4YX9A

Crystal structure of the cftr inhibitory factor cif bound to tiratricol
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
293
structure length
293
Chain Sequence
AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMEAPIPDARIYRFPAFTAQGESLVWHFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CFTR inhibitory factor
publication title Inhibiting an Epoxide Hydrolase Virulence Factor from Pseudomonas aeruginosa Protects CFTR.
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain ucbpp-pa14)
molecule tags Hydrolase/hydrolase inhibitor
total genus 107
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yx9A01
5JZ9A 3W05A 1CUVA 4EB0A 3WI7A 1GGVA 1JJBA 2DHEA 4HRYA 3DDUA 4NVRA 5DYTA 3VVLA 5AM0A 1ZD5A 1A8SA 5FOQA 1EHYA 5AIBA 3PF8A 3BF7A 1N8SA 1CQZA 5EHZA 1SFRA 4UUQA 2B9VA 2OGSA 5BWCA 5ALFA 1XRMA 1CUDA 3VVMA 4Y2XA 4U2EA 3I2JA 4KAAA 4GXNA 5AKXA 5HF5A 5ALMA 4BRSA 3H2JA 2JGIA 4B9EA 1ZGBA 1IUPA 3D5EA 2YH2A 1U8EA 5LKRA 2JGFA 1WHSA 5ALVA 4QDZA 4WDRA 4UBLA 3BJMA 4GBGA 3DD5A 2K2QB 1VXRA 1C7JA 3ZPXA 4ZI5A 3R41A 2OAGA 1H2XA 1MX9A 4ARBA 1XZJA 2XE4A 3WWOA 1YAHA 4MYSA 4EY6A 4OB8A 1WPXA 3D0KA 4Q1VA 1HLGA 1DQYA 2HDWA 5F4ZA 1JJFA 1MN6A 5I7UA 1TIBA 5AICA 4AN0A 4CI9A 4F0JA 1TCAA 1MNAA 4Q05A 4QWWA 5DLPA 4U2FA 2AJCA 4DLNA 3GUUA 2EDCA 3AFIA 3FLBA 3CCBA 3PUHA 4HXEB 3HSSA 4PNZA 4OD0A 3FNBA 1YAJA 3O4JA 4TGLA 5JATA 4U2BA 1LPSA 3VJKA 3PFCA 3V1LA 1DWPA 3H04A 2WLSA 4GI1A 4ZREA 3O0DA 1Q0ZA 1FJ2A 1Z68A 1YSCA 3H1AA 4QEKA 3V9AA 4F5ZA 2XUJA 4UFNA 2GBIA 1XZDA 2WHPA 1VE6A 3WK6A 1CFJA 2QRUA 1YR2A 1N5RA 1SOMA 4PO3X 4KE7A 4AX4A 5LZ8A 3OTQA 2WU3A 4QA9A 1RWQA 2WTNA 1RYYA 5DJ5A 2OG1A 3STXA 2Y2UA 2JGLA 4H7IA 2XUGA 5JAOA 1MPXA 2C4HA 5K3FB 2HFJA 2O2GA 4BAGA 1FFDA 2XQKA 1TKRA 2WU4A 3F67A 2OLEA 2PUJA 1K8QA 4KJXA 3IBTA 2Y1KA 3EQ7A 2WUGA 4QNNA 4UBIA 2PSEA 3K6KA 2HL6A 4MWSA 3G9UA 1EXWA 4N8SA 1WHTA 5EIAA 3G0CA 1B41A 2HA5A 1CUBA 1T2NA 3D2AA 4NZZA 3KWFA 1ZIXA 1ETHA 4N8EA 2WJ6A 2FX5A 4G1FA 3WZMA 5DYWA 2C5FA 5JZSA 3R3WA 1XZIA 3H17A 4DMCA 1QIMA 2H9YA 3DOIA 4IH9A 5JYCA 5KWJA 5FLKA 5EGNA 1TK3A 3KXPA 4Y2PA 4WY8A 4H7HA 5AI0A 4MWTA 1XZFA 1JMYA 2WG1A 4LXGA 1UKCA 3WWCA 4H35A 2OCLA 1Y7HA 2G4LA 5LZ4A 3EIOA 2ZSHA 4Y2VA 1RP1A 3HYSA 4EY8A 2PM8A 3FOBA 4J3JA 4MXDA 2HU8A 1E5TA 1LPBB 1R50A 3RM3A 4J0DA 4Y2RA 2CJPA 5KWIA 2WUFA 5ALQA 5CMLA 2VJCA 4B81A 1JFRA 3HJUA 4O08A 4RPCA 5C8VA 4QDOA 2ONCA 5AK4A 3CXUA 1ZIYA 1XZHA 1JJIA 2WQZA 2FJ0A 2O2HA 1O6FA 1BU8A 5CTAA 1IZ8A 4ZRDA 1IUOA 2OGTA 1JU4A 4KRYA 1BCRA 4G4GA 1DT5A 1QFSA 1E66A 2AJBA 3LIIA 3WKBA 2AJLI 4LYEA 1VLQA 2XT0A 1Q84A 2QJRA 1QIIA 2XMQA 1VE7A 2XMDA 3WKAA 1CUCA 3WKCA 3BXPA 4IQ4A 1B6GA 5HK9A 4FNMA 4C87A 1MTZA 5LKAA 3G0IA 1DX4A 5CT5A 3F97A 1XRQA 4XIIA 3HABA 3W04A 4BCDA 1EK2A 2FUKA 5JD4A 2XUOA 3D2CA 1VXOA 3IURA 5H3HA 1LBTA 5CH3A 5CURA 2R8BA 4EY4A 2DQYA 3IUQA 3O4HA 4IH1A 2GYVA 3ZLUA 4J0KA 2X5XA 1ACLA 3C5WP 5YASA 3OOSA 3EQ9A 2XMZA 5ALHA 2PSJA 4QDTA 4N5IX 2RHTA 3W2TA 4Z49A 3RARA 1YA8A 2IX9A 5I8PA 3QH4A 4UHCA 1XRLA 4EBBA 1WB5A 1R88A 3C8DA 4DNFA 4BVJA 5JAUA 1EDBA 5ALLA 2VT6A 5CT8A 4DGQA 3FAKA 3FYUA 5AHXA 5HK8A 3FSGD 2O7RA 4CCYA 3UUEA 2XLCA 3DQZA 3A2MA 5AIAA 1DT3A 1XZMA 1QIEA 1CRLA 4GHWA 1XKTA 5JASA 3STYA 1THTA 3ICVA 5AOBA 3L1JA 4PW0A 1USWA 1OILA 5JARA 1HKHA 3WKEA 3AUKA 2XUHA 1ZI9A 1UOOA 2VQ6A 3WK9A 4DNPA 2WILA 5AKIA 1WM1A 4AQDA 2H7CA 3M3DA 1CR6A 1EDEA 2ZJ6A 4FLMA 1CUGA 2I3DA 5LZ9A 4NMWA 1U65A 4FWBA 3MUNA 4C4XA 5I9IA 2E3JA 1QIGA 3R3XA 1EX9A 3HXKA 5CT6A 2C7BA 4S0XA 4X6UA 3PUIA 5LLSA 1ZI8A 4G8BA 1BS9A 3AZPA 4Q3KA 6YASA 1ISPA 2JF0A 2UZ0A 1P0PA 5ALYA 1CUAA 1AKNA 3I2GA 4BC1A 3G9TA 4BAZA 4ZWNA 4K2AA 5CXUA 5EFZA 5EHXA 3ILSA 5K3BA 1ZJ4A 1XZLA 2ES4A 4AN1A 3IDAA 3VKFA 3IUMA 2ZYSA 1EB8A 4J0HA 2J3DA 4L9AA 5JANA 1CV2A 4KEAA 4UHDA 3TRDA 4DM7A 2WIFA 2XUDA 3WK4A 2PKYX 3MGAA 2HRQA 4H18A 1GT6A 2H7YA 4H7FA 1TCBA 5ALJA 1NU8A 3OPMA 3QMMA 1AQLA 5C8XA 1EINA 1CIJA 2XUAA 3R0VA 1CUHA 5EHQA 1CUUA 1Q0RA 4LYDA 3BDIA 3H2KA 4WFIA 5A62A 1QO9A 1P0IA 1LGYA 3FYTA 1JKMA 4NS4A 2JEZA 5KBYA 4I19A 4K5QA 4D9JA 1EH5A 2C0PA 5AKHA 1W76A 2RAUA 3FBWA 4TVKA 4X00A 4OYLA 1ODSA 5FXMA 4X95A 4ZV7A 5E2IA 5AK6A 4F21A 5AI6A 3O4IA 4ZGBA 5ALRA 3C6ZA 1QTIA 2RONA 2DHDA 3G9XA 3WWPA 1CUWA 4MJ3A 2ACKA 3QPAA 2XI4A 2Z3ZA 1EK1A 1QGED 5A2GA 2BGNA 4FMPA 4ZV9A 4FDMA 3ED1A 1QIFA 2I78A 3QZUA 2QKYA 1THGA 4UBOA 3G7NA 4P9NA 4BP8A 4YK7A 4ARAA 3BIWA 2PSHA 3WQHA 3H2GA 5LP1A 2BJHA 3SC2A 4B7ZA 4HXGA 5AK5A 1A8UA 2HRRA 4P92A 1VZ2A 1TAHA 2QXUA 2VF2A 1XZBA 4LXIA 5AO9A 4LHEA 1CUXA 3R3YA 4AO7A 5ALIA 2YASA 1D07A 3BL8A 1YB6A 4KACA 1AURA 3G0BA 1FFBA 3C6XA 1GZ7A 2PU7A 1XROA 2C0QA 5HF9A 1J06A 5JAPA 2XMBA 1G66A 4BB0A 2JGMA 4FKBA 5A6VA 2XUKA 2WKWA 2YXPX 3HZOA 3SWWA 4OPMA 5CW2A 5T4HA 2DFPA 4B85A 5JAHA 4OB6A 2DQZA 4DIUA 1ODTC 5ALNA 1W4LA 1AMNA 5DNVA 2PU5A 2JIDA 4EUSA 1PFQA 2OCIA 4BTLA 3PFBA 4BTVA 4Y2UA 4M0EA 4C6HA 4X97A 3B5EA 4RE5A 2G63A 5FPQA 4WFKA 1LPAB 3H1BA 4QE3A 2EDAA 4H7JA 1QIKA 4W1SA 2DHCA 4ROTA 4C88A 2WFMA 5IKXA 4EHBA 4YPVA 4B80A 1CEXA 5SYNA 1BEZA 5LZ5A 3C45A 5JADA 1G4HA 1YS1X 1BE0A 2OXEA 3GFFA 4BBZA 1YS2X 3F8SA 1CUIA 5AI8A 1QZ3A 2XQJA 4J0JA 4UBJA 