KFKB 4Q48A 4MP3A 1NQ5A 2Q50A 4EFDA 4LS3A 3ZW8A 2UDPA 1CY2A 3FDZB 1ISHA 3P52A 4FE3A 4OUDB 5GVSA 4FGWA 3OM1A 3LYLA 2W71A 4RVUA 4TVKA 3AVWA 3K9CA 4H6WA 1GCUA 1DB3A 1E9SA 2XNKA 1WDMA 3TG2A 5JCJD 1W0KD 1YCFA 2GKOA 4OU4A 4DC9A 3ZBPA 4LHYA 1OWLA 5H3CA 3HY4A 1C5KA 1XLUA 3Q3CA 5F1KA 5A7HA 3WBFA 1PQ4A 2HMUA 4NK4A 1Z8DA 4A92A 2AXPA 2VT3A 3IEPA 4JUDX 3OZRA 3WJ1A 1RLIA 4IJVA 1HLPA 1NE2A 1K0FA 2BFWA 4KGDA 1R1DA 5DM2A 4BQRA 4BE7B 2J7PA 3W34A 4ZVTA 2QW8A 1SJ9A 4ND2A 2R6FA 4OP1A 5L6MB 2J3KA 2CDRA 4KKVA 4R1UA 3AM4A 3C7DB 4I1OA 5FBZA 2ODQA 2X0NA 4NHEA 3DF9A 3W06A 3T7JA 2VSFA 4UHBA 4U4AA 1GZ5A 3UHOA 2BGNA 2PKRA 1CUVA 1UM8A 3KAPA 1SXJD 3TMAA 1SOUA 1QB8A 2Q8QA 3MTQA 2ORVA 2C7OA 2EVWX 1OXBB 4HYQA 2NUAA 2I7VA 2C4MA 4HWGA 2WU3A 5DP1A 3H7AA 1SCIA 4OAOA 3M1IA 4YMTA 4X1IB 4Y1RB 3JCZA 3SN6A 4LOKA 5JD6A 4JKOA 4BTEA 4HS4A 2BKUA 3NS7A 1B6TA 1T3HA 3DOJA 3TNFA 2PSHA 4IZ6A 1XWIA 2CSXA 2QM3A 2D1YA 4LXXA 1Q83A 3HWX1 5JBIA 3ZXXA 4U2CA 1UADA 3KV1A 5EE1A 2VIIA 2R751 3DMGA 4MWDA 2CXSA 3GLHA 4CU2A 2D00A 2WQ6A 3BHNA 4FOOA 5C1DA 4ZC1A 4KQWA 5TIIA 3V2UA 3T4XA 1XTZA 4X20A 4QJBA 3DE4X 1QS0B 3ZQUA 1Y3FE 4GQIA 3R20A 1LRJA 4GOMD 5I5EA 4BX8A 2GSWA 5DO9A 4HGPA 2C29D 3DE7X 1HZZC 2QYOA 3MPUA 3NWPA 5JNVA 2PLNA 1DEXA 5F9MA 4DF3A 3HUUA 1BW9B 3D0RA 4P4GA 2H65A 1H2FA 1W88B 4HSEA 5ERYA 1DMSA 1PZMA 2FR0A 3DC7A 1R74A 4KMOA 2Q3HA 2ZG6A 4L9AA 4PGHA 2HJHA 2TMDA 3T5GA 3U13A 1DG3A 4HLDA 1XPUA 2OCDA 5CA0A 2W2TA 4RXUA 5IM5A 4AX4A 4HEA1 4CV3A 1VBNA 4CTKA 1YOVA 3WLQA 1PWXA 3R4VA 3L8YA 4ND4A 2E87A 4C4XA 4FONA 4PC3A 3FPLA 4GYWA 4TKMA 4DUYB 4QD3A 3WYAA 1KPGA 1QIMA 2WT9A 4WGGA 5COAA 3UW3A 5BQXA 1XTKA 3IVGA 1UC9A 2G1JA 3O4HA 4F7DA 5BXQC 3R6GA 2QRHA 5AW7A 1Z4QA 2CYAA 2PRSA 4WH0A 5AK3A 2I4LA 3U7JA 1TEHA 1KKUA 2H8GA 3FCCA 1S9DA 3WJAA 4I55B 5B58C 1S3SA 3WLRA 4ENTA 2OXCA 2FN4A 1Z88A 5I45A 1GPWB 