The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
46
|
sequence length |
144
|
structure length |
140
|
Chain Sequence |
PKWSARAIKSLAMGELEARKLKYPSTGTEAILMGILVEGTSTVAKFLRGNGVTLFKVRDETLSLLMYFFSPEHPPLTEPAQKAIAWAIDEKNKSDVDGELTTAYLLLGVWSQKDSAGRQILEKLGFNEDKAKEVEKSMNE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Protein binding
|
molecule keywords |
Double Clp-N motif protein
|
publication title |
Structures, Functions, and Interactions of ClpT1 and ClpT2 in the Clp Protease System of Arabidopsis Chloroplasts.
pubmed doi rcsb |
source organism |
Arabidopsis thaliana
|
total genus |
46
|
structure length |
140
|
sequence length |
144
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2015-02-05 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02861 | Clp_N | Clp amino terminal domain, pathogenicity island component |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Double Clp-N motif | Clp, N-terminal domain |
#chains in the Genus database with same CATH superfamily 5HBN A; 1MBU A; 2K77 A; 3WDC A; 3ZRJ A; 1MBX A; 2Y1R A; 4UQW A; 4IRF A; 1R6Q A; 1KHY A; 3FES A; 3FH2 A; 4IOD A; 1R6C X; 3PXG A; 5GUI A; 1KSF X; 1QVR A; 1MBV A; 1K6K A; 4Y0B A; 3WDE A; 2Y1Q A; 1R6B X; 3WDD A; 3WDB A; 1LZW B; 4P15 A; 1R6O A; 4HH5 A; 4HH6 A; 1MG9 B; 3ZRI A; 4Y0C A; #chains in the Genus database with same CATH topology 5HBN A; 1MBU A; 2K77 A; 3WDC A; 3ZRJ A; 1MBX A; 2Y1R A; 4UQW A; 4IRF A; 1R6Q A; 1KHY A; 3FES A; 3FH2 A; 4IOD A; 1R6C X; 3PXG A; 5GUI A; 1KSF X; 1QVR A; 1MBV A; 1K6K A; 4Y0B A; 3WDE A; 2Y1Q A; 1R6B X; 3WDD A; 3WDB A; 1LZW B; 4P15 A; 1R6O A; 4HH5 A; 4HH6 A; 1MG9 B; 3ZRI A; 4Y0C A; #chains in the Genus database with same CATH homology 5HBN A; 1MBU A; 2K77 A; 3WDC A; 3ZRJ A; 1MBX A; 2Y1R A; 4UQW A; 4IRF A; 1R6Q A; 1KHY A; 3FES A; 3FH2 A; 4IOD A; 1R6C X; 3PXG A; 5GUI A; 1KSF X; 1QVR A; 1MBV A; 1K6K A; 4Y0B A; 3WDE A; 2Y1Q A; 1R6B X; 3WDD A; 3WDB A; 1LZW B; 4P15 A; 1R6O A; 4HH5 A; 4HH6 A; 1MG9 B; 3ZRI A; 4Y0C A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...