2PSFA 2WFZA 4JH0A 4A5SA 4XVCA 2G5PA 4FFVA 3FCXA 1DTEA 5BWBA 2BKLA 3EF3A 5JD5A 3IUNA 4BC0A 3AINA 3H2HA 3FLAA 5ALZA 2IITA 4J03A 1Q83A 4QDXA 4DYHA 4ITVA 2WIJA 2CUTA 2O2IA 5AJHA 5FPPA 3RKSA 1K4YA 4FNGA 1H23A 1XLVA 5ISMA 4G8CA 4N8DA 3AZQA 5CRIA 1L7QA 3I28A 4B82A 1XZGA 3WL6A 5HKBA 3WYDA 3DL7A 4B6GA 2X76A 4KE8A 3LLCA 3H19A 3KD2A 4KR0A 5HQ3A 1JI3A 3R3ZA 5A71A 1NU6A 4G5XA 1I6WA 3O9MA 1H2WA 1VKHA 1WPRA 5ALKA 3KOOA 1CUEA 4Y2JA 3OG9A 4XWGA 1ORVA 1LPOA 3QBJA 3GZJA 3NUZA 2HIHA 2LIPA 3ESAA 2GYUA 3A70A 4UBKA 3AILA 5ALXA 3CCCA 3S2ZA 1ZI6A 4DSZA 4Q3OA 2XQIA 3C5VA 3DS8A 4Y7DA 4QDUA 3M83A 4K6KA 1G42A 3DOHA 4UBNA 1ZGCA 2JGKA 3OC0A 3QMWA 3PICA 1YA4A 1DU4A 4J0IA 3BDVA 3JW8A 2CEKA 3C43A 4AO8A 4G8DA 1PV1A 1YB7A 3IIIA 5K5EA 3H2IA 4DNQA 1ACJA 1XQYA 2Y6VA 3FVTA 5HZGA 2AJDA 3TJMA 1A88A 4MYDA 3WWEA 3QPDA 1MJ5A 3JWEA 3WLAA 1LPNA 1N5MA 2XUIA 3PF9A 1EA5A 4OYYA 5AK3A 4X71A 5AM4A 3ZLTA 5FRDA 2Z8XA 5ALOA 4HAIA 2ACEA 2ZJ7A 3AIKA 1UT6A 1ORWA 2PUHA 3D4LA 1IUNA 2DCMA 4M0FA 3WMRA 1E8MA 3WK8A 4JEIA 3DYIA 1X2BA 3K9BA 1U2EA 1IMJA 2XDWA 1KU6A 1XQWA 2XUQA 1NX9A 2BGRA 4GWLA 3WIBA 2JGEA 5CT9A 4Q3LA 3HI4A 7YASA 1GPKA 1MO2A 4MQMA 5CH5A 1WB4A 2BUBA 1H2YA 2ZVDA 4BE9A 2VJDA 1EB9A 1MU0A 1XFDA 2BUAA 2RHWA 3WL7A 5AM5A 1E8NA 1XQVA 3ZLVA 1QIDA 4PSDA 3C6BA 1MT3A 3O95A 3DJYA 4UFPA 1XLUA 4G4JA 1UKBA 3QITA 4BDTA 4OU5A 5AKJA 1VJ5A 2PBLA 1UK6A 2Z3WA 4QLOA 3FYUC 4M0MA 2R11A 1JT2A 1LZKA 1TQHA 1DQZA 3WK7A 5CT4A 1C7IA 3LS2A 4RNCA 2OQVA 3O9VA 2GBFA 3FVRA 1K63A 5DTIA 2PPLA 1QTRA 2NW6A 3FWHA 1BEEA 1TCCA 1YCDA 1E89A 2J3QA 5DTJA 5AM3A 2G5TA 2RIPA 4W1RA 3BE8A 3PE6A 1WB6A 2Z5GA 3AIOA 3S8YA 1ZD3A 3ANSA 4BDSA 4UHBA 3BWXA 2VSQA 4Y2QA 4G4IA 4WCVA 5HFNA 2WUDA 4B83A 3QYJA 1AX9A 5A7HA 2V9ZA 3LP5A 3BJRA 1LPMA 4HZGA 5HFAA 1F8UA 1GXSA 4E46A 4L0CA 3SX4A 4IH4A 5K3CA 3W9UA 3WL5A 3D7RA 2BFNA 2VAXA 1FFCA 3PDCA 5ALWA 4KAFA 3DKRA 4LKOA 1KEZA 1GQSA 1P0MA 3W9BA 1HL7A 2HU7A 3RK4A 3D59A 4EZIA 4Y2SA 5AI4A 1J07A 3DNMA 3E4DA 2QMQA 4FLEA 1K6EA 4FTWA 4W1QA 3I6YA 4HRXA 1CQWA 2CBGA 3EBLA 1UXOA 4JUIA 5ALUA 1QIHA 2QTBA 3IA2A 4C4ZA 1BN7A 4G9EA 1H22A 4X3CA 4Y9SA 3AIMA 4HVTA 1WOMA 1KU0A 4A16A 5ALEA 5EIHA 4CIBA 5D7BA 2ZYHA 4P08A 5AKEA 1L7AA 4J0CA 3WJ1A 2WJ3A 3G0DA 3O4GA 3BF8A 5DNWA 5AH0A 1UWCA 4GLBA 3X3HA 4L72A 1EVQA 4Y2YA 1M33A 1C4XA 1LPPA 4JYPA 4ZXFA 3R40A 3DKKA 1LNSA 3FSGA 5LZ2A 4QWMA 4CIAA 2GBGA 2ECFA 2HA7A 2CMFA 2XMSA 2GZSA 4HXFB 5C81A 4AMYA 4CG2A 2VA9A 5AKGA 1MAAA 4TPKA 3E3AA 3VDXA 1FSSA 3F9CA 2QUBA 2ZYIA 4CCWA 2RI6A 2ZSIA 5E4JA 3CN9A 5FKJA 3G02A 5AM1A 2XLBA 4U2GA 4JNCA 1BCSA 3ZI7A 4AZ3A 2VEOA 3VJLA 1XZEA 2OPHA 2WIDA 4GDMA 3AJAA 1PJAA 1O6GA 1OCEA 3STTA 3I1YA 4BVKA 4XX1A 1Y7IA 4X94A 4Q82A 5FP0A 1GPLA 3I2KA 5JZBA 3E0XA 1AC5A 1VA5A 5BV7A 4RGYA 2VJBA 2ORYA 4KRXA 1LZLA 3F96A 2WUEA 4IO0A 5JD6A 4H77A 1J2EA 1W75A 3MVEA 2B4KA 4F60A 2ZYRA 4DNOA 5LYYA 2Y6UA 3D3NA 3STUA 1VOTA 3WA6A 3C70A 3DEAA 3T52A 4OCZA 3DYVA 4PSUA 3L1IA 1R9NA 4INZA 4UHEA 3NGMA 4E14A 4W9RA 4UHHA 5IVKA 4FOLA 1EDDA 2HA4A 4BYMA 3IUJA 3N2ZB 3K2IA 5A7GA 5AKKA 2OGZA 2EEPA 1LLFA 3YASA 4B0OA 5AI5A 1TRHA 3G0GA 4UBMA 5AM2A 2VT7A 3B12A 4OUKX 4BZZA 3WWDA 2VATA 3WYNA 3DCNA 5DNUA 5HF8A 1HQDA 3I6MA 4X93A 1HPLA 5T4FA 1Y37A 2WG0A 2HU5A 1ZD2P 4K6GA 2Z8ZA 1AUOA 4P93A 5AP9A 1K5PA 3NOXA 1E8DA 4X85A 3ZWQA 5D3ZA 4MEAA 3GBSA 5EHNA 2BUCA 4FBMA 4GECA 2WTMA 3QVMA 1HBJA 4PQEA 5ALTA 1CUSA 1R9MA 5CH8A 1JMKC 5BOVA 3TGLA 2DSNA 4FFWA 3ZV7A 1UK8A 3I2HA 1SCQA 5AKYA 3M82A 2QM0A 3M81A 5D6OA 3OURA 4BRZA 2VTVA 1U4NA 3HACA 3Q0TA 4KYVA 4I4CA 4QZVA 3WJ2A 4B0PA 2PX6A 3VXKA 2XUFA 4JYMA 1A8QA 5CXXA 5SYMA 3I6ZA 4X92A 1XZKA 1QONA 2XB6A 1X2EA 2WJ4A 2AJ8A 3DL4A 4CFSA 2BCEA 1R4ZA 1UOPA 4OB7A 1XLWA 3ESDA 1ZICA 1UK7A 2HFKA 4RE6A 5K3FA 2V98A 2GZRA 1EVEA 2CZQA 2HA2A 3F98A 3WK5A 1W52X 3HC7A 1CVLA 3C6YA 4BAUA 2C5GA 1XRRA 1BROA 2WFLB 3U0VA 4XJVA 4A23A 3D2BA 5IH7A 3WIOA 3WZLA 3UUFA 3HEAA 1MX1A 3U1TA 2YYSA 5EI5A 3LCRA 5IVHA 4MQLA 1CLEA 5AKLA 3WL8A 4OU4A 1QE3A 1R1DA 4AB1A 4KAJA 2W22A 5K3AA 1X70A 2V97A 4LIPD 2WM2A 2WG2A 4EY7A 2VJAA 3WKDA 4E15A 4OSEA 2I03A 1ZD4A 3BIXA 4FBLA 3ANTA 4E11A 1GKLA 3I2FA 4V2IA 3HRHA 1G5FA 1E3QA 2OAEA 3B3QA 2ZJFA 2HHAA 3GA7A 4UPDA 1VZ3A 1N1MA 5D3KA 4X7BA 5EIEA 5T4EA 1ZJ5A 4W63A 3WA7A 1H2ZA 3A6ZA 2XMCA 4CG1A 5FDFA 3UMJA 4BCBA 4X6XA 1UZAA 3QPCA 2QR5A 2HA6A 4HS9A 3FCYA 1FFAA 1QLWA 1CUZA 2P8SA 1BRTA 4PF1A 5E4TA 4AXBA 3ESBA 1DINA 3AZOA 3W06A 3H0CA 2WSLA 5ALDA 4K6HA 5A7FA 1DWQA 1S8OA 4PV7A 4H7KA 1UK9A 5AOAA 2CB9A 1MX5A 3C8HA 4YASA 3RLIA 2AXEA 1XZAA 5LIPA 2RGUA 3SK0A 2QUAA 3LIPA 4DMFA 1UFOA 1XRNA 4WY5A 4FHZA 1CPYA 4G9GA 5T4BA 3V1KA 2X8BA 2WHPB 1XZCA 4Y2TA 1CUYA 1OXMA 3DLTA 1UOQA 1ZOIA 3QM1A 3FLEA 4Q34A 5IVIA 4B9AA 4N5HX 3T4UA 3KSRA 3ESCA 1AZWA 2PSDA 1W1IA 5JALA 1YASA 2CKMA 4DMKA 3N0TA 5FV4A 1R3DA 4BE4A 2B20A 4DSAA 4MEBA 2WHQA 4AMZA 2VAVA 3JYHA 2JGJA 3P2MA 4C01A 1UKAA 2PVSA 2O7VA 5C8ZA 4QLAA 3IB3A 5HCUA 2Y2VA 2WFLA 2OCGA 4FLFA 2QT9A 1SC9A 1MAHA 1WCYA 1P0QA 3PI6A 2WIGA 5J3JA 3KDAA 5IVDA 2C58A 2GYWA 5DYYA 4WDQA 5K3DA 3IVMA 5ALSA 3V1NA 4CCYB 1A7UA 4EA6A 2OQIA 1IVYA 3CN7A 3H18A 5KREA 5ALGA 5DWDA 4BVLA 2Q0XA 3A2NA 2QXTA 3I1IA 2XQFA 