2Z4TA 4WKBA 1EJ2A 2NU9B 3RR2A 4F5DA 5AM5A 4A6DA 2VK8A 3AEKB 5ENDA 3KSAC 1SY7A 4CQJA 3QI2A 1ZK2A 1L4EA 1ZVVA 3R3UA 5K4HA 2PVSA 4MWZA 5CVCA 1VGVA 5L9AA 3CVJA 2GJSA 4U6SA 4W7SA 4YAFA 1KFJB 4M9RA 5U9CA 2XUKA 2ZTMA 4WADA 2QX8A 2FKNA 3ORYA 4N65A 2JA1A 5JS2A 1E9CA 3EZNA 4KUEA 3KKLA 1J7JA 1D2AA 4LJ8A 3OHMA 5LP6B 4YJ2A 4FPXA 1KI4A 4TMYA 1DUIA 4UEOA 2DKNA 2X42A 1NP6A 1AF7A 2F1HA 5IW8A 3F96A 1IOZA 1M6WA 1TQ2A 2UYQA 3CF4G 4HWKA 4IDCA 4QWMA 4QXQA 4XIJA 3I64A 3EXHC 1PT7A 2W7TA 1N75A 3B52X 3CNBA 4NBKA 4E5VA 4HX9A 1NXOA 2WYHA 4G0WA 1NSTA 3VOAA 2HT6A 1GUFA 4OM7A 1M76A 3I2JA 5TARA 1XT6A 4TSFD 3JQFA 3CX4A 3P32A 2PX5A 3F3MA 4X61A 1L4NA 3OU7A 4NEGA 3RC3A 2WAYA 1QO9A 2P4HX 2XITA 3MWFA 2RSLA 5J9FA 1PUXA 4C0QC 3GP5A 3S44A 2CSUA 5DTRA 1W4ZA 5FKJA 4AS2A 2Z83A 3M81A 1ISJA 1FYDA 2CVZA 2VL7A 1F6BA 2PA0A 4WZZA 2PEZA 2VCHA 1BE6A 1KYYA 1M6VA 2WJZB 3CUYA 2QRLA 3K31A 1TZCA 4PS0A 1NBIA 1AGXA 4R1QA 1HY3A 4JWKA 4O25A 3HU2A 2C99A 1HBJA 1KH1A 3GGJA 1IXYA 1DCFA 4KUGA 3BTOA 3ZCUA 5FL7D 4N9QA 1AY0A 1WS6A 2CVQA 1OFGA 3H1AA 4FQ5A 1YDFA 4F2HA 3I4CA 3UYKA 4MCJA 721PA 4O5AA 4ZU1X 5C80A 2G25A 1P2BA 1W19A 2IUTA 2GAFA 3GVIA 4M8NE 1N2GA 1N5OX 4HL6A 1MIOA 2CF5A 1P4SA 2PFKA 2IUFA 2XCIA 3A26A 4X8MA 3X1WA 1GARA 2G4CA 2IZ1A 2YYYA 4QEKA 4EY8A 5IK2D 5JT1A 4QM6A 1L9KA 3D2CA 3H9GA 1W1WA 3HKDB 1XRNA 3JAWB 3HB5X 4GD3Q 4NCXA 4PHGA 4Y9TA 4E5PA 3M5WA 3TZBA 5GZ1A 3EEQA 1FUUA 3JQBC 2CVHA 3U7IA 3J81A 1E5VA 3OURA 4LZJA 4M49A 5CJPA 2N75A 4LOJA 2Q5EA 3K15A 2UU9B 2Y3IA 2PUVA 3DZCA 3NHKA 3UUGA 4UHFA 1VKNA 1USWA 1U3VA 2D4AA 3KSMA 3GRCA 1GCGA 3L5OA 1RRMA 1T9AA 2AFHB 2QTAA 2BGJA 1NIPA 2OV1A 3F6PA 3HB1A 4LN1A 4BV8A 4JN6B 4YMUA 2B78A 1NQUA 2O52A 4YECA 5EJ4A 1EGAA 2AT1A 4DCUA 4EKYA 1XNJA 1HDIA 5CHEA 1DRKA 2PX8A 4EEKA 3A1CA 5I01A 1P8JA 2X0JA 1MXFA 1N2ZA 1N34B 1G21A 4Y1FA 3DAHA 4EEZA 5GJCA 1ESDA 1ORHA 