4ZTBA

Crystal structure of nsp2 protease from chikungunya virus in p212121 space group at 2.59 a (4molecules/asu).
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
321
structure length
321
Chain Sequence
FQNKANVCWAKSLVPILETAGIKLNDRQWSQIIQAFKEDKAYSPEVALNEICTRMYGVDLDSGLFSKPLVSVYYADNHWDNRPGGKMFGFNPEAASILERKYPFTKGKWNINKQICVTTRRIEDFNPTTNIIPANRRLPHSLVAEHRPVKGERMEWLVNKINGHHVLLVSGYNLALPTKRVTWVAPLGVRGADYTYNLELGLPATLGRYDLVVINIHTPFRIHHYQQCVDHAMKLQMLGGDSLRLLKPGGSLLIRAYGYADRTSERVICVLGRKFRSSRALKPPCVTSNTEMFFLFSNFDNGRRNFTTHVMNNQLNAAFVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protease nsP2
publication title Crystal structure of nsP2 protease from Chikungunya virus in P212121 space group at 2.59 A (4molecules/ASU).
rcsb
source organism Chikungunya virus
molecule tags Hydrolase
total genus 88
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ztbA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4ztbA01
4OA8A 2YQZA 4Y2HA 3O31A 3LDUA 1KYZA 4R8SA 1X19A 2OO3A 3TQSA 3KPUA 3EMDA 4DCGA 3ELYA 3G2MA 4Z2YA 1VL5A 1WXXA 1H1DA 3BGIA 3G2PA 3G5LA 2IH2A 1KR5A 5EC8A 5ICEA 1ZHFA 4GC9A 2ZFUA 5GOZA 4P58A 3M70A 2ONZA 4IWNA 3GIWA 5DT2A 3C0KA 5E9JA 3E23A 3R3HA 2VDWA 4KW7A 1NBHA 4CKCA 5EZSA 2C7PA 4RVDA 2YXLA 5DM0A 1JQEA 3OE4A 4HH4A 2O07A 4QDJA 1I1NA 2ZBRA 1HNNA 3G7UA 3FTEA 2XYVA 2LD4A 2PKWA 3ELWA 3FTDA 4E2ZA 5E1BA 5FWAA 3TKYA 2EX4A 5K0LA 5DX1A 3REOA 3UJDA 3UZUA 3KQVA 5DX0A 4V0QA 4YUVA 5CCXA 3VC1A 2NNWB 5ERGB 5EEGA 3BWYA 1ZQ9A 4YUYA 5BW5A 5DX8A 4FS8A 3SGLA 3FZGA 3JWIA 3MAGA 3A26A 5FULA 4P7KA 2YX1A 4RTQA 5K0GA 4CXMA 2R6ZA 1XDUA 4RWZA 2PXXA 3AXTA 3DLIA 5JUWA 1YF3A 2Z6QA 1WZNA 3NDJA 4HGZA 3KQSA 2NXCA 3CJQA 5HIMA 4RTMA 3UJCA 4L7VA 3IHTA 4PYIA 3THRA 1XCLA 1XCJA 1NW7A 2VS1A 5E1DA 2AOUB 5EHGA 4QQNA 3BGDA 4BLVA 3FUVA 3DTNA 3CBGA 3B3JA 2HV9A 2IDKA 3C6MA 3KPYA 1Z3CA 2OB1A 4RTSA 4PYOA 1JG4A 5K0JA 1DCTA 2IBTA 4V0RA 2K4MA 3M4XA 3FUUA 2OYRA 5ICGA 3WSTA 5EGSA 2PSSA 3FUWA 2P8JA 1G8AA 2EJTA 3G8AA 2P3LA 4MHTA 2AN3A 1BC5A 4PYMA 2A14A 2ORED 3KPVA 5DM4A 1WY7A 3HVKA 5ICFA 2ZTHA 2AOVA 2GS9A 4X63A 3DR5A 3PFGA 1IXKA 2IGTA 3EVDA 3RIEA 4CWAA 3OCJA 3OU6A 4GQBA 4RV9A 3EVCA 2IIPA 4E33A 1N7IA 4FSXA 2NP6A 4EQZA 1ORHA 1FBNA 3BT7A 4PIPA 5LQUA 3KQWA 5T64A 2ZW9A 4RTRA 2AOXA 1SVUA 1AQJA 3UFBA 4HTFB 4DKJA 2CL5A 2IFTA 2GLUA 3LPMA 3T7SA 1EG2A 4BP1A 2WK1A 1D2HA 4OQDA 4QVKA 5K0FA 3K0BA 3NVKI 3EVGA 5BW4A 5FUBA 5F2NA 2C7QA 5GWXA 1RI3A 4PYQA 4C06A 2UYHA 1ZGAA 2YTZA 4OX9Y 2B78A 3UJ7A 3PTAA 2OBFA 4XUCA 2ZIGA 5T6BA 3EMBA 3DLCA 1XVAA 4PYKA 3LHDA 3AWIA 5CVVA 5DSXA 3NTVA 4IKPA 2ZULA 4OA5A 3FUXA 4QPNA 3FRHA 4DQ0A 2BM8A 4MIKA 5EKXA 7MHTA 3P9CA 1JQ3A 1DL5A 2FRXA 4XUDA 5FHRA 5E1OA 5HILA 1XDSA 3DMFA 3G2OA 4HGYA 4OBXA 5EIWA 4GOOD 5CUQA 3MCZA 3TPZA 4EK9A 4YMGA 3HVHA 2BZGA 1WS6A 3T0IA 2P3QA 3MERA 4GOLD 2P1DA 4ER3A 3UWPA 4EKIA 2QRVB 3L8DA 5G02A 5FTWA 2PLWA 4M7RA 1MHTA 5EZQA 2PY6A 3LCUA 2BM9A 2QM3A 4HSGA 5FA5A 1KPHA 1Q0TA 3KQOA 4E31A 3FUTA 4YUXA 3CKKA 4M37A 5DTQA 