4YX9A 5K3EA 2HA3A 1XQXA 2JBWA 3R3VA 1W6RA 5ESRA 4DMHA 3NWOA 1QJ4A 5AKZA 4WFJA 1F6WA 2QS9A 5AOCA 3V48A 2HA0A 4B84A 3VJMA 5HKAA 2XQGA 1CUJA 1QIJA 3EQ8A 3FYUB 1MNQA 3I2IA 3STVA 1QFMA 2D5LA 4C89A 1BN6A 1SCKA 3ICWA 4EY5A 5JIBA 1DX6A 1AGYA 2D0DA 2WIKA 2XUPA 2HM7A 4I3FA 3Q8WA 3C87A 4IHAA 2QJWA 4AO6A 2PL5A 4BATA 1J1IA 2J4FA 1GQRA 3VISA 1F0PA 2I3ZA 3QMVA 1LBSA 1QOZA 2QOEA 2OCKA 1GPNA 3G9ZA 5HF6A 2JEYA 4HTAA 3L1HA 4H0CA 5E4YA 2XMRA 5C7YA 4BZWA 2H7XA 1IZ7A 3TEJA 4C4YA 1DWOA 3A2LA 3IULA 4BP9A 2QVBA 1VA4A 3G8YA 4W1PA 1HDEA 1EI9A 2XMGA 3R3UA 2QZPA 2B61A 2WHRA 4H7EA 1QO7A 3E1GA 4GW3A 1F0NA 4X90A 4UFOA 2BAGA 4PSCA 2GBCA 4LXHA 4H7DA 4U2DA 1GKKA 3HLKA 4CG3A 5AI9A 4KE9A 4X91A 4GEGA 2J4CA 2DR0A 5CBKA 2V96A 1JU3A 4AZ0A 3STWA 1FFEA 4KE6A 5LZ7A 3KWJA 4J7AA 2H1IA 4DTCA 2W6CX 4UHFA 4J0GA 4ETWA 4WJLA 4BCCA 3MUOA 2FJPA 2ROQA 4U2CA 3V1MA 5ALPA 1SCIA 3GELA 4X6YA 5HQ3B 2IIVA 4L3WA 1XRPA 1T4MA 1L7RA 1ODCA 3GROA 5FUMA 2HADA 3OM8A 1XKLA 1CUFA
chains in the Genus database with same CATH superfamily
1ADFA 1T5DX 3VC3A 1ZW1A 5B3JC 4UM9D 3IQDB 1CUVA 2A9VA 1W9HA 1GGVA 5A4IS 4DR7B 4YRMA 1RYNA 4ZEVA 1A9ZA 3MCTA 1IAVA 2UYYA 1E6KA 2XKBA 1DBSA 3HDTA 1ML4A 3L4EA 4Q9NA 5FTNA 5J40A 2QYTA 1T6YA 2F8SA 4QX6A 4J94A 3SNHA 4D9CA 5AM0A 2Z08A 4DG9A 5FR2A 4ATNA 5FOQA 2V4UA 3QUCA 4AZ0B 1SUCA 1N8SA 1TKCA 4OLFA 2FPUA 3NDJA 2WTAA 2XEDA 4W7IA 3QVLA 3TVDA 4BNLA 5A02A 1FP7A 2OO5A 1U7ZA 5C32A 1ESDA 3SYKA 2EW2A 1WEKA 4CM3A 1RXUA 4RFLA 4EZBA 4INOA 5BWCA 5KTOA 2YRXA 1HC7A 4R1LA 3NOVA 1XRMA 1KH3A 2WVJA 1RRMA 3NJ8A 2QZ4A 4Y2XA 2OXTA 4PO1A 3MZ0A 2GMWA 2N42A 4GXNA 3KJZA 5KKAA 3JQRA 5EMMA 1GG8A 4M1WA 2M32A 4KIFA 3IP8A 3BBPA 4JBLA 3LMKA 5DYGA 4YDQA 2DLCX 2GN6A 3FF4A 2BP7A 2JGIA 1BKSB 2VPWA 3KB2A 1P31A 4ZVRA 4XXHA 3RWMB 4KL8S 4B9EA 3OO1A 3D4BA 4OI2A 2QPTA 3FRIA 1S7GA 2VF4X 4ENVA 2YH2A 3TQQA 3CLUC 2E4WA 2R7MA 1OE0A 2B92A 3EF0A 4HNQA 4X1IA 3VKUA 4A0HA 4W8HA 1GVHA 3BILA 1V1JA 3W5JA 2JGFA 1TUGA 1S2IA 1JYEA 3AB3A 2O57A 3MPUA 1X1BA 4FR5A 1G8JA 3UKJA 5ALVA 3OZRA 1PYDA 3ZGYA 4UXIA 3QLUC 3RYFB 2I1WA 1OFTA 1OU0A 2R79A 3E7PA 4UBLA 3GLIA 3PNMA 1I36A 3O2NA 4JBWA 4BEVA 2Z2JA 3A6HA 4AFNA 4D44A 2BBWA 3RS7A 1UMBB 1YZKA 3AO0B 1RT9A 2Z1DA 4KC0A 2WIBA 3LK7A 1P4RA 1Y3AA 3EZNA 3ZPXA 5EMLA 1ZUD1 1C9EA 2PGDA 1HTTA 4CBVA 3BIJA 1HFWA 3DFKA 1U3UA 1KSHA 2W6OA 1II8B 2OAGA 2XX3A 3UG6A 2F17A 4ENRA 2OENG 1E58A 1AKRA 4FHEA 1GPWB 4KP7A 4Q9JA 2OB2A 5B2ZA 4ARBA 2XE4A 4KXUA 4I1RA 1XR3A 2OBYA 3EIWA 3Q5GA 2UU9B 5J4YA 3ZUPA 2R87A 1OX6A 2F67A 1EJ6A 5HE9A 1WPXA 5IZCC 4Q1VA 5ILOA 2ORVA 2FW0A 13PKA 2HDWA 2J0UA 1JJFA 2PQMA 4F8EA 1DX9A 4ADSG 2HIAA 1WBDA 4R2JA 2QMOA 4ZO6A 1TZMA 2D00A 4POAA 4X8MA 3U1BA 1DJLA 1IWOA 4EY3A 1FFYA 1OHHA 3JRXA 1PNVA 3KUDA 1G55A 4QQFA 1OROA 2G72A 2Q3LA 4DCSA 4D25A 2P4QA 3AUYA 4LVUA 4UNSA 3EH1A 1QHXA 5ECGC 3SU8A 3QEAZ 2J6HA 4DIOA 4G5HA 2AVDA 2UZAA 3N07A 4Q05A 5K20A 5DLPA 4NBWA 4ZOAA 3V8QA 2VA8A 1ID8A 2XZPA 4U2FA 3RJ9A 3KJGA 4D80A 1AB6A 3ENKA 1M6NA 3FMGA 3WSWA 4UE6A 1UDXA 3SQDA 2HQOA 2IWHA 3ECAA 1O9BA 1ORHA 1WTCA 3CCBA 3FLBA 2WMNB 2KYRA 3LVRE 2R8XA 3O8OB 3PUHA 4HXEB 4BO8A 5L7WA 4WXEA 5EWLA 4OD0A 3VU8A 3QOWA 2PT7A 2ZYVX 1DAGA 3U0BA 3TW8B 4HG2A 4TGLA 5JAQA 4D0LB 1I2ZA 4ENPA 2AFHA 2QPOA 2V74B 3OPYI 4PC2A 1HNWB 1QC5B 4EQZA 4QXOA 3V1LA 4P2BA 3ENWA 4RM3A 2JRCA 4Z1MD 2ATXA 1NVVR 3BQNB 3KQWA 4OSPA 2VDMB 5LU9A 4ZREA 2IDKA 1Q0ZA 1P3JA 1XHLA 1Z68A 1WEHA 2WTXA 3A1VA 3EK2A 1QGOA 1Y1RA 2Y76A 2XUJA 1T1RA 1MHPA 1U0HC 3N86A 1HY3A 2E5FA 2R96A 4BJHB 3ZGZA 1PCXA 2GBIA 1WDWB 2V3WA 2DQ4A 1XZDA 3IDOA 4Q9AA 4QRDA 4B09A 1CY0A 4WE3A 3GUVA 4FMCF 4CR8A 1E4EA 1DAMA 2QRUA 2BBTA 3M7IA 3M3HA 4KN5A 3OC6A 1IE3A 4PO3X 2GF2A 3G7SA 5FWDA 4U7DA 4JEHA 3GEIA 5A3RA 2VPXA 2WK1A 1RWNA 2B7BA 1Z2EA 4X24A 1BE8A 1SQ0A 2PYZA 3WTCA 5HP4A 4YCCA 3CPHA 4JVSB 1FMLA 3ZQKA 3PQ5A 4QA9A 1RWQA 3GH1A 1JIJA 5KJ6A 2WTNA 3EZ6A 4PHCA 5L6LB 221PA 4D4HA 1M2WA 3INGA 4TWJA 3E9QA 4H7IA 1I2MA 4Y18A 4WHMA 4F71A 5HIKA 1BQEA 1E9RA 1P9RA 1XMSA 1EK6A 2BGLA 1I2AA 4US0R 2HMWA 2CXHA 1CVRA 2P9CA 4NWIA 1KDTA 2VJNA 1M9NA 1MPXA 3FTPA 5I7WA 4E6EA 2R7NA 2Y4OA 2C1ZA 1RACA 3F46A 5CB4A 3DNPA 3T3OA 2NU6A 2O2GA 1JPUA 4DCTA 4BAGA 1FFDA 2VH5R 1KYZA 4K9SA 4FGZA 2XAUA 4MNTA 5DP2A 4HLDA 2XQKA 3Q8LA 4RIGA 2GTHA 4KR2A 1AQYA 2VT3A 3U7HB 4RHYA 3WGKA 2PUJA 1DTSA 2ECQA 4BMPB 4MCJA 4YWHA 3T7CA 4N5DA 1K8QA 3PHJA 1ZUHA 3NI2A 3J7TA 3JXEA 1UC5B 1Y80A 2AC2A 4IDHA 2ZSKA 3MRXA 2OLKA 4F3KA 4HNUA 3DT9A 2G5GX 2G1PA 4DR4B 2QT1A 3ZW7A 4DRXA 2WUGA 3INNA 4LC0A 2O23A 4AJ2A 4S3MA 3ZR4B 4QNNA 2R86A 2IUYA 5IFKA 5J4HA 1U1FA 3AR9A 4Q6WA 3K2QA 3LC0A 2NXEA 1KHHA 2IBMA 2HL6A 3AM5A 3G0OA 5SY4A 2MSKA 3IS3A 3QPWA 4TRRA 2HSZA 1LVHA 5CFNA 4Q3AA 4IUYA 3OUZA 1JA1A 3CLKA 4U7FA 1EXWA 1JHDA 5IUNC 4N8SA 1RZ3A 3VR0A 3EEFA 1WHTA 1VJRA 2E21A 1GV1A 4FZJA 5LMUB 1OZFA 4XYBA 4AC9A 1GPYA 1V3UA 2O4UX 5E3JA 5FUYA 4D7AA 2GF9A 5BR4A 1LSJA 3ZHZA 3PLAE 1QGDA 1OXUA 1C30B 2HA5A 4ND6A 3RO7A 1NVWQ 1OMOA 3BB1A 4XYGA 4NZZA 2X3UA 1CZLA 3MAJA 3QJGA 2KI5A 3TZ6A 2E7ZA 1ISHA 1UDCA 2YL2A 4LOKA 4LV5B 4MHOA 3FWPA 4UU8A 5GONA 4L78A 3W5UA 3VNUA 3PQ7A 1RPZA 1W94A 1YZQA 1VL2A 4RS3A 4CT5A 1SXJE 