3DFZA 4FGSA 1KK1A 1RVV1 1T8PA 1X38A 1FF9A 1QH8B 1Y7IA 3NHJA 3BE6A 3T3PB 2BSXA 5JYEA 3GY0A 3TFQA 4QUJA 3E9NA 5ENZA 1J0BA 4LOHA 4G0YA 1XVVA 2BTQA 5EIBD 4ENQA 2C03A 3L0YA 3NQ41 2QTTA 4FCWA 3UT6A 3VR6A 4EY6A 4CM3A 3EDRA 5HUJA 2XGJA 1X7XA 1X80A 5BSGA 2XY4A 1O6FA 2ORED 4BUZA 4D4MA 1DXQA 2GN0A 3ABIA 4MO9A 3WC4A 1K6JA 2Y1GA 1KWGA 1L3BA 1YZYA 3HA2A 2OC9A 1DOAA 4UHHA 1JPNA 2QROA 2WZBA 1TM5E 1Q74A 2ZRCA 3Q9LA 2ECPA 2ZWOA 4OEHA 3SSNA 1SVOA 3JW8A 2R65A 5EP4A 1BGXT 4D9KA 2FZ5A 1ZG3A 1LF5A 4HDSB 4YT8A 1QFSA 1A2QA 3EPHA 1COWD 1QBKC 2C7GA 4JY7A 2ZE6A 1BQ4A 2HA6A 4KMSA 3LP8A 4RTQA 3GYGA 2A1TR 4MQUA 2BJVA 2GWRA 4HUJA 3KZVA 5FO1A 5G1OA 4DJAA 5I7SA 1Y63A 5ITZB 1O08A 5B7PA 4TTPA 2P6NA 4H6PA 3VH4A 1IZ8A 2NX2A 3G02A 4LHXA 1IWOA 3NFRA 4J07A 1RFLA 1SGWA 2HK8A 4P7GA 4HFJA 3JQ7A 4CKEA 4N0DA 3THXB 1KMNA 5HIMA 3L6EA 3U60B 3N8DA 5CDHA 2EG5A 3BD9A 3I28A 3KQWA 4QYMA 4AP9A 3EGWA 1TK2A 2QIOA 1FUIA 2WG1A 3UKOA 1FSSA 3QIVA 2EARA 3EVZA 1DX9A 3DDOA 5K8UA 1E7MA 4LWQA 1HWYA 3AUSA 4G36A 3HKCB 5J59A 3T54A 1E32A 1SO8A 3FGZA 3WWYA 4TWRA 4ESEA 1NJ2A 3L46A 5F5XA 4DAOA 2AOWA 2PM8A 4KZKA 1DX6A 4J94A 3SF0A 4JSTA 3SKVA 1YSCA 4IBOA 2NZ2A 4XQCA 4MVJM 5JZMA 4ZIRB 1W46A 1NU6A 3P4UA 4MHTA 2Z09A 3V1UA 3Q7QA 3ZY6A 3AZOA 2VHCA 1QS0A 2AI3A 4U02A 4R54A 4MDFA 1ICEA 1TMOA 4OX9Y 1BOFA 1ULTA 2JCXA 5EWLB 1R0RE 4UNRA 1KERA 5IYZB 5L7TA 1G41A 3MXTA 3WDSA 1KQ3A 2RHHA 2PZAA 3MMSA 1NSFA 4DWVA 1CUEA 1E18A 1X0XA 5ICCA 1RXYA 1G6Q1 4RMGA 4NDAA 4EHJA 4YRZA 1DMRA 3UY4A 3RIHA 5I9NA 4N49A 4CGZA 2BR3A 1B0PA 4PZ9A 1NFRA 5ELXA 5C32A 4TLEA 1FDOA 1GY8A 3IUYA 4FD3A 4P22A 4QWWA 4ZDWA 2JFVA 2QI9F 4GBMA 1Z8NA 3U7QA 4YV0A 1A50B 1NVUQ 3KHTA 5HJ7A 1QHFA 1M2KA 3L01A 4YJ2F 5EGSA 2QRNA 3MRSA 3N8KA 1O94C 3R3ZA 3WHKA 1OIXA 4NCNA 1M2OB 1W8DA 4R01A 4XRGA 1XTUA 2XH8A 4FDAA 3RF6A 2YHSA 1SA0A 4DLUA 1KAMA 1ZOPA 2PUTA 