3M6UA 1RI2A 1ZGJA 3PVCA 3UJ6A 1L3CA 1MJFA 2ZSUA 5DRTA 3ELUA 4AZVA 2AOTA 1YFLA 2JH9A 2F8LA 3KPJA 3BWMA 3KR2A 4QDKA 4BLUA 2PT6A 1P91A 2EJUA 2QYOA 3SSNA 3GNLA 1XTPA 2ZVJA 4DM3A 2JG3A 5MHTA 2Z6UA 4QVGA 4A6EA 1M0EA 1YFJA 3BKWA 1VLMA 3I53A 2ZWAA 3QOWA 3HCBA 4P7JA 3G89A 1RJGA 5DM2A 3P2KA 4RTPA 2PGXA 3ELDA 1JTFA 5C1IA 1N2XA 3B3GA 3LKDA 5K0CA 2DULA 2PWYA 1ZKDA 1L3BA 3P2IA 2FK8A 3LSTA 2BH2A 3H2BA 5E9QA 4U7PB 3GDHA 3DXZA 3PX3A 3GCZA 5DPMA 4EMSA 3ERCA 1QYRA 3I5UA 4DCMA 3PX2A 1VP9A 3AXSA 1D2GA 2B3TA 3HP7A 3M6XA 4FGZA 4KIFA 5EPEA 3IYLW 3LBYA 3LX6A 3R0QA 4PWYA 4UOEA 5BXYA 3UBTA 2CKDA 2ZIFA 3EGVA 5EHIA 4YUZA 5EMJA 3PLAE 1KHHA 1NBIA 1X1CA 4GC5A 5CVEA 1IY9A 3HVIA 4RTOA 2IH4A 1AF7A 4RVHA 4P7FA 1UWVA 5GIOE 2P41A 1RJDA 2YXEA 4PGGA 5EKUA 3DXYA 1YB2A 1YUBA 4F86A 3P9NA 2HTEA 4U7TB 2AN4A 1FPQA 4MQ4A 4LG1A 2G72A 3EGEA 2ZBPA 4GOMD 1Y8CA 2WA2A 4M38A 4O29A 5CVUA 4CTKA 3T7RA 2PXAA 4ER0A 5KYGA 1P1BA 3R9XB 1FP2A 2I7CA 3LGAA 2JHPA 3A7DA 4BP3A 3KKZA 2YR0A 2PWPA 3FTCA 2VP3A 3KHKA 2PVCA 3F4KA 5KVAA 4R05A 4RVFA 2JJQA 5P8WA 4PCAA 1L1EA 1EIZA 3A4TA 3A25A 5IH3A 3SX0A 2OB2A 1T43A 4AX8A 5GIPE 3U81A 3TM4A 4RTKA 3OFKA 5GM2A 3V8VA 2WA1A 3C3PA 4RTLA 2V74B 2ESRA 5DSTA 2O57A 4FZVA 3GXOA 4RVGA 3O4FA 4CTJA 4RTNA 2PBFA 3HVJA 3LDGA 1SKMA 2C7OA 4OQEA 2IBSA 3HNRA 5EEHA 4R8RA 2Q41A 5K8VA 2AOTB 1SQGA 2AVNA 3BGVA 4OBWA 3V97A 5HIKA 3I58A 3E05A 2OPBA 1G55A 3A27A 2OXTA 1HMYA 3TMAA 3TKAA 4RSRA 1R8XA 5FA8A 5FQOA 4QTTB 4EKGA 4F85A 1JG1A 4PYJA 4PONA 3DH0A 3T7TA 2UYQA 3SR4A 2G70A 4PINA 3R6TA 3GWZA 1JSXA 3HCCA 3LBFA 4PGHA 3ORHA 1G38A 3SMQA 5F2KA 1G6Q1 2ZIEA 3EVEA 5CM2Z 1RJEA 1P1CA 1KYWA 3UJ8A 3Q87B 5CCBA 10MHA 2FPOA 5F2OA 4GUAA 3MCTA 2Z6AA 2V7EA 4C08A 1TW2A 2ZZKA 5DTMA 2PX8A 1F38A 3NMUF 3GGDA 3GJYA 5FQNA 2EG5A 3NJRA 4GF5A 5LQJA 3EEOA 2P7IA 1P39A 3OZTA 2CMHA 3PS9A 1R00A 4KRGA 1D2CA 3GRZA 1QAOA 5EG5A 5HOQA 4GEKA 5GM1A 3TM5A 5CIYA 2GA9A 3EGIA 5EMKA 3MTEA 3CCFA 3BWCA 1SG9A 3CC8A 3G2QA 3P9IA 2AOUA 2I9KA 2OKCA 3VSEA 1BHJA 2AZTA 4FSDA 1YZHA 3GRUA 4M36A 3DMHA 5E2AA 2YXDA 3PB3A 5DXAA 2ZLBA 3RW9A 2UYOA 2ADMA 5DM1A 4C4AA 4P7GA 2UZ4A 1I4WA 3BXOA 2AN5A 4C05A 3GRYA 5EIFA 4HRAA 1EJ0A 2HMYB 3NDIA 1XJ5A 3P71T 1NW5A 3C6KA 1QAMA 2PX2A 5EMMA 1XDZA 2B2CA 4Y30A 4DA4A 4IV8A 4FP9A 4C04A 1O54A 4DZRA 2ZZNA 1KP9A 1PRYA 2XVMA 2QY6A 5FWDA 1AV6A 1G8SA 1QANA 2BR4A 3G88A 1NW3A 5LQRA 1JSZA 1VBFA 1NE2A 3KQMA 4PIMA 3P2EA 5U4XA 4E32A 5DTRA 3BUSA 2PXCA 2JHCA 5IKMA 4KDRA 1R6AA 1NV8A 2GAFA 4FT2A 4X61A 3HA5A 4WVLA 3TRKA 1VQ1A 2H11A 5LQKA 3HCAA 5FHQA 3UA4A 5CD1A 2O06A 4XUEA 3ER8A 1U2ZA 4PYNA 4PYLA 3MQ2A 8MHTA 1NW8A 3ID6C 3KPWA 5B1SA 4B17A 1R8YA 3JWJA 1YZ3A 3K6RA 2IH5A 1SUIA 5JR3A 1SUSA 1XXLA 4IV0A 4DF3A 2IPXA 3MB5A 3GRVA 5GINE 3OE5A 4LECA 5CVJA 2XYQA 3E8SA 5EOVA 3FPJA 4H0NA 5M5BA 4E2YA 1I9GA 4KIGA 2VDVE 3B5IA 2AS0A 3LKZA 3OZSA 2FCAA 2P3OA 2PV0A 3HEMA 1EJ6A 3JWGA 4AZTA 3OZRA 3M33A 2EFJA 4K6MA 1KIAA 3MHTA 2GPYA 4R6XA 1X1AA 1IM8A 3KR9A 3G5TA 3SM3A 1B42A 5BP7A 5KQSA 2IP2A 2NXEA 2AOWA 2HR1A 