1W4ZA 2ACWA 2WJ6A 1XU7A 1E5VA 3A9SA 1HNXB 1GCGA 1RJ9B 1UMDA 1TYCA 1VJ0A 4IRMA 1KQOA 3MYYA 5DYWA 5GM1A 1JZSA 5J2TB 4ARZB 2C5FA 5T5QA 1R00A 4LXTA 1PL0A 3ZBUA 2NSJA 3R3WA 5I4BA 4DMCA 4Z1OA 2EGHA 3DD1A 3P97A 3SEZA 5JC8A 1EXVA 1N6HA 4X5OA 3W5HA 4BWGA 1E0JA 1H94A 1B8VA 3PWSA 4D41A 4YRTA 3W6ZA 4E07A 3RTCA 5LLTA 1E98A 4WQMA 4FHFA 1C14A 3G1TA 3GQBA 1A2BA 1JEJA 2FPIB 2GPTA 2VQ3A 4PLWA 4QNMA 1P19A 5FAXA 5GINE 3FG9A 2B78A 3K5WA 4FE4A 3KSMA 3EGOA 4HS4A 2JKZA 3BXZA 4JX8A 5I7RA 4I7EA 2P6RA 3NRCA 1J97A 2FQXA 5C7LO 1Z2CA 4MW5A 2IPLA 4HQLA 2EJBA 4BJ3A 3V2GA 2LBPA 5BSVA 3HWWA 4CF5A 1JMYA 2WG1A 2YXEA 1SU7A 1XYGA 5JPIA 4Z3DA 3UANA 2YV3A 3OY2A 5L53A 4II7A 3SXUB 4JROA 3C4JA 4X60A 1NT2A 2Y8EA 4KVZA 2RIRA 5SY6A 2OCLA 4K9PA 1M8KA 4OHRA 4R98A 1XFAA 3F8TA 5BN3A 2ZTSA 1LTHR 2WUVA 2ZSHA 4CIDA 1LCIA 2PS3A 1GPBA 3M5WA 3EZGA 3NASA 4NOLA 3UMBA 1QDEA 2CZCA 3R24A 1PDVA 4YV2A 3TLZA 4ZI3A 4M0LA 1SNYA 3E0QA 1MBZA 3QUAA 4OGFA 1LWNA 3C1UA 4NH4A 5AW5A 3MRTA 3FOBA 1TU4A 3I9KA 2F64A 3R4VA 4MA5A 1K7FB 3RM3A 4E2WA 4RMHA 4BWFB 2JCBA 4GP6A 4LECA 2PFKA 4EJSB 1WV0A 1WIWA 4AMGA 4JR1A 4FMDF 1PL7A 4GX2A 2WJAA 3D7MA 5BT8A 3DTTA 1IHYA 4KBYA 4M9QA 2WUFA 4YJ2F 1YU6A 4TZKA 3NWPA 1YL5A 4LBZA 1SJ9A 5CMLA 2XYPA 1NAIA 3G2MA 2P4SA 5I8WA 3KE8A 1EVIA 1AQNA 1GDDA 3V8RA 4B81A 2AGVA 1CEQA 2ZT5A 3F1LA 1MJGA 2XOKD 4XRRA 4YJGA 4ZO7A 3HADA 1AXEA 1X15A 4LJ5A 4Z3KA 3HDVA 2P6OA 3V4OA 1J0EA 1M54A 2ONCA 3L41A 2WWTA 1ZIYA 3QTBA 4EHKA 3VPGA 1K27A 1U9CA 3GAAA 3ZHOA 3OJCA 2O2EA 1HRKA 3L18A 1Y8QA 2HO4A 2W93A 5DYIA 1O6FA 1OZHA 2GETA 2E5WA 2JEOA 2QQ0A 2XD4A 2FZEA 2Z30A 4ER0A 5B36A 2ZBQA 1DMSA 3FY4A 4P54A 3CUEF 1VBMA 3EVTA 1P3Y1 2JHPA 4F8YA 4ARSA 2PO7A 1JU4A 1N2CA 3BICA 4CF3A 5LQUA 5BT9A 1E3WB 2JZCA 1U6IA 2I8AA 4M88A 1ONOA 1E66A 3SX2A 4K7JA 4CETA 2AJBA 2REQB 1O9GA 5MGBA 1ZHFA 1TYDE 4EL0A 4EQ6B 1VLQA 4WADA 3ET5A 2R00A 3HU5A 4B2PA 2Q5LA 3HVIA 2QLNA 4LYFA 3IXLA 2XMQA 3BVPA 4I5FA 3FUCA 5A2QA 3RJ5A 5TMPA 4NJOA 5TMDA 3RYFA 1KYVA 4DLSA 5JW6A 3BXPA 2Q3DA 1NPDA 4RKRA 4M9SA 1F2DA 2BFAA 4KQHA 5EOVA 1S2GA 3FCUB 4HDKB 4TYYA 3OT1B 4FNMA 4RMNA 1AKQA 3G0IA 3LU1A 4BO5A 3DTVA 1T2AA 5CT5A 2H07A 2Q1TA 1MJGM 3IAXA 5DFAA 5IABA 3R9XA 4C08A 2WWXA 2YXDA 4MSUA 3W04A 1JIQA 4L9RA 3C85A 2QVYX 3DXZA 4WZBA 5AXAA 5JJBA 3ANXA 3KKPA 1HM5A 5JD4A 3SZ3A 4W5WA 4DEVA 1MO5A 2E89A 3LPDA 1NW6A 1QOQB 3IURA 4UAJA 3FGOA 3IUSA 1Q14A 2BP7B 4FFPA 2R8BA 4OA8A 2JGAA 1C7RA 3O4HA 1AHHA 4WLEA 3A36A 3E03A 5E3HA 3JYNA 3AP1A 3DM9B 4J0KA 4IL5A 1ACLA 3N8IA 2MINB 3JD0A 4B3XA 5A0TA 3OOSA 1OHHD 3EQ9A 1P2FA 3SJUA 3OZFA 2XMZA 5TS3A 3O2SB 4QYIB 5ITZB 3ZGXA 4YBZA 5ALHA 1LS1A 1BHJA 3PZRA 4QDTA 2N3ZA 2QAGA 4N5IX 1NW8A 2A84A 1WCXA 1H3NA 1FX0B 1RXIA 2VH2A 2RHTA 4JBGA 3LY7A 1UP7A 1SPXA 1Y6RA 5KMGA 2IUSA 2W48A 2P3QA 3QH4A 4UHCA 1DARA 1DEAA 1XRLA 2PUAA 4RZUA 4BVJA 1N5OX 1X1TA 3U49A 4UCQA 2VSOA 3U5TA 4JI7B 2IHBA 1Q1GA 1G5IA 2G4VA 4B4KA 3NM5A 2VT6A 5CB0A 2D2XA 3NH6A 2VHVA 2AR9A 1JSRA 4RPHA 5EP2A 4FYVA 3KKKA 4DGQA 1LB1B 4YJ2A 2ZJYA 4IZOA 3R7BA 2YBDA 1GP2A 2A0XA 5CDUA 1RWKA 1YACA 4BX3A 4DJEC 1G21E 3V4ZA 3WAGA 3FSGD 1P5RA 4AKGA 4B2IA 2WQ6A 1Y7TA 2AWOA 2XLCA 3K7EA 2VTBA 3A2MA 1RQPA 4J4BA 3U44B 1T91A 1W46A 1DG3A 4WLNA 1HYGA 2BDUA 2DWUA 1RXYA 1HYEA 1DT3A 1I13A 2VBIA 2WSMA 2QJTA 1YQUA 1L7EA 1ISSA 2I66A 3HO6A 4M1QA 2J09A 1F2UB 2O1XA 2RGBA 3BQMB 3AM4A 3BSYA 3DDHA 5BNTA 2JLWA 1J20A 1JB1A 2NUPB 1PR5A 2ZTMA 2XCUA 1CRLA 2XECA 1ZH8A 1C7QA 1M1ZA 1S96A 2ILVA 3STYA 2BGIA 3O47A 3P96A 2DHQA 4DLRA 4YO8A 3NQ41 1NI4A 1VCNA 3L49A 4YCLA 4DCNA 1OILA 4AKEA 5JAMA 1W581 1APBA 2ZIGA 1DVRA 3GJ0A 3QVOA 4LYGA 4MW4A 1R0LA 2JL1A 1ESZA 1NG1A 2QGZA 4P86A 3R44A 1ECLA 3O2JA 5AJTA 1YQGA 1CY6A 1SELA 3H65A 5DASA 5IMBA 4H08A 4GYWA 5K0BA 3KJEA 2PWBA 2UKDA 4ND1A 4DNPA 2YWJA 2WILA 3MQ2A 1FXWF 1OX5A 1WM1A 3NHLA 4JSRA 4XIYA 3RC9A 3Q88A 3M3DA 4C4SA 2PNJA 1TYZA 4JLPA 3LO5A 4N9WA 1EDEA 3L0BA 1Q74A 3ZEIA 5IZ4A 1CUGA 2I3DA 3L1KA 4D0SA 3DCJA 3QX9A 2Q3BA 4MPJA 5CAEB 1LKZA 5LZ9A 1PR6A 1PR9A 1YUNA 1ORTA 1U65A 2D4AA 2C9MA 2AI2A 2ZSFA 1OI4A 2Y1LA 3QLVC 3V00A 2E9SA 3AY0A 4OYHA 1Y9ZA 4G1BA 3ZDDA 1DG1G 1GEGA 1HT0A 4NF2A 2MSNA 3L4KA 5DXFA 4FWBA 2VUTA 4F7WA 2OOKA 4AYWA 4UULA 4F12A 3FN4A 4TTTS 2HWXA 5HRCA 1JP7A 1SBHA 2VP6A 2RD2A 3V5NA 4ZTUB 1TJ3A 1NJ2A 4PX5A 4PE5B 2WJHA 1AB5A 4JC4A 4X6UA 2V6GA 3PUIA 4UUAA 3ZNNA 2B8EA 1I6MA 2D62A 3DBIA 3LHDA 3SCZA 4BTEA 3O4RA 1ISFA 1BS9A 3IMGA 2XWSA 4RVFA 1CW2B 2XD9A 3RBZA 1XF1A 5ITVA 4PQFA 2Z98A 2AOUA 4RYLA 5E9JA 1ISPA 4URXR 2PDAA 2VXCA 3THOA 4E12A 2AXNA 2UZ0A 2WNIA 2BKUA 3JR3A 1ISJA 5I4CA 5LOVA 2NYRA 1J8VA 4NDAA 1WP9A 8MHTA 4HB0A 5ALYA 1CUAA 3HKCA 4OVKA 2R1ZA 5KQPA 1PJQA 3O8QB 4RZSA 1HNZB 3ZXUB 4DTIA 1XTTA 3PNLA 1L4KA 2XWBF 1Z28A 2IEBA 2IXFA 3GFGA 4PG5A 4K8OA 3NVMB 5IBQA 5A3VA 2YY5A 4A10A 4UVEA 3EA4A 4BC1A 4EJ2A 1BCRB 4QGFA 4URZR 1IIRA 2YS6A 2ZPUA 4K2AA 1V3TA 5JWHA 2WPDD 5EFZA 1ZM7A 2NO7A 2IXEA 3P9XA 4IQGA 1JIKA 3MB5A 2VJMA 3JRNA 4D4JA 2MMCA 1OGYA 3NDBB 4OJQA 1N7IA 2JI4A 2QAGB 1XZLA 4RKWA 1RLUA 4RMIA 5J4LA 2ES4A 1IN7A 1TQ4A 1ZRSA 1HXHA 2BKXA 2X40A 2ZB7A 3ABIA 3IUMA 4NYMR 3VKFA 2YJ5A 2HOQA 4J0HA 2J3DA 1CV2A 1CQJA 2PL3A 2ZCJA 