2V98A 4TQAA 3ZQKA 1G2QA 3ZQ6A 4Q1BA 5TEWA 3OTQA 4ASUD 2HB6A 2ZI7A 3A31A 4KV7A 5FDFA 2NMVA 4AAYA 5EP2A 3M3DA 4XVHA 1AKYA 2UVDA 4GXTA 4PFJA 5CT8A 4DLPA 4P4NA 4L75A 3VAZA 1EUCB 2CFRA 3I01A 1SCUA 2AKYA 4KACA 1K6EA 3SSOA 3ZE2B 3S2SA 1UBTS 4GICA 1EFHA 1GCAA 4DARA 3UPTA 1ORRA 3DL2A 4RESA 1T8TA 5KPDA 3UH0A 1CR1A 2I6XA 5KYWB 2Q9UA 1CZRA 1Z33A 2QG4A 3HV0A 4KN8A 4FDLA 3EE6A 2BEWB 1JHXA 3CH7A 2P8JA 3PXGA 1ECJA 4YP7A 1HTBA 3B1XA 1EEHA 2A1IA 1R6DA 3AETA 3FWKA 3LX8A 3RTDA 1O94A 2QPOA 2HHJA 1J20A 4O8ZA 4RGBA 3MSXA 4JC5A 3BHMA 1YE5A 4Y30A 2CFIA 1NJ6A 5JPDA 1HC7A 4UHKA 2G5PA 4GOLD 1T24A 1QHYA 4WFQA 1E69A 1UL1X 3IP5A 2E6KA 1OIVA 2JJ2A 4KWHA 5AVSA 5KYUB 2DY1A 3TR6A 4FFNA 1EXMA 1OUMA 2FDXA 4EL0A 4N7RA 4W5RA 3DW1X 1I1HA 3GVCA 2QGNA 2BLNA 3OH8A 1NX9A 2OUKA 1ADYA 3NWBA 4IIJF 3EX7C 5CNKA 4YACA 2JATA 5KPJA 2TMGA 2WD8A 1W0CA 4R69A 1P1RA 1BX1A 2CWWA 2GRUA 3DZJA 4IKPA 1KEPA 2BFMA 2WWRA 4MQLA 3WNDA 2PK3A 4NX2A 5TPWA 2XQFA 2NGRA 1RYBA 3WL4A 3THWA 3R44A 3HO1A 3NT4A 2NTJA 4PAMA 3LOPA 3D8BA 3MMZA 4Q1CA 1RKUA 1QE0A 1ZVMA 4WINA 1YBVA 3E9DA 3UV6A 5FYQA 1SXJA 4RH3A 3LQ4A 2NZ8A 4G5OA 5AKZA 3QG1A 4G4GA 3QVKA 4ME6A 4IIBA 4RK1A 4G0UA 1N1GA 2LIVA 4QUAA 3TIIA 1TPZA 5J5CA 4ZAVA 1Z73A 3ICEA 3QU2A 4PX5A 1JVBA 1KMIY 1X1RA 1ZK4A 3SJAA 4QKQA 3VPAA 2QQFA 5SY4A 5A5DA 2KSQA 4YP1A 1QO0D 2TECE 2JJ2D 3BULA 3H75A 3KT0A 3L6CA 3M4NA 1A8QA 1YJQA 2X1LA 4C6TA 4OG2A 2Q5OA 1ECFA 2F1JA 2WBLC 4D44A 4LC0A 4O1MA 4CQMA 3REFA 2R7NA 1NPTO 3P0EA 1P0PA 3B1VA 2W2PA 1P4GA 3COVA 4OQMA 4Y6RA 3JWHA 4ZK2A 3ZLBA 3LRXA 3C4VA 3S4YA 3O95A 4KP7A 1T36B 4IIEA 7GPBA 5C37A 1UJ4A 2GEFA 3BJEA 4UBIA 2REBA 2M6SA 3G5LA 1U0BB 1MAUA 2YS7A 3D6VA 4CR8A 1PW7A 4JNCA 3BB4A 4CLRB 3VYRB 1NN3A 1SPXA 4HT3B 1DC7A 2EDCA 4CM8B 3QUCA 4JZYA 5CVJA 1QH1A 2PCLA 4KO3S 3AXSA 2YTZA 5U4QA 4KOEC 1C7ZA 1QUEA 1RAFA 2VDWB 2BCEA 2PPLA 