3DXXA 1R18A 2R3SA 1V39A 4G56A 5E9WA 3S68A 4YV1A 1RI5A 3ANXA 3VYWA 3HA3A 2FK7A 4GBED 3FTFA 2G71A 4XCXA 3NWBA 4ER6A 3GO4A 3D2LA 5C0OE 1VE3A 2XVAA 2N47A 4X1OA 3EPPA 3GRRA 5KQRA 3KQTA 1BKYA 2PJDA 3TOSA 5K05A 1L9KA 3DMGA 4WXHA 5K09A 1KXZA 2NP7A 3C3YA 3LCVB 2I62A 3UJAA 2ZZMA 4DMGA 3AY0A 1DUSA 3DP7A 4FR0A 5C9ZA 1EAMA 4CKBA 5DXJA 2P7HA 1JQDA 3BZBA 3FRIA 3P8ZA 1O9HA 1NKVA 2FYTA 4FT4A 5H02A 2ZCJA 2JHAA 2OZVA 3LECA 3SSOA 3LDFA 5K0NA 4RX1A 2G1PA 3HCFA 3DULA 5KS2A 2DPMA 1VP3A 3QV2A 4E30A 5K01A 4HG2A 3OU2A 3NWEA 4YV2A 5LSAA 4PNEA 4HC4A 4CKEA 5HZMA 2O0LA 2JH8A 3O7WA 5DWQA 3HM2A 2IDJA 3KU1A 4MTLA 1NW6A 3CGGA 3OFJA 3UJBA 5EVJA 3HCEA 1QZZA 2ZWVA 3E7PA 4ER7A 5FADA 1VPTA 2OY0A 3FPHA 3PT9A 2CMGA 4MWZA 3UJ9A 3X0DA 2GH1A 3GU3A 3QOXA 4ER5A 2QRVA 3HTXA 3B89A 4E2WA 2VDUE 5DRYA 2NXJA 1OR8A 3EEYA 4KDCA 3B3FA 3JWHA 2ZBQA 2PX5A 5ICCA 1M6YA 5HFJA 1RI4A 4KWCA 5DLYA 5HIJA 3TLJA 1WG8A 3M6WA 5K0EA 9MHTA 4YUWA 1L3IA 3P97A 5E1MA 4X60A 3EVFA 4ZTBA 4E2XA 2FHPA 2E5WA 1NV9A 3FYDA 4LWPA 1UIRA 3PFHA 1G60A 3KR1A 4BLWA 1JR4A 3BKXA 2YVLA 5E8RA 2VZ9A 5HIIA 1N7JA 3LCCA 4YMHA 5E2BA 1AQIA 2ONYA 2G8NA 3DUWA 1JG3A 4GOND 5GP1A 3RODA 3CJTA 3B7PA 3ME5A 5LQNA 2ERCA 2I6GA 2QE6A 1BOOA 4ISCA 3ER9A 2XBMA 5T67A 4RYLA 5FCDA 3OU7A 2CWWA 3KQPA 3SSMA 1RJFA 2KW5A 4C03A 1SQFA 3NW9A 3R24A 5D1HA 2O05A 4E70A 2BR5A 2NYUA 1X1DA 4EVIA 2PT9A 2AR0A 4QPPA 4HTFA 3TFWA 3KR0A 2P40A 1F3LA 4BY9E 1PJZA 3IEIA 3MTIA 5HEKA 4LWOA 3UA3A 5D1NA 3I9FA 3HCDA 3I64A 1EQAA 1JTEA 2B25A 3VC2A 3Q7EA 4POOA 3AJDA 3KQQA 1ZG3A 3BWBA 4ATNA 4C07A 4R6WA 4X41A 1ORIA 3A7EA 3FPEA 3FYCA 4KVZA 1FP1D 2PX4A 3EVBA 5EQJB 4PCLA 4NECA 5EMLA 4A6DA 1KPIA 1NT2A 3NVMB 2UYCA 2Y1WA 3MGGA 3CVOA 3FPGA 3KQYA 2H1RA 3EVAA 2H00A 1R74A 3OPNA 1Q0SA 3LL7A 1TW3A 1UFKA 2HWKA 5K03A 1TPYA 5E8JA 2P35A 1M6EX 3CJRA 3IV6A 4JXJA 5CVDA 4AUKA 1RI1A 2HNKA 4QTUB 3SXJA 2Y1XA 2YUIA 2NXNA 4QQKA 2BR3A 5LR6A 4F84A 3M6VA 5LQAA 2AVDA 3DOUA 5LQCA 1O9GA 1WXWA 1JG2A 4AZSA 3HA7A 1QAQA 4RTJA 3SVZA 1X1BA 1KPGA 3FPFA 1INLA 2B9EA 3P9KA 4AZWA 2XYRA 4YV0A 1FJXA 5K0BA 2C7RA 3TR6A 3G8BA 1VIDA 3THSA 3EVZA 2GB4A
chains in the Genus database with same CATH superfamily
1Z8FA 3KJFA 1BIFA 3EC2A 1M1XB 3O31A 1WULS 2FPIA 1K88A 1N9ZA 2B2NA 3G2MA 4HDKB 5DLPA 4DLRA 4M87A 1XCGB 3HB1A 3OAAD 1YC5A 1I80A 5DASA 5BT9A 2IH2A 1GKKA 1I1QB 2PKQO 1F8FA 2B0JA 1EDOA 2Q7OE 3LK6A 1E1RD 3OEHA 3GIWA 5CFNA 3GHHA 5HQ3B 5ENVA 3HJTA 1KYQA 3D6HA 4ZCLA 3LK7A 1USWA 4TWZA 2ZB7A 4F6RA 3DYIA 4BMOB 1CFJA 3M6IA 1D4OA 3PUJA 1OLSA 3JD3A 3HE3A 3B6IA 4PHFA 5F9FA 1DE0A 1JE1A 1NHGA 1YONA 2WHEA 4NFHA 2BEKA 1JZQA 4D3XA 2R5FA 3MC1A 4MR9B 2E4AA 1WXIA 3I72A 4MRSA 3FLEA 3A2MA 3LC1O 3LNCA 3DEJA 4GXRA 1CY8A 3WGOA 1TK3A 1YL7A 3AF3A 3OT1B 3O38A 3PD7A 4FGSA 3UHPA 5CCXA 1H94A 2V7UA 4OGGA 5TVGA 5BW5A 3GLIA 1XC7A 3DKIA 1QHYA 1ZGGA 4Q12A 5IMBA 5IX8A 1M6VB 2GPAA 1JR2A 5MGBA 2OZLA 5BSVA 2IL1A 4IJUA 4TL6A 3RUDA 3LQ1A 3NYQA 1NVVR 4RWEA 5K4GA 1C7EA 1IWOA 3G2KA 3KKEA 4FNMA 4COKA 1JBEA 3K4HA 5GMOA 4WOJA 