3H5VA 3V2IA 3EGDB 3QQPA 1G7RA 1E6EA 2WIFA 3AV0B 3FFBA 4ZYZA 3GNSA 3CX7A 4AY5A 3E22B 3CU5A 4AD8A 1E61A 2DVMA 1O5TA 1E92A 1ODJA 1W4AA 3BSFA 3FW1A 3GFOA 4Y1EA 1KEVA 1I94B 1FK8A 3JQBA 4IIJF 1YH3A 1TLTA 4K9RA 5FYQA 1Q44A 3WYAA 5F4BA 5AVRA 2G6TA 4IKPA 4LDZA 1NU8A 1E1CB 2V4ZA 5FA8A 3OPMA 3QMMA 4DBLC 5C8XA 4WVFA 1TZBA 2O0HA 2HC9A 1DKRA 2FUEA 1YJ8A 4MI6A 1DBPA 5JDCC 3GVIA 4IXNA 5I48A 3FPFA 4TXMA 1Q0RA 1SC3A 3B51X 3UWKA 3LYUA 3U44A 4O1HA 3VVBA 3DKPA 1AZLA 3D3WA 3E5HA 4G5RA 1L4FA 5EXTA 4ERNA 4ZGGA 1KH1A 1MXHA 1PN3A 2QF7A 3EDYA 3FYTA 1YQWA 1CJBA 2ABWA 3PKIA 4PSKA 4W9NA 3QPUA 4K9LA 4UMVA 4EG8A 3RAEC 4OXKA 4KB5A 3AX6A 3AHJA 3QQ5A 4P7BA 3VOSA 2Z3VA 4QXQA 2H63A 3VYTB 1F4PA 1ZH0A 1P77A 1TPZA 1FUEA 2IEYA 3AETA 2JEZA 4FWIB 3THWB 4NHOA 1U2SA 4LF4B 4C7OB 3CS3A 1NHWA 3A9UA 1YUMA 4IW3B 5PGMA 1NQVA 4J43A 1BWPA 1EUCB 2Q6VA 3JYLA 3MJSA 3EAGA 4JODA 1XVAA 4P3NA 3H83A 4MS4B 1C4KA 3E3LA 3G2HA 1E3TA 4JLWA 5CUQA 3REQA 4LNAA 5HTKA 3IJEB 1OXVA 4QVGA 2PN1A 4NOJA 4EAAA 3KE9A 1C1DB 5H1YA 1E2KA 3DLCA 2ODBA 5JCXA 4PGMA 5EKTA 4KQJA 1RZRA 3TG2A 3GPCA 3VSBA 3WL4A 2AE2A 3VM6A 1ODSA 4QHYA 2ZIAA 1CF9A 4HWTA 3PSHA 1PTJC 1B42A 3GCGA 4AROA 4CQJA 4F21A 1KWGA 1U0GA 3SG0A 4ZGBA 1IN8A 3HKBA 5ALRA 1GTRA 2WU8A 3LDFA 1ZISA 1QTIA 4EPWA 3KCQA 2OV6A 4LHVA 3O38A 1Z7WA 2YVUA 2QL5A 3NC0C 2VVTA 2ZWPA 5CK5A 2FETA 5MFZA 2VHQA 2OZPA 3X1JA 3EBOA 1QKJA 4JXJA 3WOHA 3CR7A 2NTYC 3IAFA 1Q1BA 1QK5A 4ND2A 4BFTA 2AQHA 2EOAA 4PG4A 4Q47A 5JMTA 5CIYA 3LP8A 2E18A 2WWWA 1FA9A 4ZV9A 4FDAA 4FDMA 3M1LA 2CNWA 3UK0A 1FF9A 1X7GA 4JR0A 1OPRA 4TLBA 3DPSA 3URKA 3D8TA 4YCMA 5L3VA 2IEZA 4LF6B 2WWFA 2I78A 1G8MA 1O87A 2JD0A 4X66B 4G0WA 5EZSA 4O29A 1P4GA 1ZA2A 2FPRA 4YJKA 5EAIA 3ZWYA 3BC1A 3CRW1 3IILA 3A7EA 3G7NA 4P9NA 1PUJA 1DKUA 4H1WA 5KSWB 5KU7A 5F1OA 1GPJA 3BGIA 1XPOA 5I7FA 4IWYA 3T1YB 4CMKA 1USIA 4DCJA 4HQNA 4OP1A 1ZH6A 5LP1A 3DOUA 3GLKA 4G0QA 1E7QA 5H3CA 2G17A 2XODA 3PHIA 2BJHA 1BS1A 3JTMA 4YS6A 4B7ZA 4HXGA 4C14A 4Q4LA 2GPWA 4KFSA 4RPGA 5AK5A 3ZCUA 1A8UA 2HRRA 4NU6A 1TKBA 2Q49A 1QF7A 3ENNA 4UMDA 1Q6YA 3A6EA 1BKYA 1VZ2A 3QYAA 1T6NA 3EDRA 3MMNA 3STHA 4B3RB 3E7WA 1JX6A 2GCIA 3P94A 1A9XB 4Q5IA 8ABPA 3K71B 3ESZA 5K0ZA 1SQ6A 4PHFA 4JQOA 3T3HA 1Z4NA 4LHEA 1VRVA 2CJWB 3R3YA 2J5RA 1C1HA 2WSSD 3WGIA 2D3WA 3SC6A 1B16A 5ALIA 5LA6F 3SEFA 4X0EA 4KACA 1FLDA 1A04A 1FFBA 2RCNA 2IH2A 3HCPA 2VPYA 3VDMA 4YJGB 4S1OA 4G65A 2C0QA 2NYUA 1Z7BA 4LMPA 4TX1A 2IDMA 4X3OA 3T99A 3X2SA 1MMFB 4MS3A 1WSBA 1ZJYA 1D3AA 2YICA 1RNLA 3FH0A 4NCNA 4RHFA 5IUJC 3SWWA 1EFVA 1ZCZA 4IQ8A 3BXEA 4OMCA 1G66A 2B94A 4EI2A 5JS6A 3LNTA 1KGSA 5I7OA 1G98A 3GLRA 3LLMA 4L5CA 2J5KA 1K8XB 1N2IA 4IJKA 1TK2A 2XUKA 2WKWA 3UJ7A 1NQ5A 3BXFA 4L3VA 2ZWOA 1HDRA 4U4AA 1NFQA 4QQ8A 1A3CA 2J3IA 5EZYF 4ER5A 3RYCB 2WD7A 1GNRA 3HYNA 4WNYA 3FVWA 4EHNA 3WLRA 3SFVA 1KL7A 1I0IA 3FZQA 4QFMA 1X9GA 3ELWA 4CLRA 4Z9FA 3BMOA 4DIUA 5ICMA 2QVZX 3CEPB 1XYYA 4AJHA 2Y0BA 3WGNA 1XMOB 3LHKA 5ARCA 3WJAA 5I3CA 1W4LA 1UF9A 2GNPA 4IDPA 3VV2A 1DBQA 2IXGA 3AF2A 5HDQA 3ZV6A 2V7BA 1ZS9A 2OCIA 2QYHA 3JWHA 4UASA 1Z0AA 4ZCSA 3F2VA 3ZS9A 5JUWA 2DTXA 2I3BA 1QQ7A 4X45A 4BTVA 5COAA 2AW3A 1XN1A 2UVDA 5EWMA 2WZCA 2B21A 3EGCA 3B5EA 3TKLA 1Z5GA 1J2JA 4JP2A 4XEUA 1ZD1A 3VFDA 3B3FA 3OE4A 1SCUA 2JFWA 5BMVA 3U3JA 1RM3A 1T4CA 1ZAKA 3OVMA 5EJ2A 3T9AA 5AQEA 4W1SA 4B3GA 1N0VC 2V5VA 3OIVA 3QELB 3WG9A 2Q4OA 1F1BA 1S0UA 4FNOA 4MVWA 2IIBA 4Q4JB 3HRKA 3OM0A 1Z8NA 2K87A 5BW8A 5CA1A 1TVKA 3DLAA 2DGDA 3OZBA 3TZEA 3RHSA 4BJ1A 4G5OA 5DKFA 1OLUA 4P82A 4R3UC 1YXMA 2H11A 3I01M 1BEZA 2FW8A 1CYDA 4DQXA 1PFYA 1RJDA 4JHLA 1AKWA 1BE0A 1I3CA 3QBDA 2OXEA 5JV5A 2PBFA 2ODWA 3VR6H 2OO7A 1WA5A 2LKCA 3CMMA 3CZQA 3H8JA 1ZCJA 4LHSA 2P2GA 2ZQYA 2OV3A 2YV4A 3F8SA 4ND3A 4CXMA 4ZK6A 1IOLA 1QZ3A 3WLKX 4W6ZA 2DBVO 1W36C 1G9TA 2V9PA 3BB3A 2FSPA 1NNI1 5T57A 4QBIA 3RTBA 1Y7LA 2QTVB 3KJXA 1DJPA 1P4SA 4YLGA 4NH0A 5BRAA 4L76A 5CGZA 1LFAA 1FIUA 4XQEA 3NXKA 5B58T 4IS3A 4JFRA 3C4VA 4YQZA 2WFZA 3MWGA 3U3OA 3ZHQA 4DREA 2C5AA 1WULS 1PNTA 3S2IA 3PUKA 3U56A 3VO1A 1YA6A 1EFRA 1S2LA 1AN0A 1Y0BA 2H2DA 4XVCA 3KQMA 3M6FA 2GPJA 3ONEA 5JCPA 5BWBA 1GZUA 4GXRA 1W85A 1DZIA 1SUAA 1N5DA 1Z2AA 4LJ6A 3K9GA 1RBMA 2Q28A 3FSEA 5JD5A 3U26A 1ZM3A 3IUNA 4XB2A 2R0QC 1U1IA 3AINA 2FN9A 4NV0A 3DLPX 4LXYA 1XP5A 3FLAA 1G8HA 5ALZA 1KO5A 3GFRA 4DHWA 2OV4A 4QDXA 3R6WA 4DYHA 1RWMA 3M2TA 2QN2A 2ZUBA 1A4XA 1WHTB 2PA3A 1O6BA 4NENA 3B3JA 3QPBA 2ZI9A 4F9EA 3EEBA 1QPGA 1ICIA 3PYLA 4WGFA 2O2IA 1FUIA 2HMVA 4EA8A 5DXAA 1EA7A 4WCFC 4WKCA 3A9VA 2Y92A 3HNRA 1KZ1A 1MT0A 3PFHA 4M55A 4NTZA 2BZ0A 1GU0A 4G5YA 4OXRA 3U19A 1CR2A 3ZDBA 2F4VB 5TJHA 3SJZA 1H2AS 1LQ2A 1OU4A 4KCGA 3VH3A 3ZHBA 1F7UA 2VF5X 1A9OA 4EDHA 2TRSB 2XIQA 1E4OA 4DKXA 1QQBA 1G2IA 2CWWA 3B20A 4OHMA 4AUMA 2AD1A 2JHCA 5HKBA 3AVXA 5DCUA 3W34A 1ESEA 2X76A 1PDWA 3GJQA 1IZ9A 3DOJA 1VCOA 3KD2A 4KKVA 3DDSA 5EE9A 5HSGA 2W58A 2CDAA 4C5BA 3MXOA 5CPBA 1P6UA 3ZW9A 3KXDA 4Q4AA 3KRTA 3ZC3A 3HA5A 5A71A 1EUYA 2GHQA 1NU6A 4EIWA 4PU0A 2YRWA 2B4RO 2JFYA 1PZFA 2DAPA 1F48A 2IY9A 3A37A 3NATA 1QP0A 1I6LA 3R7WB 3SLGA 2ZRHA 4NATA 5K0NA 1EE2A 1WZCA 1U4SA 2I3GA 3LA8A 3NHPA 4Q7LA 4FEAA 4B4OA 