3IAS6 4L51A 4RAOA 1JFFB 2APJA 3STXA 4ZCLA 3Q4GA 2PCJA 4WA8A 1U0GA 4D9NA 4RVHA 3IS3A 2WU0A 2XOKD 5TJ9A 4F21A 5I7RA 3LKBA 1VRVA 2GAOA 3RGGA 1MB4A 5BSVA 1QYIA 2DBYA 2ZI3A 2H92A 4FKBA 4TXLA 1U2TA 2EFDB 1P2UA 2C8LA 4V38A 3IBYA 4WDQA 1OD6A 1E3JA 2ZE7A 2J7PD 2Q0QA 1MNQA 1TAHA 5A9SA 4OXXA 2XCLA 1BMTA 4UZFA 1F4VA 1U2EA 1S4QA 4X20B 1PW5A 2LD4A 3OWOA 5LKRA 3DD1A 2VXCA 2EJCA 3VZRA 4RQTA 3AKDA 4UNQA 4XX0B 3PU6A 3A37A 1QH1B 2D3WA 2I1WA 3MOIA 2H3EA 2V0NA 1JR6A 2BR5A 5KSPA 3W04A 4HPXB 3C0KA 4IR7A 4R7ZA 4L5IA 2P9ZA 4AZSA 1NI3A 4MPRA 4TL7A 3PWKA 5BYAA 1GRVA 2MMGA 5D86A 4G0XA 3ZN2A 3QUQA 1YB5A 3OIUA 4XARA 3VKFA 1LNQA 3DFKA 1ECBA 2AG6A 4H77A 3W77A 2YWDA 4I19A 3Q3IA 2NYVA 5MHTA 2BE9A 1ZCFA 5EXTA 1Y7HA 1N25A 1M10A 3L93A 4HLNA 5HS6A 3P9NA 3H5RA 4V0RA 3T0IA 5B2ZA 3HA3A 2VDPB 4K88A 5HCUA 1I5EA 1BW9A 3VAAA 1DCKA 5LZ2A 5KJEA 3UJ6A 3F73A 3ZQ4A 1JIQA 1QVWA 2WIAA 2YBDA 3V2IA 1P9RA 2AMYA 5JWHA 1D3AA 4PFKA 3FF4A 3TOXA 3U3DA 5BWOA 1T5IA 1W1UA 1TFUA 2GBLA 4RANA 4LRQA 2I99A 4FYHA 5HF8A 1IE3A 2AJCA 1NBHA 3RVQA 3U4QA 1OCEA 3AF4A 2X0DA 4N18A 3E6AA 3ZWPA 2VK4A 1X77A 4YCSA 3ED5A 1Z56C 4RCYA 3DBOB 1OXVA 3PC7A 2ZJ4A 5K09A 3SR0A 1CNMA 1SA0B 1MG5A 4MQ6A 5LD2B 1WDTA 1PWEA 3H1EA 3PJEA 3KEGA 1CEYA 1SC6A 4N0EA 1DWQA 5FTJA 4W5HA 2MTBA 3NH9A 3IR5A 5BR4A 5BW8A 2E4ZA 4LFBB 1SM4A 4DNXA 4XFDA 4DLYA 5AVYA 3ZWQA 2GB4A 1EE2A 1I2BA 1E1MA 2C20A 3FZNA 3WVNA 4W5QA 4KK3A 3C5VA 1K6MA 4EBFA 1QGDA 1DO8A 1PQUA 5FCDA 5FNZA 5DNCA 3K1AB 3U17A 2RONA 4D5EA 3CRRA 3X1MA 3ZBQA 1LZLA 1S8NA 1IHPA 2ROQA 2NPOA 3D1VA 1ZUNB 3D8HA 4S35A 4KIFA 5ARCA 3OT1B 1EVKA 3A0UA 3JRXA 4MS4B 4GKKB 1PHPA 1T1GA 1ELOA 1T0BA 2ZEJA 3T7DA 5FXMA 3R9IA 1FVHA 3GLGA 2C4VA 4JXZA 4BNFA 1Y7PA 3CURA 5F52A 4BPRA 4BLQA 3NHBA 3QF7A 1BE0A 4REQB 1REQB 4LNHA 3AFMA 2I7TA 2VP4A 2BE7A 1P4AA 4GEKA 2VBCA 1JYEA 1ZA1A 1HRKA 1QKJA 3CB4A 