5EZ5A 3RIHA 3WGNA 4FJCA 2DJGB 3DZDA 5JNSA 1S2GA 2P5SA 3KAQA 4K8RB 1B0UA 1P4SA 3JQQA 3VI3B 1H1TA 3CNOA 2IHBA 2XB6A 5T3UA 3RJTA 1Z5UA 4DIKA 4V3BA 2W2LD 4JJ7A 2NUBA 5CJPA 2HXZA 3R5JA 2D2XA 4ZXPA 3M2PA 4M8SA 3FHCB 4DUPA 4YJFB 3FUUA 3CE6A 3CVYA 3WJ1A 5KYUB 3WSTA 4CKBB 5EIXA 3ADPA 3FIUA 2P8JA 1SOMA 2EJTA 4FR5A 1QNLA 3CQ9A 5AOVA 5IC5A 3VR1A 3GPCA 4JLBA 1ECLA 3COZA 1NI5A 1L1QA 2HPZA 3Q7SA 1U7PA 2BKUA 4XGRA 3RE1A 2RKOA 1DBRA 2O2DA 3R9WA 1SK9A 2WUVA 5C8YA 5EXSA 1Z47A 5JVDF 5UKDA 2FZEA 4G5GA 4IOKA 4WZAA 1ZL2A 1Y1PA 3OU6A 2WVGA 1RCFA 4G0YA 4HADA 3MRSA 5TMDA 4R2IA 2C4TA 4GMKA 4C7BA 5U9CA 4E2XA 2X5JO 4W9MC 4S0ZA 1ORHA 5IBRA 3N2NA 3QA3E 3B1FA 4Z8XA 1LC0A 5FOSA 1AQJA 1I8TA 4MUJA 2IFTA 3JV7A 3OJWA 4Q5IA 4RZIA 1QB8A 2WK1A 1CNMA 2D1RA 2FQXA 3IP5A 3WZ2A 4CM8B 1RMTA 1EVZA 2P5YA 5CDTA 5JYEA 1ZWLA 2J30A 1E2JA 1UFRA 4QUGA 4AFNA 4YONB 1MZVA 4BUJA 5IASA 2RH5A 4PZEA 4B3IA 3WAJA 2R9NA 1WB6A 1IN8A 2JW5A 2XPCA 2DP4E 1G20B 4FZ5A 1DBPA 1HYEA 3AZPA 3QU9A 1Y1SA 3LO5A 4KUGA 4CKWA 2PUAA 2G1JA 3OZFA 4PSDA 2W70A 2VKTA 3FSEA 3KJGA 5E6UA 4RXTA 3R7BA 1OCEA 2PMWB 3KFXA 4IRMA 4N6GA 4OL0A 4UD2A 5FBWB 4EFLA 1W85B 4G8DA 3OCYA 2QY9A 4QBGB 5E3IA 4PLPA 1AURA 4J0GA 4PXSA 3NOQA 4HAOA 1MOZA 1G8FA 2MIIA 3H6GA 3STTA 2J31A 5BUQA 1YAJA 1QO9A 3VV2A 2PGOA 4DSTA 1EESA 5DHTA 1EPUA 3MA0A 3KE9A 1M1YE 2HO4A 3DMFA 3I1YA 4IYRA 4AK9A 1TQ6A 2BFWA 3MCZA 5KYUA 2C2YA 5TGDA 5JZOA 4E7OA 2O9JA 4GGPA 3WIUA 2NACA 2OK8A 3VHXB 2ERXA 4BPVA 2CLOB 2G06A 2XUJA 1RLUA 1N2CB 1QO7A 2ZCUA 2I22A 2PZFA 4KQJA 3KDAA 3TLGB 2CMDA 5KVSA 3P0JA 4AXLA 1QYWA 1W88B 1T2EA 3JZDA 3DF9A 3L84A 2RHRA 2AFHB 3N2GA 1T9KA 1W76A 1LA2A 5BQ3A 5FA5A 1N4AA 1M1YB 1Q0TA 2Z1MA 1U7HA 2VEDA 3LT1A 1JHVA 2WU3A 4M46A 5BSFA 5KYNA 1RJWA 1UH5A 4BNKA 4AJ1A 1Z0FA 3WKDA 1PT5A 3L0YA 4OHXA 1QE0A 3C6ZA 1IJFA 1FUYB 3S4YA 4JJ8A 4JI6B 3E48A 2E21A 2Z4SA 3GZTB 4RACA 1NB5A 4YGYA 1E5XA 2W8BB 3SS8A 3WMWA 3C85A 1YOBA 2YXBA 3GBSA 5F64A 2BM0A 5HJ2A 1SXPA 1C1XA 3TZEA 1N5DA 4XQGA 3S1AA 1N1DA 4ZJUA 2YWXA 3HJFA 3BL6A 4EHDA 4TYYA 1YFJA 3JQAD 1E58A 1RXIA 1SPXA 1UBOS 3B85A 1ZXBA 1XHLA 4JQZA 3RF6A 4DWWA 4NFSA 4P7JA 2AIMA 3T1OA 3F0TA 4GL4A 4UTZA 4YAIA 2BGGA 4BGEA 2QE7A 4C7OB 3D1JA 1KYTA 1VPEA 3EEFA 1W85A 3TTSA 1F2UA 3AZQA 4DDHA 3RT7A 1KI1A 2CBGA 2AI1A 4OQNA 2D1QA 4TTTS 3D3EA 2A3NA 4U7PB 3LPNA 3ZE2B 5H82A 4CEJA 1VSUA 3U7RA 3BIOA 1ZRNA 3NIDB 5IT4A 2HV8A 3NDBB 3L6OO 4KIFA 3WB2A 2F1KA 3LXMA 4CLRB 4PC7A 4YUZA 1WQ4A 1AO0A 2H4ZA 2R00C 2A3RA 4U7FA 4H7EA 4C6TA 1CR2A 1F0NA 2O7VA 2ZRHA 3NGMA 3TQQA 1N2CA 4RVHA 3V1TC 5FDFA 4CTOA 3M5DA 1ZVJA 5EKUA 4JUFA 4HQ0A 1RXYA 1Z4LA 3KUKA 4FD3A 4W5JA 1KHPA 1JEJA 1XLUA 2JI7A 2QG6A 5IDQA 2G77B 3WRVA 3F49S 4EO9A 1IOVA 2CNLA 3DTVA 1RXVA 3BBLA 5K3OA 1QQBA 1Z7WA 2AC2A 2BN4A 3IV9A 4YCMA 2UZ4A 2H5LA 4OYRA 1Y9EA 1D9XA 2JI6A 3LVRE 1S1CA 2JHPA 3A7DA 3EA0A 2ZAOA 3LO8A 3SXUA 5L8VA 4EG4A 3SHVA 2C8JA 3ZY6A 2PLRA 4ZCQA 5I3CA 3LX8A 2AEJA 3SN6A 4A2CA 1U28C 4TTRA 1ORDA 5I7RA 4YJ3A 1E7MA 1VCIA 1E6CA 1T43A 4C3OB 3ZUPA 3IQFA 