3KOOA 1IZYA 1CUEA 3IP7A 5JWRA 2VZ0A 1PSZA 2VJMB 3OG9A 3QE2A 2E4UA 2VPQA 3LQQA 3W5SA 3IQFA 2Y4NA 3QBJA 3T7EA 3DZDA 2IDZA 2NSYA 3V7WA 1HZZA 4B7UA 5C2JB 1V39A 2YQZA 4TV9F 4JLVA 1NI4B 3L02A 2HRCA 1T5LA 4BGDA 1R4MA 3GZJA 1GCOA 5CLIA 3L7LA 3HBLA 6PFKA 2HWWA 2JJ2D 1SO8A 1SUFA 5HKKA 3NUZA 2Q6OA 3ZY3A 2LIPA 2PJRA 3ESAA 5LXTB 2QW0X 2YNMA 4OFZA 2FKNA 4D3DA 1E4EB 8LDHA 3VO2A 1BX0A 4CU2A 1E9DA 2COEA 2I2AA 2Q6LA 1NTRA 1FUYB 1ZNWA 3GJ4A 4XD7A 3UAXA 2WWIA 1TIPA 1UQUA 3MC1A 2W6PA 3AILA 2BFPA 3DTVB 3PQDA 4FPXA 3RE1A 4YUXA 1DV1A 4JGIA 3AWIA 3NAMA 3RRYA 5ERXA 2W6JA 3GD5A 3MHPA 1G2QA 1L7OA 5CVUA 5IYZA 3E18A 1ULZA 4I50B 3WB1A 1QYIA 2WSSA 2KHZA 1VIAA 4NCKA 3C5VA 5TT0A 1JA9A 2OZEA 3T1TA 3DS8A 2OECA 4BLPA 2OD7A 1C3VA 1SUPA 4QDUA 3LUDA 1G42A 4IDAA 4K6KA 4UBNA 4TMWA 4M1OA 4AY2A 2O2DA 2WD8A 1PQUA 2OBLA 3HJAA 3QBVA 2REQA 4GZ5A 1H1LB 3WB9A 4ENQA 1SULA 1N92A 2IKQA 4CF6A 4N1AA 1YA4A 2K7FA 5T67A 3T7KA 3BDVA 1KYWA 5GOTA 3H5IA 4AL4A 4RLSA 3R3JA 4MARA 1MJHA 4BNJA 4QDJA 5B7PA 3QNUA 1Z7GA 5DM2A 4JJ8A 1Q6ZA 3EGDA 4D3SA 4GI7A 1EGAA 1R4MB 1U8YA 3KV1A 4QQRA 4U6SA 3UO8B 2QX6A 2PAFA 4O63O 1CY7A 4EFLA 5HRAA 5K5EA 2AG5A 3OLXA 2ZUCA 3OX3A 3OCVA 2ZUWA 2XY4A 4M0UA 2WIAA 2BEVA 4B31A 1YFLA 3WRYC 2PEYA 3CLRD 2VFAA 2ZLBA 3DVRX 5CFMA 3VNBA 3K0CC 4KPGA 1SEPA 1PLJA 2C99A 3K96A 1R37A 3FVTA 5HZGA 1CIVA 1GR1A 2J1LA 3RU9A 3N59A 5IWAB 1QR6A 3TJMA 3TS1A 1XHFA 1U99A 3HXQA 2ZJ0A 3RK1A 4TTIA 4IGFA 3JWEA 2AZDA 3E82A 4JK3A 4FB5A 2PUBA 2OORC 1NBMA 1NJSA 1RFLA 2J0SA 1D1QA 1GG5A 4EB6A 4LGMA 2XUIA 3OZAA 3LL7A 4CM5A 2FG7C 2DE0X 2JRLA 3EQZA 1B76A 2BFCA 3KFLA 4ZT4A 4E22A 5JS7A 4X71A 1G3RA 2DPHA 1RQGA 2FWMX 2Z8XA 3THWA 2RG1A 1T24A 1Z0DA 2M6KA 1E9BA 3H4MA 4HPWA 4DQ0A 3UPUA 4JVNA 2BFWA 1LJLA 2HSEA 1RLJA 5L3ZA 4O2BF 3OX2A 2RE8A 5AW0A 2ST1A 3EXEB 2AL7A 3CO0S 1R0YA 3UT0A 1QJCA 5KOHA 5AJUA 3VNQA 2O50A 4UDYX 3RVBA 1PU2A 4MS1A 3WYFA 4QVKA 5T41A 1X6VA 4KLRA 4HO1X 5EPOA 4DANA 5H83A 5FI3A 1D0IA 1ORWA 1JQ3A 3HKEB 2DPYA 3RK0A 1BSVA 3K0HA 4YIKA 4EFNA 1X38A 2DCMA 4M0FA 2DQKA 3NHZA 3PJGA 4LRSB 4X84A 4LFBB 2VDOB 2BTOA 5FO1A 4DCUA 5KYKA 4PX9A 1N8TA 2QUKA 3TRFA 3GEDA 2HQBA 4CI0B 1UDRA 2MTBA 3K9BA 3L8YA 4FOSA 3I30X 1IMJA 3ER6A 3U4HA 4ZMSA 1KU6A 1X7ZB 4BB6A 4D9NA 4CIWA 3IQWA 3TXYA 3S7TA 4M60A 5HMLA 3VNAA 4AS2A 3LK6A 1SB8A 5JMPA 4EO7A 3KKLA 3OJOA 1AGPA 5LDDC 2R68A 1RHJA 1TM7E 3HR7A 3LCUA 5HJEA 3E58A 3KAPA 4DJFC 4NV1A 7YASA 3HUDA 3SR4A 4KV9A 4B79A 1MC8A 1GPKA 2J9ZB 5GVRA 4DZRA 2I91A 1MO2A 2XE6A 2Q62A 4JLAA 3B1JA 4PLTA 3DE1X 4K1XA 1P2GA 2I0FA 3FFTA 3HP7A 3UIEA 1KQGA 4N76A 1O08A 4IIXA 1N0WA 4RQTA 2ZVDA 1DDIA 5JECA 2AMYA 1Z4JA 3G59A 4P3OA 3AP3A 3H1EA 3T6KA 5KYYB 3WHPA 4QO8A 1EVKA 2A86A 4OFBA 5EHIA 1JSXA 5DNYB 3U9LA 3WL7A 2G1UA 1XQVA 3MM4A 3EGWA 4CTOA 1XCPA 5DP1A 3ZLVA 4PLGA 4C7XA 4RD0A 1V1MA 2GERA 2C4KA 5L3SB 1F4VA 2LZ0A 1JXMA 2JKVA 3GEHA 4ZCRA 4RTSA 2UZ3A 2A30A 4DSTA 3OQHA 4UFPA 2QTGA 4OUDA 5HA5A 1RRCA 2BN4A 3UXHA 2AZTA 2H1VA 2QIPA 2XADA 3E3NA 4MTCA 3DAHA 1XJ0A 1JAZA 4M1TA 2GDZA 4RSHA 3TDMA 3B7PA 4B75A 3MWLA 4BDTA 3IR7A 3L92A 3N74A 3BD8A 4IY1A 1GUFA 3QKRB 4QUAA 4R3NA 5AKJA 4QASA 1GA4A 4C3UA 2HDHA 1P1CA 3Q7QA 1A82A 2H3HA 1QKIA 3F71A 3K0CA 4JASB 3WO0A 3AHIA 1ZCFA 4CQMA 4GPIB 1KFCB 1J39A 1J70A 3PQEA 3AR5A 5EWMB 3VZSA 4KX5A 1VG0B 4REQA 1YBHA 4UU1A 1B6SA 2FVYA 6REQA 1FLAA 4PRKA 1D2AA 4EENA 1U0LA 2IQ5A 3RIGA 1KZ6A 3IBCA 2R6DA 4OP2A 3PJDA 1VKRA 2OG2A 2P2CA 3R7AA 3FVRA 1GCUA 4DIEA 1ESCA 1IU9A 3M6AA 1G8PA 3A6DA 4A91A 1QTRA 1Z0FA 1YRQA 4LZPA 3DZKA 5EYPA 3TIIA 2NW6A 3PC8A 4NPAA 3AI2A 1TCCA 3IDZA 2WD7B 3T41A 3UT5A 5U1PA 5FOXA 3SBXA 4DL9A 4FGKA 2PX5A 2C42A 3GQBB 1GL3A 1W2WB 4Q9KA 1PQPA 2G9NA 1W5AA 4NARA 2H2WA 4D5EA 4YMUA 5K4HA 1QHNA 1JGTA 3UGJA 1ISIA 2Z5GA 1U2GA 4M7PA 4NP6A 3V8EA 2FW9A 3BKXA 1L7DA 1GCIA 1TTPB 5KUTA 3KZCA 3MWDA 3ANSA 5K0LA 4FGSA 3DVQX 4MGYR 1PWEA 2VSQA 1ESMA 3E3MA 3JS5A 4MKXA 4YP9A 5HFNA 1KEUA 3KQHA 3LUFA 2WUDA 4G89A 3SQXA 4P32A 4IDOA 4JUFA 3LNCA 4XLLA 1O57A 5GJVC 3SYTA 5EJ4A 4N41A 1FDTA 4HRVA 3KQPA 3UA4A 5TLSA 3JYOA 2JGDA 1QVRA 5G41A 1R6VA 3FMOB 5BUZA 1CNFA 4ZAVA 2PUWA 3FTCA 4PYQA 4EMBA 3GYGA 1X1QA 2J7PA 2YUTA 4N4AA 1J90A 5D1NA 2Y9PB 4UTPA 4MUXA 3OU6A 3SX4A 5KKNB 2CK3A 4IH4A 3W9UA 2ZU6A 4ERXA 2EKZA 1T6ZA 2QTRA 2GM3A 1L3CA 1SXJC 3ZE2B 3A4MA 1FOEB 5K3SA 1RE0A 1UT8A 3LRXA 2HMUA 4MV4A 3D7RA 4H15A 1K4KA 1A97A 4QUIA 4E08A 2PMKA 2BLNA 4M36A 3UUGA 5HKOA 1C9MA 4YIHA 1YR9A 3M6WA 4I5DA 3PDCA 1MRNA 1JQBA 1DRUA 1PWHA 5E9QA 1IB6A 2IODA 1ZH4A 1NXWA 4CVNA 4LX0A 1XZ8A 3DKRA 3JASA 1OIWA 3MJTA 4FYIA 4RTNA 3L06A 2QRLA 1KFEB 3I5YA 4K3VA 4LKOA 4RD6A 5BWOA 1C29B 3W9BA 4YRIA 1HL7A 1MQ9A 1KZ4A 3RK4A 1VSBA 4EZIA 5FEUA 3I8OA 3LV8A 4FD3A 5A5EA 3U4GA 4BB5A 2QLBA 1YQXA 1M5RA 1YHNA 1Z5PA 3DNMA 5H80A 1OC4A 4ER3A 3INRA 2J46A 1UZLA 1N78A 3AP2A 1ONBA 2FCRA 1IBLB 2HXSA 1NZFA 5JSYA 5CVTA 5K8LA 1HH4A 1J42A 3HQ4O 2ODPA 1P75A 1PT5A 3ETDA 3OTWA 1J2RA 1PTKA 5JSKA 1FS6A 2AG8A 2J5QA 2QVCA 4UTXA 3ZJTA 4C0WA 2YDXA 3BL5A 1QZXA 3ZWWA 4LYYA 2DCUA 1TJ4A 1AHNA 4GBED 1UXOA 5ALUA 4CMEA 5DM70 3RSFA 3Q2IA 2P9TA 1QIHA 4J91A 3IA2A 1E9SA 1ODLA 3O1IC 5JZVA 3DFUA 4JWTA 2Q0HA 2XGMA 1JIIA 1C8LA 