5H02A 1HYGA 2W6CX 3KB1A 2ZQYA 2IEZA 1DAGA 4IILA 3C43A 2OCIA 1FS4A 4KGVA 2BMEA 1ZK1A 3AHCA 1WCIB 1M6HA 3DHYA 1RAAA 1G20E 1QHEA 3S29A 1NZDA 4QXMA 4MYDA 1VG9B 5LL6P 3KYCA 2ZRNA 4TYMA 3O4VA 4DDHA 1VSQA 4RVGA 3ZXIA 5A0TA 2HSDA 4A0GA 5KOIA 5ALSA 1FQKA 4TTAA 3W8RA 7REQB 1MB9A 1QE5A 3K6JA 4IO0A 1QRRA 3I39X 5JDIC 1DUSA 1TOAA 2GN9A 4G0ZA 5C5DA 4PZCA 2CNOA 4IGKA 3ZIDA 3HRIA 1I2DA 5C8YB 1TT7A 1XHLA 1RAHA 1Z75A 4Z3OA 4BYGA 5A3JA 5CM8B 2CLKB 1Z2CA 3BTUA 3QENA 1J8DA 3STUA 3WNBA 1VHQA 4LEIA 4M1TA 1V1JA 4FBGA 3GFVA 2YFKA 1V26A 4NZNA 1L5GB 2OD7A 4XQGA 2E82A 3K0AB 2AXNA 4U7WA 5ESRA 4AXXA 3ZWMA 3OC6A 3RGWS 2GM9A 1N1MA 2R00C 3KUDA 3W8FA 1U2SA 3O2JA 4OMUA 5HQ3A 3ZLJA 16PKA 2OAEA 2WB4A 5DULA 1XPJA 2E48A 2EATA 5FV7A 2VP9A 4YAEA 1VMAA 4W5TA 2VZ0A 5E3HA 3ETCA 2Q5IA 1T15A 4UEJA 5AM4A 2XVYA 3ISTA 5EUBA 3TL3A 4D0GA 2R4UA 2QRMA 3VDNB 1WWKA 3K0AA 5KTKA 3O8LA 2QUIA 3KV3O 4TVOA 5K3CA 4JLKA 4U7DA 1QHNA 2I4TA 4RY2A 1EI9A 2X0RA 4BNGA 4H27A 4AJ9A 4I50B 4MJXA 4C7KA 2CMKA 3ANXA 5M2QA 2QJWA 3GJXC 4MW2A 1PQPA 2G1KA 1TW2A 3OEHD 4LMBA 1ID8A 1L7PA 1MJ5A 2AW5A 1JFRA 1H1LB 2CC2A 2V65A 4Y0AA 1A27A 3JR7A 2QRGA 4R1MA 1JHOA 1ZO8A 2HWUA 1Z63A 1T1EA 1A9XB 4M9XA 5FUVA 4EFNA 4GC9A 4EW2A 1R5OA 4MKFA 2QYSA 5JDCA 2XSZD 2RHJA 1JEEA 2W2LA 3NHSA 2AN9A 4UNPA 4E2YA 1VBKA 3NC4A 1FIUA 2YIMA 3DFMA 5TMBA 1S2LA 3KTDA 1I1OA 3F7OA 3SWWA 3TUIC 5IAJA 4OREX 3EGIA 1V2HE 2P6OA 3ESXA 1XWFA 1GOTA 4P54A 1K7SN 4HH3C 4IJUA 5ITZA 3ORSA 4RLQA 3MVEA 3IURA 4D25A 4JVNA 3S7TA 1HFJA 1N7HA 1Q19A 1V45E 2OENG 2QR2A 1ZBDA 4K8OA 2PA3A 4GOJA 3AV0B 1X7ZA 3E61A 1YCHA 2GBGA 1F4LA 3KUCA 5LNK1 2C88A 5GZ6A 1W5TA 4QGAA 4BE9A 3WQQA 5CLJA 3PKZA 2B4RO 2D1QA 5TQ0B 2QMEA 3JVVA 3QEKA 1T2VA 4JLOA 3QWIA 1EA5A 1VC2A 1I5RA 1RI2A 2DR0A 2WWIA 3TTUA 1GR0A 1M72A 5L3QB 4RGYA 2UXDB 2G72A 1XU7A 1Y8QA 2DE0X 1BMQA 2ANBA 2PSFA 2DBRA 2GN2A 