2HA5A 1VL0A 2GYVA 2WSMA 3OUZA 1DXHA 4M1ZA 2I87A 4OPMA 4BVBA 3M5CA 4YWJA 3RSQA 5LP1A 5F76A 1RHUA 1C81A 1XVTA 3QUAA 3U0BA 4J75A 4D82A 2Q41A 3WLKX 4QKQA 3D1LA 5HIKA 2G1AA 4JBHA 3DV2A 4MYUA 3T3OA 1XEAA 3ZKAA 4FDAA 1YE8A 3BXZA 1PTKA 1F6BA 4YP9A 2OK7A 2GR9A 1XZKA 3P5UA 3VAZA 3VTAA 1CC1S 3Q2IA 4JR0A 4HMQA 1EVQA 1VGVA 1T0BA 2DT5A 5EZYA 1ZH6A 1POXA 2OORC 4RFVA 4Q21A 3SR4A 4E3ZA 1HDCA 1BWQA 1JBQA 2AWOA 3M6AA 4ZWNA 4DNQA 4K28A 3VYSB 1PDVA 2P9ZA 4MPRA 4EHFA 1UKEA 5D2CA 4J76A 4ZAVA 1S4VA 1C7ZA 1VOTA 4CMEC 4GUAA 2OXCA 3L46A 3U49A 2YVAA 4C08A 5JTUA 3TQTA 2W4MA 1G17A 1F38A 1P7CA 3T94A 4UU7A 5JSKA 4C2AA 1IZ7A 4GF5A 4D98A 4F3CA 3FOZA 2HCTA 2Y6VA 5FTMA 3X1JA 3KKUA 2RGBA 3LQ4A 4LYEA 4BZPA 1Q74A 3UN1A 5HOQA 5IU6A 1W7AA 3TDNA 1FL9A 3FOAA 1J8DA 1OAOA 2ES4A 3O74A 4GEKA 2GA9A 4X44A 3RV3A 5B58C 3CCFA 2PKXA 4XM0A 5CVOB 1I5RA 2AOUA 5GONB 2HY7A 2AYZA 1TCUA 5INTA 1WAMA 3OKFA 3BXXA 1BHJA 1HRKA 4D46A 1YZHA 2H3HA 3FM9A 3CW8X 1F48A 4R7GA 4RENA 3QWBA 2GEKA 1XKXA 2NPOA 4L3WA 1USUA 2VWGA 1A9XA 3SR0A 3V2HA 3TDMA 3JATA 5HTOA 1YUMA 1V7QA 1HDZA 3AOGA 1VZ2A 1RWQA 2UZ1A 3IEPA 4JD5A 3CBQA 3RSOA 3WHKA 2GAJA 2VK4A 5HZGA 4O3MA 1DRJA 1SAYA 3QKWA 2QRUA 1L5VA 3C5HA 4P0QB 2BEUA 1K75A 2ZYWX 3FHTA 2BP7B 4G5YA 4GZ5A 3E03A 2FPUA 3BVPA 2J9XB 2OO5A 1GUAA 2M98A 3OWXA 3G6KA 4GPEA 5ENDA 5FBLB 3QKSA 4DLNA 1JSZA 4EPRA 1PPNA 3ZNQA 4CM9D 4Q9AA 4X6XA 2EZUA 1UJBA 1FMFA 5BR8B 4NU6A 5LA6F 2A5YB 4KDRA 3RRXA 4C4SA 4D96A 2BTQA 4DIDA 4CDCB 3Q0EA 1FB5A 1VYVA 3QOYA 4K9DA 5ALPA 4JC5A 2QUJA 3RUIA 3OIFA 1P2VA 2GVZC 4RKQA 1WBJB 4LN1A 1P2GA 5CD1A 5E4YA 4LE2A 3OZWA 4YV7A 2FUNB 4RA9A 1XG5A 4EA8A 1UBCA 3IEJA 4U4AA 1XQ9A 1JIKA 3RSSA 4NVRA 4ZYVA 3O7MA 2Y92A 9PAPA 1UANA 1Q2UA 3C7TA 1JSLA 4K88A 1H6CA 4OW0A 3ODGA 1JMVA 4NH0A 4BQVA 1W36B 1ENYA 3I76A 4PV7A 4H0NA 1RKXA 4D1YA 5EHXA 3BWVA 1C7IA 1MEGA 3OC6A 2AS0A 2GUGA 3GRCA 6ABPA 1ANKA 1ISMA 5IM4A 1NRWA 2YN4A 2FCAA 1B15A 3MHTA 2QLTA 1KHQA 1UAYA 1KORA 4GSLA 4R6XA 3PQDA 5LP6C 2IWHA 1GRRA 2X4IA 1QDUA 5KQSA 1XKQA 1UXIA 2ZROA 5EJ7A 3HVRA 4BV9A 1G5QA 2MINB 1G16A 3AM4A 1PJQA 4MW6A 1QFSA 3KAJA 1MNAA 4FCVA 1X9IA 4HFJA 5EQFA 3HA3A 3T12A 2FK7A 1TU4A 1U3FA 2G71A 1B8UA 3A14A 4Q7JB 4CW7A 2AZXA 3CX4A 3RUFA 5AVTA 2J5BA 4GLJA 4GXQA 2AYOA 2VKQA 3DDWA 1Q1EA 5HR5A 3ILHA 4P6GA 1QIMA 2CUNA 4WKPA 5A9TA 3HSSA 2J67A 4ALNA 4URWR 1LDYA 2I62A 4P5PA 2W6QA 2WIKA 3FJ1A 1HYQA 3DDOA 2XKAA 2WIDA 4LBYA 4HQ6A 5LBTA 4D4IA 4Q1VA 2CIOA 1FJGB 1HM5A 3PKJA 4RK4A 1Z33A 1YR6A 1TA9A 1ELOA 3BCUA 3IAS1 2KYRA 3ML1A 3OM9A 3GD7A 3QVVA 5TPZA 2JKVA 5LUBA 1B2RA 2ASEA 2NPFA 5DIZA 3T9FA 2F3UA 3QPCA 1X15A 4BS5A 1JDTA 4IKEA 4IILA 2YJ2A 4ZO4A 4L3VA 4G6ZA 3AEZA 3EODA 1AA9A 1YB6A 4B9EA 2J09A 4KODA 4IEFB 5FPKA 2V1XA 3PRJA 4A5OA 4RXUA 3L92A 4G86A 4CF4A 3OE1A 2QTFA 4LGMA 4E11A 1NW6A 4H6PA 2HSDA 3PWSA 1ZLYA 3E7PA 2ORYA 1GIAA 4KB5A 4UHEA 4UBOA 4B3SB 4MWZA 2OTCA 3KSZO 3F8SA 4YECA 4UM9B 4IXTA 4RZ2A 1L7NA 2FRDA 4LSZA 1PVDA 4YMSA 1FFDA 3IFSA 3K70B 2WIJA 3LV8A 1IWBB 4MICA 1NURA 3R3WA 4N0EA 