5L4NA 1W8IA 4AIRA 1J00A 2GD0A 4C43A 3GY0A 4ED9A 5L8VA 4UEJA 4AJ9A 4CMGA 1AHIA 2AMLA 4J0QA 5E1MA 3GLHA 3PQ3A 2ERXA 2WYVA 2CHQA 2RB5A 4X7PA 3C3WA 3RRFA 1NY5A 5ALEA 2OBFA 3PNKA 3H16A 2DUUA 5FNZA 1UPCA 4E88A 1V7QA 5DIZA 4JI0B 1A9XA 4NR0A 2FSHA 2X2PA 1WPGA 4HLQB 5E3IA 3EZYA 1FPQA 2IZ7A 1Y89A 3WJ1A 1NLUA 4NBRA 4IO1A 1GYPA 2BMDA 2EP7A 5LWQA 1T8PA 3HK2A 4BV8A 1NP6A 3G0DA 3BF8A 4ZALA 1SD5A 4BZXA 2ID7A 5DNWA 2WY2D 4D3ZA 5AH0A 3PGMA 1Z18A 3CZCA 4F5EA 3VDQA 1K0FA 5BR8B 4FE7A 2IHUA 4FYMA 4GOLD 4R51A 2QE7A 2OC4A 1EVQA 1SIUA 1PZXA 1M33A 2QRHA 4ZXFA 4A15A 2PGNA 3RTGA 2H54A 5LNK1 7ABPA 5EMNA 1LNSA 5I4IA 4CHTA 3K5HA 4PPGA 2FE1A 7MHTA 2Z1NA 5BORA 4YECA 4QWMA 3CMCO 1Q7RA 1RIIA 4I9GA 1P1IA 3K0FA 4UOEA 1A5SB 1P7WA 3TSCA 1DBWA 1E1RA 1P45A 4MZDA 5EWJB 2W0MA 1C7ZA 2DH5A 1WV1A 4XVUA 4NXNB 2PLAA 4IZ6A 4LBYA 1JB9A 5FOUA 3FHTA 1KNQA 1W6UA 4KOAA 5AKGA 3W1EA 1M2OB 1NMYA 3BYZA 1JW9B 5GGXA 3CLTD 3LDAA 1L4NA 1YVDA 4I2VA 3W2GA 4AZSA 2BM0A 4AUNA 5CLFA 2CHFA 1PR2A 3VU9A 3CPSA 1PP4A 1BDHA 2QUBA 3QX7A 3SYLA 2I1QA 5KYUB 2QVXX 4QC2A 1FNBA 3LGAA 2VUSA 2RFLA 2ZSIA 4YPOA 3L6RA 1OBHA 1J7JA 3G02A 3OFND 3OTGA 5AM1A 4GO1A 3ZKAA 3UXEA 3G6KA 4V0QA 3LW8A 2Q6KA 3W8RA 1GGNA 3MSXA 4C30A 4KYIB 2IL1A 4YWJA 3FOZA 4U7PB 4HB2A 1KPGA 3PR3A 1A98A 1YI8A 4JUBA 4UZEA 1U7PA 3MS2A 1GAJA 1T36B 1ZO8A 2VP2A 4IDNA 2RH9B 1HYHA 2GKSA 5FPYA 1V6CA 1X8LA 2FGKA 4LJ7A 4RV5A 3S3TA 4B87A 4Z4GA 2OPHA 1ABFA 1W4BA 4F2WA 2OPBA 1ZN9A 2PFSA 3STTA 2IV2X 2C9ZA 3AERA 1JNYA 1I7NA 2QJOA 4WZAB 5FULA 2VKQA 5DHRA 3L3BA 4X94A 2OFOA 4Q82A 2H1OA 2O8CA 2OUKA 2IYQA 3NC1C 4XIFA 2F3SA 4MCIA 5FWYB 3M4ZA 4KDFA 3I2KA 5JZBA 2VYNA 5INTA 2VJYA 3E0XA 3IOEA 2J3HA 3V9PA 5JYBA 5IC4A 2V7PA 2VJBA 4K26A 5BSWA 3T1QA 4PXYA 4KRXA 4EG5A 1MO6A 2JGDB 1DO2A 4UZSA 1J2EA 1DB3A 2FR1A 3UNXA 5KIAA 3CF4A 1BYIA 3N5CA 3D5QA 4FFSA 4PCAA 5LYYA 2Y6UA 1K88A 3F7MA 4PNPA 2QX8A 1P3DA 1T0UA 3HJBA 2CUKA 4F11A 3IB6A 1VOTA 3C70A 5IAEA 4X3PA 3FCOA 4D8TA 1U8TA 2I4RA 2EW8A 2EV9A 1KY3A 2PTHA 1EX6A 1V1RB 1NVMB 4LGCA 4BFCA 2HXYA 3NYWA 2A67A 4PSUA 3HG7A 4TKUA 3UAGA 2ZFUA 2WV9A 4LN1A 3UB4A 2O0JA 4GBJA 3NGMA 5C1OA 3L8EA 5L45A 2O6LA 5M29A 3ROXA 3ORSA 1LDYA 1UJ2A 3OETA 4YMSA 5LDHA 1LF5A 1KZGB 4FOLA 1KK2A 1XZPA 1R2QA 1C9YA 4PNHA 1RHRA 3TLJA 2J0UB 3IUJA 3SMQA 2BEUB 3N2ZB 4JXZA 3U7GA 1CU1A 1UBTS 3ZK8A 1DG9A 3TOSA 1C30A 1WHSB 5IG2A 5AKKA 4N65A 3BH0A 3NTVA 2GXUA 2EEPA 4C06A 1T2UA 2RC5A 3D8SA 1TRHA 3WWYA 1X0VA 3Q4GA 3GJ7A 2GAOA 1IN4A 4IDBA 1ABBA 4ZI2A 2VHWA 3G0GA 3RFCA 4MYCA 3B12A 2EJCA 2J31A 3ZCTA 1RAIA 5AD1A 3GLSA 2QP3A 2NO0A 4HAZA 3WWDA 4REQB 3R77A 4EYKA 3LTEA 4IG4A 4CF4A 3VHXB 2EFHB 5HF8A 4N9QA 4V02A 1RQXA 1HQDA 1N9ZA 3IERA 2O8VA 4X93A 1HE3A 1GRCA 3T61A 1D2NA 2WG0A 3RU7A 1HV8A 3TKYA 2HF8A 3JQ9C 3RVSA 1U2DC 3K4QA 1L4MA 2JHFA 2XZTA 5CXQA 2SBTA 4RESA 4IICA 2QUHA 3HBJA 4XCVA 1OLSB 1O4WA 3QK7A 3B85A 4Z1MA 3NOXA 4KFTA 2POQX 5B6PA 2JLBA 3EGVA 1XE3A 1YOBA 2OCPA 2BUCA 1ES9A 3LDGA 2B8NA 3MIZA 3AB8A 2WTMA 4GECA 4OHUA 1MC1A 4XR9A 1EP2B 1JECA 5IAGA 1EGHA 4MJ7A 4XOUA 3W2IA 3CLSD 3O31A 5ALTA 5FH9A 1F20A 1ZNZA 2IDJA 1PHPA 2QW1A 5GAJA 3M0EA 1KI3A 1EGMB 2XVMA 3HO8A 5BVHA 5BNZA 4FFWA 1VG1A 1EWKA 3ZV3A 4P0TA 5JE8A 1VIYA 2ZAGA 1NXTA 1I32A 4PEVA 3SGLA 4RHXA 4IUDS 4UEOA 1JE0A 2QM0A 5D6OA 5T4FA 3MW8A 2CMDA 1TU0A 1U1EA 3FPKA 4R6XA 4B7AA 4R16A 5EG5A 5ABPA 2YJNA 4DA8A 4IYRA 5DB4A 3R7SA 5U4XA 5E6SB 4ZVQA 3HM2A 1V26A 3CVOA 2ETXA 4EGCB 2XOKA 2QU7A 2ADMA 2HREA 2IP4A 2JLAA 2VJQA 3AK4A 4QZVA 2NN3C 2Q50A 2K5UA 3DAPA 3K8OE 3S4YA 1E1DA 3NRBA 4YCJA 1M2KA 4YJDA 2AFIB 4LMAA 3JQPA 3TBHA 4CRWB 4TL9A 3CWZA 3I6ZA 3PEVA 4X92A 3S2GA 1HT2E 3R0XA 4QYSA 3WGZA 5BUSA 1G6Q1 1FUUA 3PQ4A 1XZKA 2HMTA 1E1MA 4W9NC 3PX7A 2GPNA 2EQBA 4ETIA 3MRVA 1WW2A 2JH8A 1YHZA 2Q3HA 2Y1XA 4CFSA 3ZWCA 1HEYA 4XB1A 5G40A 2ZSJA 3ESDA 4KHZA 2NYAA 1SHTX 1K1EA 2Z2KA 3G2NA 4RE6A 3COZA 2WLTA 2W00A 4G0ZA 5AT1A 4OJTA 2V98A 2MYTA 1F06A 2W0SA 3IEXA 1NF8A 1TT7A 4HAOA 3MMXA 3OA0A 1Q16A 4LPKA 1U6JA 2IEIA 1VGRA 3JCZA 1EVEA 4LHWA 1UBHS 2NUPA 2QDKA 4JYBA 1N3YA 2CFIA 5DW3A 3UQYS 5FQOA 1FP4B 3ZWNA 3ZLBA 4TV9B 4DC9A 2V8OA 1XELA 1GLGA 4RQAA 3EDQA 4JB0A 4FFBA 4NZPA 5AMXA 1YZHA 5BV8A 3KCNA 4U7GA 2D1QA 3PS9A 4G0NA 1ECPA 3F9RA 1O96B 2WFLB 1CDEA 1JJ7A 2QV0A 3FNHA 3OE5A 3OD5A 4XJVA 3CPJB 4DMMA 5F9HA 3A7DA 2ZBRA 2RAPA 2M1XA 3FYHA 4L08A 4OF4A 3UUFA 3HEAA 1D2RA 1E0DA 1UEXC 4NS1A 3SF0A 3ZWKA 1GTSA 3FPEA 4DR2B 2YYSA 2JAUA 3LCRA 1J8FA 2QM3A 5ULLA 1F17A 2C3YA 4JELA 3RANA 4MVJG 3WL8A 3UK7A 3DWEX 1SKYB 3DJFA 3ANMA 4WCFB 1QNLA 1SVUA 3CUUA 3F4LA 1REQB 4RVHA 1R1DA 2WKRA 4KAJA 4UQPA 3WXMA 1UZMA 1X70A 1VMAA 4J4TA 2FXIA 2PZMA 4JMPA 3R8XA 2JW5A 1E96A 4FEYA 4MTLA 2VHTA 3EVZA 3SHWA 3ITEA 2NU6B 1SUBA 2WG2A 1BVHA 2BI8A 1ZSVA 1YR3A 4WKPA 3MT9A 1JI0A 1NI3A 4FR0A 2EFDB 5BYKA 2QX4A 3CQ9A 2G08A 2GQ0A 2I9PA 3PX2A 3DDNA 1T3HA 2XWQA 3HO1A 4IILA 1OPXA 4HNGA 2QRKA 3RD5A 2PG3A 2ZT8A 5F73A 4E11A 1F6BA 2P9YA 1X74A 5FQNA 1VM6A 5BURA 1GKLA 3OE7D 3A1EA 1BXZA 4IJVA 1G5FA 2OAEA 4HADA 5B7QA 4DCOA 3BAZA 1NZJA 5TMEA 3RKRA 1MVLA 2VSYA 4TS9A 4BLTA 2VZLA 5GGYA 5KU1A 4M37A 3UWDA 4C4PA 2ISQA 4G0XA 4MUMA 1VZ3A 5U9CA 3NM6B 3I09A 2B3TA 