4N8EA 2JFNA 3UWMA 1DKPA 2GBCA 5FA6A 5AW5A 4MWOA 1NPYA 2H1VA 1QXSA 1T3GA 4LKOA 4L22A 1E1RA 5ALJA 3G68A 1HQDA 4JDUA 3WIOA 5EJEA 1QMGA 3HADA 3TINA 5H7XA 1QG4A 3JYHA 4RJ2A 3OKPA 3ZWKA 5F77A 1LDBA 4HQNA 4EEXA 3SIRA 3PX2A 2GPAA 1XRQA 1T1SA 4UFNA 3BK7A 3WSTA 4TRRA 1FB5A 2XYVA 3QFHA 2QMQA 1DCTA 2X7XA 3TXAA 2V7VA 1PJ2A 2NVBA 4MW7A 3ROGA 4TXMA 1M0EA 1XCMA 4C4TA 1RQNA 1P0CA 4C06A 2EXXA 5BN3A 4KR6A 1OYYA 1I6WA 2RG1A 1Z38A 4MQEB 1DAEA 1SCDA 2VYND 4P0TA 4WESB 2PUBA 3E2PA 4RK6A 4K1LA 1DHTA 3W9YA 3FNIA 3R7FA 4RL6A 1JDJA 2CW5A 1PVVA 3RSZA 3W3AH 2YHAA 3PNPA 4OM8A 5BT8A 4WASA 5C7OO 4HGZA 4MKHA 3VR4D 1SCKA 5EWMA 3GD7A 2Q6KA 1JI0A 1MTOA 4WK6A 3RH0A 1QG0A 1Z2PX 3HCCA 4MV4A 2C2WA 2PQ6A 1T4DA 4ZV4A 5U4XA 1C3OB 4FSXA 3TLGA 3T1YB 3ABSB 4G5SA 1CDOA 3PQ8A 3TD9A 2CE2X 1GLNA 4YXFA 5LIPA 3PBKA 1E1QA 4RSHA 4BBJA 2NU9A 2GO1A 4B3CA 4G25A 4TTSA 2HCFA 2IIBA 3PHCA 4DOMA 2BI7A 3BBPA 2AFIA 3WKCA 4CLXA 2XUJA 1WXXA 1LVHA 2ZSBA 4NV0A 2FRDC 3ET5A 2I7DA 1VFPA 4N4AA 3KYIB 4AW9A 1NFQA 3LM8A 4IV5A 5K0NA 1PVDA 3KYJB 4B1FA 1YBFA 1NYRA 1UBFA 1RRFA 3R41A 4MP6A 1MO5A 1SXJC 4PZEA 4YMWA 2ZT6A 4H0FA 4DR2B 3PXUA 1E61A 2V6MA 4BASA 3GA5A 3ZVKA 2XB8A 4HTAA 3PJDA 1Q3HA 3TX6A 4GI2A 4C4YA 3LLUA 4DDTA 4V1CI 1H9BA 2VEOA 5F73A 1M1ZA 4WSOA 2JVJA 4MLDA 5IBPA 3RWBA 1ZD8A 4I2VA 3I5UA 2C5LA 3BA1A 3E9ZA 3KEOA 1B3BA 4GLFA 1XLTA 2X1MA 4YQYA 1YL6A 4HDKA 3CUKA 1ISGA 2BJWA 1J49A 3GT3A 1KRHA 3RRJA 2WFLA 2GK4A 1ABBA 5J2TA 1CC1S 2X40A 3MT9A 4YCLA 2P5UA 2Z9CA 1JDZA 4QUBA 4FEAA 1YK1A 2XE4A 3SYKA 3JS5A 3FWNA 4U9UA 1YL5A 4XDHA 2ONYA 4NBSA 3NIDB 4B6FA 3U16A 2CWDA 4KFSA 2PRZA 2PUAA 4PYQA 3SC4A 3U3RA 1PR4A 1YQGA 3CZ9A 1M8KA 1I7LA 4BN5A 3MJVA 3WB0A 1RLTA 3GLHB 4UBKA 2R5WA 3I83A 3KTOA 4G9GA 1P5FA 3UBMA 4AD8A 2V3WA 3KD2A 5KNCD 3IXMA 4YAGA 5K0JA 2UXCB 2G77B 1SXJE 5BWLA 2OGZA 1P61B 5D01A 5EJGA 2VYVD 1X1QA