2O5CA 1H4QA 1J9EA 4ID3A 4GP7A 3RI3A 3ZWNA 4P86A 1WG8A 4QJ5A 5K0EA 2GFQA 1KZ1A 3FMGA 4H7KA 3PJDA 2BRUA 1U8ZA 1SVWA 4BMXA 1CZHA 1Y82A 2CB9A 3DGEC 2LDBA 2HLDD 3VR2A 4NU0A 3LF2A 5K7SA 3FYDA 1YZNA 1LI4A 3E82A 5KBYA 3I39X 4LK3A 4TKVB 1Q6ZA 5DHAA 3O9ZA 4J2OA 2GXAA 5HK9A 1YZLA 5FBQB 1N2OA 4Q9LA 1V5GA 2IU6A 2YXNA 3PFNA 5C7LO 2X5NA 2PBZA 1M9NA 3HCWA 1UEXC 5SY9A 4PVCA 2HPVA 3VOTA 3OU7A 3C7CB 1VKNA 1PJSA 1MRNA 4QXOA 4KQEA 4L08A 2WJAA 1GTZA 1N6LA 3I9V1 4P7BA 4FFVA 4R0VA 3T5TA 2MSCB 1E20A 3C4JA 2I8LA 3O4HA 4HHEA 4CQMD 4RY9A 4RK0A 1C3OB 1WWKA 2WNIA 3E1ZB 4IEEA 1F2DA 1ZCAA 1IEQA 3H13A 2CLEB 1GTSA 1NDQA 3PT5A 4LWOA 4US2R 3F90A 1JB1A 2OFOA 4US0R 4H0CA 2H2FA 5AKGA 2AYYA 1F8GA 3UENA 4C9BA 1LQTA 1ORIA 1IRXA 3A7EA 1QK3A 4OLAA 4V0NA 5AVSA 1S2IA 2HYIC 5C3UA 2CXOA 2F9FA 4TX1A 5AJWA 3E9YA 4CQMA 3QU4A 2BUBA 5E95A 2H1RA 1M5TA 2XTNA 3EIXA 1L1RA 4ENRA 3DLHA 2I33A 4G25A 1NFRA 3NHRA 4CQMB 4NHEA 3ZGZA 1NJ5A 4XWAA 4I5EA 4U7JA 3VNUA 4O08A 3EGXA 4XRGA 1JS1X 4G8BA 1LBTA 3WHIA 3WWCA 5J2UF 3RVKA 3URKA 3QVOA 4Y2PA 1P8JA 5CA0F 3PYXA 5IJ0A 3K9NA 1Z6QA 4LQDA 1HT1E 4ZHQB 3UICA 3KZMA 4YX9A 4L9RA 3U4QA 1J25A 1BFDA 1ISGA 1HT3A 2PJUA 4Q4HA 3W4JA 221PA 3LW7A 4WL0A 1IN4A 1UZNA 4ZV4A 3D8BA 3P9KA 2GDZA 2WHXA 2XA9A 1M0TA 1FDWA 2PPLA 5ALVA 2CHUA 2F7SA 1U0TA 2B0CA 3QELB 1BWRA 2YY5A 4BMSA 2JFYA 3TGWA 5KVCA 4P0TA 3KKLA 4UTXA 1TUEA 1V8FA 3Q7RA 4EJ0A 1OXSC 1KJ9A 1NSFA 1K1EA 2H85A 3GUCA 3Q8WA 4R8SA 2P62A 3OZGA 1NT4A 2PL3A 3L7CA 4DQUA 2HLNA 3P9ZA 3PNKA 4KFCA 3G5LA 3QM1A 3LQKA 3L7MA 2DTEA 2HHNA 4CNBA 1I3CA 4OJQA 2H57A 2AJLI 4RK5A 1HLGA 5H80A 2PGDA 5HDQA 2ONZA 2Z9DA 4RMIA 4MVXA 4RGQA 5K0TA 2IYPA 1RZVA 3ORQA 3UB4A 1O97D 2LGJA 2GWHA 3KWJA 2YZGA 3MWKA 4QQ8A 4H7FA 1DBIA 5AHOA 1NUPA 2OV3A 3RNLA 2Q49A 2PU7A 1LPAB 2I3ZA 5B5SA 3ZHRA 4E2ZA 1PK8A 2X7XA 1GCOA 4PC6A 3PV0A 4BDSA 1NUTA 1RHQA 4XEHA 2C4WA 2GK6A 1MC8A 2GTIA 2KWIA 2WW8A 3KQVA 5DX0A 4BMPB 1JR6A 4ZAYA 1YB5A 2XECA 2NNWB 5SYAA 2F67A 5LD2C 3SP1A 4Q3AA 3KQHA 4L9AA 2FSFA 4GXTA 4MYSA 4MWBA 7AT1A 4Q1BA 3R8CA 2IYEA 1JZTA 3K24A 1UDWA 4TWBA 2B5OA 4Q9HA 4CKXA 4ESVA 4ARCA 1XDUA 2PXXA 1NOIA 3TNDA 2DEUA 2GZ1A 1YS2X 2AYXA 1ZIYA 1V45E 4KE6A 2QMZA 3O1LA 4Q48A 4QDZA 4RORA 4A16A 4D9MA 4YRNA 4NCJA 4ZEMA 2ODAA 4ZI3A 3BJMA 4Q4HB 2VF8A 4M1OA 1V5WA 3ZLBA 5JAHA 1I0IA 2DOKA 1N9KA 2VBGA 4OHCA 4R9UC 1AKMA 4CM4B 3ETLA 3O4JA 3P0IA 2PH7A 3DOJA 3LFYA 4E4RA 5KNDH 3PQ5A 3A6FA 1JPNA 4K9RA 4RTSA 3O21A 2GERA 4AICA 1JG4A 4WXRA 1P6XA 2WP8J 3CF6R 3R5KA 1Z15A 2QUAA 2PH1A 1NXXA 4PC3A 4R40A 3RV4A 2PSSA 1N2JA 2AG8A 5AW1A 1X14A 1ZJ4A 4YAJA 1OLOA 5ALRA 1NSTA 1NVXQ 2C58A 3AB3A 3KSMA 2WIBA 3HBMA 3FIJA 3PNOA 4LHSA 4FJ2A 2D00A 3K1AB 3N8GA 3P5SA 2PZEA 4WRRA 3RJZA 1AYVA 3N3AC 1KXJA 4YRBA 1DWQA 4H3SA 4CWAA 4DM7A 4ONEA 3L6CA 4Q15A 1FCJA 4WESB 3LCJA 4J0HA 2OBLA 5CA1F 3GGJA 3FMFA 4HNRA 1N2IA 1H8HA 3AUKA 3B13B 4XOUA 2ZSKA 4AVYA 7MDHA 4ESOA 2RI6A 1OA1A 3JPYA 1UC9A 1HQCA 4HZUA 3RFVA 5BW4A 4R51A 2HZBA 3K9QO 4MS1B 1CBUA 4PYQA 3SHTA 3VTZA 2PADA 1P2UA 2B78A 