2X9GA 3V7FA 3PVSA 4ABYA 4PTZA 5KAPA 4Y7CA 3GJXC 3OFNA 2QZ9A 3WQQA 5EIEA 3QE0A 3FRJA 1QAOA 3COWA 5D84A 5T4EA 1WU8A 3KVRA 4QTUB 5JNVA 1BWQA 3WA7A 4UPEA 5HUHA 1H2ZA 4JOQA 2AHOA 2VP9A 2PRZA 5A6SB 5CVJA 3UHFA 3SF8A 2X7JA 2H57A 4MRVA 3A6ZA 5G53C 4CG1A 2C83A 3NDRA 4DILA 3UMJA 2PT6A 3ZK7A 3FR7A 2P3SA 4X6XA 4ZT5A 3LKBA 3MEQA 3UUWA 3VC1A 2PXHA 1DI0A 5KTKA 1N75A 1ZINA 2QR5A 3ADPA 3ITDA 3LUGA 2VDJA 3LKZA 3WQBA 4E6PA 3SNKA 3FCYA 1FFAA 5IDVA 1T2CA 3RBXA 2FUCA 3AR8A 4DAOA 4N5LA 5IMSA 4OLBA 4ZAXA 4WT7A 4DA6A 1CUZA 2OXCA 1U2GC 2P8SA 3B1KA 1BRTA 4PF1A 4TOIA 4H6XA 4HY3A 4OAQA 4UQOA 1GGEA 3H0CA 2WSLA 3MMSA 5ALDA 1I9GA 2KE5A 4HNVA 5C46F 2XXJA 5L3QB 4TMTA 1QGYA 3EZ9A 4PLYA 2R2GA 4PGHA 2HRZA 1NONA 2R3SA 1F8GA 4JFAA 5IULC 5JVDF 3TD6A 2MJLA 4ZVLA 4PV7A 4H7KA 5HZMA 1CJMA 1XU9A 2CB9A 1Z6AA 3Q3JB 4F06A 4A9AA 2JLYA 4MX8A 3T3PB 4G8JA 3LT4A 3N75A 4NBNA 3G49A 1EESA 2P0YA 1JEQA 1YRWA 3F5QA 1CZUA 3EVAA 4GZMA 5CFRA 3G7UA 1DC3A 2O3JA 3GRUA 3SK0A 4ODIA 1A9YA 1SWVA 2CSUA 1WZUA 2G8NA 4PYJA 2H5JA 2V6IA 3KLOA 3OHSX 4FDVA 2R47A 3B8HA 4E2ZA 3ASYA 4R2KA 2QNBA 5CFQA 1UFOA 3AG6A 3IAS1 1XRNA 4WY5A 3KSDO 2ADFA 3OZVA 1GPMA 3CX4A 2FZGA 5EXEA 1TF2A 3OJLA 4G9GA 4E5DA 4DR5B 1UC4B 5T4BA 1YR7A 3QFRA 4CM4B 4JDPA 2C92A 1QWSA 3NHUA 4RY2A 3VUEA 5KOJB 1TDJA 3P9KA 3KEQA 3RAGA 3HNOA 1FQOA 3ULKA 3QYPA 4QGHA 3R0JA 3PJFA 2K6GA 3PNOA 5UKDA 4CQMB 2C4UA 3SJBA 5DNEA 2ERYA 5BP7A 1NBAA 1CUYA 1IOVA 3K73O 4N7RA 3MWJA 4IJWA 4QTTB 3WNVA 4EPTA 3QM1A 2RK3A 1TVEA 3DBRA 3QI2A 2AR7A 2VRCD 4ZC8A 3ZDZB 5LOVB 2XCRB 4JUCA 4N5HX 4FP9A 3QTLA 4RL4A 1U9YA 2D7JA 4RSGA 3T38A 1G3IA 3T4UA 2I29A 1X39A 3DT8A 4KN8A 1XTVA 3OIYA 2LDBA 3QKWA 5AYVA 1SUSA 3SZMA 5ESWA 4XUGB 3P0IA 1G0NA 5A3SA 4DMKA 3FTNA 3BB4A 3H11B 5IH3A 4CYMA 3AVVA 2XTMA 1GZ4A 4DNXA 2B8TA 2VIIA 2XYHA 2A14A 4PS0A 1R3DA 1DC8A 3P27A 5CP8A 3RTEA 2B20A 4PLCA 4DSAA 2JHGA 1XMVA 3T9EA 2FLVA 2IT1A 2P78A 4YAJA 3UJ3X 2HZBA 3CKMA 5ITSA 2ZXUA 1PK7A 3F4BA 1C3OA 2SKCA 3AMVA 3QEMB 4FYHA 4D82A 4RCYA 4CEIA 5I01A 1UKAA 3HI6A 4JHXA 3GLGB 3KOYA 4AY3A 3JPWA 1E69A 3AYXB 1ZGHA 4ZOCA 1YZYA 3E5NA 1W44A 1IEQA 2CMKA 4N18A 4E1VA 1XMQB 1P0FA 5TV2A 3Q11A 4O2LA 1T5TA 1RKVA 5C1DA 5C1BA 1JALA 4D3YA 2JDID 4D4KA 3HFRA 2XOXA 3M4XA 2UYOA 2ZIXA 3AKDA 1YJ5A 4TTQA 1JHQA 4G2NA 5FTJA 3K0KA 2IOYA 5HIJA 3OQVA 3U7QB 1MAVA 4DT1A 4PZPA 1P0QA 3ZUGA 1U8ZA 1EP1B 5L3QA 3MOIA 3VV3A 2WIGA 4QULA 2QG9A 3OQNA 4B3SB 1CRZA 3MG9A 5IVDA 4WCFA 2WNSA 3L7MA 4DABA 4OQ4A 1EIZA 1ODIA 3PD0A 3BMXA 3MLBA 1Z5OA 3D3QA 3CLHA 1UMKA 1VI2A 5FNVA 1DQRA 4PNEA 4Q6BA 2B7CA 4QJ4A 2MCFA 2O4CA 4ZOEA 1JAXA 1F2TB 4CEHA 2TMGA 2JCYA 3AHHA 4EA6A 4ZI7B 2WR8A 2PD6A 3HM9A 3BGDA 1RMTA 2V45A 1O97C 3OQ1A 3H18A 3SHQA 4EYOA 4ARIA 4L4RA 3FKSD 2XUZA 5IARA 4QXMA 3O7MA 4M8SA 3BEDA 4MR9B 5AVWA 1RWXA 4ZO9A 4K28A 4NHEA 4RFSB 4E7PA 4M38A 3V8PA 2DSTA 1PJTA 1KI7A 1MPTA 3SEAA 2XQFA 1JPVA 2HBZA 5DVZA 5ANRB 4BMCA 2ZYTX 3PNVA 4ZZ1A 2HNAA 2JFQA 2Q4RA 4YX9A 2UXCB 3TEMA 2QM7A 3LDUA 2GM9A 4XAQA 5ESRA 4BFVA 4C0XA 4M0DA 3NWOA 3U4AA 1JRLA 1QHEA 1T29A 2YQ4A 5AKZA 5CVDA 1KAMA 1Q5PA 1Z3CA 4AN4A 3A28A 2G7MC 3CW9A 2VDRB 5EJIA 3ZNQA 5D01A 3L4SO 4IEFB 4DY4A 4XVRA 4JJ4A 5K0FA 1G38A 4MGIR 2HV9A 2D7DA 1EK5A 2NTNA 3VJMA 3X0DA 1N25A 5CJJA 4Q24A 4QFDA 1QIJA 4GR9A 1QC5A 3R7NA 5EE0A 2BISA 2BEKA 3CR3C 3KZOA 1YGPA 5CNMA 1GEEA 2UUPA 5E8JA 4D46A 3L6OO 2E48A 5A3QA 3G0HA 2IZZA 1RQLA 2D5LA 2F2TA 3MCUA 3P9NA 4R9NA 3L46A 4O4LF 2CMHA 2GO1A 4UEQA 5JRZA 1HFJA 3RTAA 4F96A 2FZKA 3OOJA 4YRNA 1V45E 2WUWE 5C5DA 3H9UA 3C6KA 3TZKA 1P62B 3MGBA 5BVHB 2XUPA 1Y8ZA 1DO8A 2ATVA 1JFLA 2BR5A 2JFGA 4EG0A 4R71A 3E48A 1XA4A 1EEHA 3ZDFA 2HPZA 3FIUA 3IIEA 1NN1A 3KR0A 2WPDA 4I3FA 2D8MA 2PTGA 1H2BA 2GCOB 2ZRJA 2C7GA 3GRYA 3NIDB 4W7SA 1SKYE 3HS3A 4AO6A 2PL5A 4BATA 5CVVA 2NZ8A 2J3MA 3GR6A 4QYXA 5JQGB 1DS6A 5JWOA 3I72A 3V7YA 1MAWA 3HL4A 3KJNA 5ELMA 1JDUA 2OBBA 5EIOA 3HN7A 5FF9A 4C6RA 2O7NA 2QRMA 5DNDA 3A32A 1I9CA 5A1JA 4O2BB 3RIHA 2QOEA 2OCKA 4OK3A 4C05A 1I3NA 2CK3D 2G8LA 2Q9AA 3X1KA 2P1DA 1E9CA 3E9NA 5AVOA 1BE1A 3PL1A 2DRIA 3LXUX 4QLBA 4HTAA 1QHHA 1DAFA 1O8CA 5J2UA 3R5HA 3ORHA 2XMRA 2BR3A 2ET6A 2XA1A 4MGEA 1G21A 3HFGA 4BNGA 3UJNA 4KWIA 2Q8QA 4FKZA 3FPJA 1DIRA 4NCIA 2MSLA 1IZ7A 1LH0A 3WBBA 4HVLA 5J1SB 2ZUUA 3AVQA 4UJ3A 5D3MA 3A2LA 3IULA 2F6RA 4BP9A 1Z4PX 1D4FA 3F6RA 3LQKA 2O8FB 1II9A 1JVNA 3INTA 4ZDWA 3QFFA 5JHHB 5E4FA 4YCAA 5A9TA 5LYJA 1HKUA 2XMGA 4B40A 1L2TA 2HUPA 2J41A 2W6NA 1KE1A 3ICEA 5A04A 4F4CA 2FPPA 3IMKA 2GGSA 2NXWA 5JYDA 2WHRA 1LLQA 4M7WA 4FK8A 5HTOA 5KJEA 2YIDA 5DK6A 5B1IA 1NR7A 4GW3A 2BH2A 4ALLA 4IX1A 4MQEB 2EHJA 1F0NA 1UJCA 5E95A 1RXEA 1SK8A 4X90A 5CFZA 5ITWA 2X5OA 1ML3A 3NTQA 1T5HX 5CHEA 3PK0A 3SVZA 1KP2A 1JHOA 4QPDA 5AK0A 4LXHA 4IYJA 4RTPA 4KIWA 2R6R1 1LTQA 1NVFA 1YR6A 1DXOA 1PS9A 3NV9A 4ZU1X 2B83A 3KC2A 4CU5A 1A2OA 4U2DA 3GNQA 4C1BA 4PPYA 1CYEA 2ZT6A 3F5MA 1E9FA 4GKVA 3DBOB 2J4CA 5FBVB 4OQYA 1T6BY 3PE3A 4TWAA 3OTOB 3RUDA 4P0PB 4MVJA 2QTTA 2P77A 1IJKA 2LIVA 2ZRCA 1CZHA 3Q8KA 4NDNE 4AZ0A 5K6TA 2A4MA 2JLRA 1ZN8A 3K1AA 4IWNA 3UGTA 4RWZA 4NBUA 1EUCA 1Q1ZA 2W6QA 3TTTA 1RQRA 2DLDA 3A4LA 4DTCA 3SKXA 4O4LA 5AXDA 3SDZA 4BCCA 1GFW