3KRTA 5T6BA 3HWRA 5AK6A 2ZRIA 4KBYA 4D8WA 1EAYA 1Z28A 2UVDA 2VDPB 3A9TA 4N54A 3C3BA 3BSWA 1VTKA 1AMOA 1U0JA 4M88A 4KU4A 4RQAA 1JEAA 1QHEA 2ZSHA 3ZCSA 5HZKA 5KTOA 3DE1X 4X8LA 3N59A 1BAPA 3CF0A 4RMNA 1H2XA 4L7QA 5MF6A 1VIVA 3DCJA 4WZAE 5YASA 8GPBA 2EXXA 4AURA 1QH8B 3P2JA 1PV1A 1QE3A 3QPDA 3IEMA 2Q3MA 2FQYA 3QE2A 1V95A 2VF5X 4FZRA 4ZT3A 5BVGB 1OVMA 2FEWB 1UJCA 2C4VA 3ANNA 3MERA 1HE1C 4FYXA 4QXQA 4R4JA 1P1RA 1G41A 4JLUA 1JU4A 3OOSA 3WGGA 3G8CA 4BVJA 3DW1X 1JV2B 2GBGA 3ZS8A 3JASB 2BM9A 2WJ3A 3DC2A 5LQMA 2XKBA 3FUTA 4YUXA 3LT0A 1L5YA 2YJ6A 3DLPX 4KVFA 3WISA 2J8ZA 2K7ZA 2PS3A 3EXHB 3EQ9A 3I06A 1PQYA 2AFIA 2XRYA 2EHJA 1XCMA 3LUCA 4N40A 3RC7A 3IMAA 2Y0CA 3PIDA 2PT6A 5AW8A 1J0BA 5KNCA 1XTPA 2FR0A 5ITZA 5CNJA 1KDVA 1KNXA 4A82A 1Y4SA 2ZBDA 4KTVE 3UW1A 1FVFA 1GNTA 2NZVG 1NAHA 4E4YA 5DNVA 2AKEA 4UHBA 1KEPA 1JFVA 1QHFA 4PADA 1T6BY 3BKWA 4CZWA 3SHQA 4XYEA 4AKTA 2W6IA 3HGTA 2WYVA 3I2FA 3V48A 4NBWA 2B9VA 3OE7D 2B34A 1N2XA 2Z5GA 4NDNE 2ADOA 3WZLA 1TNDA 5GJWC 1CUIA 4WA6A 3P26A 4M0PA 3VU9B 3I8XA 3T8YA 3IQXA 5FD8A 4NRDA 3WK8A 3LLMA 2V5VA 5ALTA 2V65A 3PDIB 2G5TA 3HUUA 3LUJA 3SYLA 4MM3B 2DAPA 3PNSA 4DARA 2WJYA 3EXIA 1AQYA 1SKAA 2I1VB 1YACA 5IFLA 3H5TA 2GT1A 5LA6B 5B7QA 1V9LA 5E38A 4C1NA 4QJBA 3EUFA 1X74A 3JQFC 5GIOE 1QG2A 2GZAA 5HXAA 4BMDA 1Z7EA 2Z98A 3WYNA 3QWIA 4F06A 4I5DA 1YGPA 1LD3A 5FUWA 4I4NA 2L2QA 2X4GA 4H1TA 1IK6A 4EPTA 1L8XA 2FP4A 2MYPA 1TE2A 1TL7C 1YJAA 3ESDA 3Q9SA 4J1TC 4PU0A 2J07A 4BMZA 3OZBA 1ZX1A 1ZCFA 4YHBA 3AFIA 2GPSA 4KQIA 2JGRA 4LJ9A 4CR6A 3VVBA 1A97A 1EX9A 2FWPA 4NOMA 3BK1A 1H05A 2ATXA 3ZCXA 3RS3A 3BHIA 5DYNA 2BKAA 1HE8B 2CY0A 4B7XA 5D3MA 4EHIA 3CH2X 4JDUA 1BDHA 4G81A 1QV6A 3HJBA 2NN3C 4PZPA 4YCBA 4BFXA 4OHPA 4DABA 1T2DA 4UD6A 1XAJA 3JQGB 1PL8A 4XFDA 1XJ0A 1KEUA 1UBLS 1UQUA 1Y9JA 4S12A 2JCBA 2XMDA 3RH0A 3O4FA 1QQ6A 4FYJA 3LDGA 5AT1A 1MO5A 2IBSA 2DZDA 4C2UA 1U2DA 2A0UA 3KB2A 3W3AH 3FFWA 9LDTA 3GVIA 5DTEA 5JANA 5CX4A 3KXKA 1FYFA 3T7DA 3R3YA 1CE8A 1ZUHA 3U9LA 3FPAA 3OQ6A 5CH3A 1PWYE 1G20A 4OI2A 5AOCA 4NMLA 4B8YA 2R6CA 2Y9MB 1E7YA 1OFHA 3TLBA 2NQTA 5IAOA 5LLTA 1ND5A 2QSYA 3I37X 3FNIA 2LCQA 1JDSA 1L4YA 3PQEA 3OQMA 1ZISA 5CLFA 4PINA 3O2NA 4JHLA 4PGHA 1QIDA 4QSMA 5K8LA 5DMXA 4RE5A 3T9BA 3ESQA 4DT1A 3W0LB 4YCSA 5CT4A 4F3NA 2XMBA 3AOEC 9ATCA 1VIAA 4DY4A 1GA6A 1RPNA 1A9ZA 2V7EA 5HK8A 4BN5A 3EY4A 3QI2A 5IS2A 3U37A 5CBPA 1KEEB 5ESDA 2IZ7A 5LQJA 1O97C 1ZMOA 3GT4A 1Z8NA 3QG1A 3S2IA 1U90A 5T4HA 5KQRA 3JVIA 3FD8A 4FMDF 5EUMA 4LKRA 5KTPA 3L3BA 4AS1A 1E4VA 4KLRA 5AXDA 1MP0A 4Q4JA 1MFPA 4DW8A 2IVFA 5CLIA 2FQ1A 3L7IA 4O2BA 3AR2A 1U8CB 2P90A 1I2DA 3T61A 5E2AA 2YXDA 1MVOA 3B2EA 4BOUA 1ISPA 1CHDA 2ADMA 3Q4GA 3P4XA 2PQ2A 1SUEA 3EXFA 2MYUA 1F2AA 1SKQA 3GLKA 3B6JA 3ICQB 4RMJA 1KC3A 2Y1LA 2YIDA 1HE4A 4X6JA 1F60A 2K5UA 1OTYA 2GYUA 5CIQA 1MPTA 2QN2A 4XJSA 1EWVA 2NW6A 3C6KA 3DZJA 1AB6A 1LSUA 5BNTA 1JJFA 2QRJA 1TVMA 3CMCO 1EP2B 3KJXA 4GBMA 1UJ5A 4MDEA 4CMKA 4PXAA 5TJHA 3RVQA 1E98A 1AQNA 2WZCA 2JAXA 2Q3CA 1S9DA 3ZJTA 1VBFA 1Y9AA 3MB8A 3CVVA 3ST7A 2GK3A 4BNVA 2ZWOA 1NB3A 3F8WA 1CJLA 3QXSA 2P5TB 1RQNA 2JTCA 1ZH4A 4O1MA 3SBOA 5DYIA 2QR5A 1QBGA 1D7AA 1CZOA 1HZZA 3BWKA 3HA5A 4WVLA 3K9CA 2BE9A 2GESA 2H11A 1U9YA 3HCAA 2G4CA 5FHQA 3SE0A 3MWFA 3CR3C 4HB3A 5G1PA 1VFNA 5C81A 2IOQA 2DKFA 4EGSA 1UPTA 1V11B 1EVLA 3MQ2A 4PYLA 1BSVA 1KZ6A 2IKQA 2J3IA 2AZMA 1F1BA 3JWJA 1BXGB 4K6GA 3N75A 4W5HA 4H59A 1NVTA 2W0SA 4C7MA 3J81k 1QP7A 4E6EA 1LBEA 4BO1A 1YZKA 1TIBA 3F6SA 4CT4B 4C20A 2CL0X 5CVJA 5IKXA 4UMDA 1TEXA 1I9GA 4IX1A 1TUBA 3N7AA 4L76A 4MKXA 1KS2A 4X45A 4G0UA 4I5FA 1EUYA 4D42A 3K8UA 1KNQA 2XMSA 1THEA 2G9RA 4IIEA 2JLWA 4QGGA 1E1CB 4YAKA 1ODLA 3JVEA 3M33A 4W8OA 3CW9A 4GOXA 3ZW9A 3U09A 1WTCA 4NIMA 3QYFA 3N8IA 1R12A 4GOKA 4K86A 5F7JA 4B4UA 4R3UC 1XQYA 1NLMA 1T8UA 2NYVA 1XKGA 1ZNXA 3L7YA 3BMXA 3QVUA 5JU6A 3NHKA 3ANXA 3VYWA 2Q9BA 3I34X 1B6GA 1JQBA 4GBGA 2A59A 3CXUA 2VHQA 3T7IA 3I6ZA 3JZFA 4LTMA 3K9LA 4RABA 3WNCA 1XTQA 4AXXA 3X1ZA 3TVTA 2B92A 4JX9A 3TLXA 2I03A 4NAVA 4BVLA 3WGHA 2BHRA 5IAGA 2R66A 3AO0B 5JQWA 2YMPA 4Y2QA 1KK1A 4IDNA 4JOBA 2JDIA 3OCZA 3LUAA 5CPFA 4EBBA 3F9CA 3M2TA 4YAWA 1UPXA 1I14A 1OAAA 3PWZA 3ZU6A 3LECA 1QQTA 2WQ7A 1TAUA 3AEKA 4BFUA 2UZ1B 2JAQA 1EK0A 1KEZA 1IEXA 5EY5B 3U7EB 2AUZA 3ZHYA 1T2UA 3D8TA 1AZTA 3ZY2A 5AW7A 2YVUA 4GLLA 3S99A 3WFZA 3QPAA 3I5YA 2CMKA 4NV3A 5AVOA 3WRXC 4PNEA 4JP1A 1Q0QA 3D7NA 4NMXB 5B3LA 1WP9A 1K27A 5CFLA 2B1IA 1XEWX 2JFPA 3FVQA 1VPTA 1M67A 3FYUB 1Q3KA 3MOSA 5FH9A 2GX6A 2GH1A 1B8OA 3AR5A 3DVSX 1LY1A 4DIMA 1BS2A 4MPJA 5GVSA 3QF7A 1UKFA 3W5JA 1PFKA 4PR0A 4F1KA 3LIIA 1XMVA 3ZWQA 2YHIB 2QMEA 1MVNA 1QIKA 3JYHA 1LLCA 4NJMB 2VTBA 3PJRA 3KVYA 3L5OA 4V03A 1SN7A 3QG5A 1GNVA 3CFYA 1C2YA 1W9MA 3PENA 1BJRE 1QC5A 1FDTA 5KHOC 4TMFA 3BTVA 1VPLA 2J6BA 4YRIA 3WQHA 2BC9A 3JYNA 3A1TA 2IX3A 3GOQA 2YVLA 2P9CA 1Y33E 2I1LA 2YN0A 1BE8A 2EERA 2VSYA 2VZ9A 3QKRA 4LDQA 1U11A 5A03A 5JAIA 2CV0A 3EBLA 2ONYA 2IPPB 2IUFA 3HZRA 2H7JA 1W75A 1Z2DA 3DMDA 1K68A 2I6GA 2W2NA 4JJFA 4KLBA 2Q28A 3RHTA 2XA1A 2NOAA 2PQ6A 4CLOA 5KYKA 1RRCA 4JI0B 3QTBA 1OT5A 1KQOA 4Y6RA 5ECDA 3PRKE 2PT9A 5E4JA 1XZ8A 1MO6A 3LZ6A 4B75A 2F1JA 3GN1A 2DBQA 4L74A 4IOMA 3UOAB 5A3JA 1GLOA 1XO1A 3B2NA 4TN1A 1FXUA 4DWJA 4L16A 2XCLA 3QRWA 1M34E 1GFSA 4MCHA 3TD9A 3I9FA 4R9VA 1IYZA 1NYTA 3KEFA 5AM1A 3ZHSA 3KKPA 4IFIA 1EQAA 1K7YA 2ZUVA 4EY6A 1UWCA 3BD7A 2ACKA 4W7SA 2BFCB 1E9EA 3H87A 1E8MA 1DQYA 1TMYA 2IYFA 3FYCA 4UOQA 4KAXA 3EJWA 4GZMA 1T4BA 5J9FA 4H3VA 3Q72A 2SCUB 2HDOA 3K1ZA 4Q66C 2CBZA 2YV3A 3FPGA 3A1DA 3Q40A 4YRTA 4YRJA 3W78A 1M6WA 4RPIA 3PL1A 621PA 3QSYA 1ECGA 4P5EA 3KKNA 3WYAA 5KDDA 1NQCA 1L5HB 1LSJA 2G1UA 2IYTA 2RGWA 3BMNA 3I04A 5TNXA 3ROPA 3TRIA 4CQLB 4U5QA 3MD0A 1CNFA 2BR3A 1II9A 2Z8YM 2WG0A 3M6VA 4ZXFA 3T7KA 4R8VA 4KRXA 1Q6YA 3UHJA 4G0MA 2J5KA 1YIDA 4GECA 4GRAA 4E13A 5AVVA 1WUYA 1U63A 3V6LA 3MT7A 3TPFA 3GZNB 4KLCA 1G21E 1KDZA 1G291 3ZNPA 2Q5EA 1WNTA 3VU0A 5CP8A 2BRUC 2TRSB 1AHPA 4B6PA 1K8XB 2PRYA 4JGBA 5E1BA 5C1BA 3RVSA 5KWSA 3B70A 3AJRA 1R88A 1P8AA 3F5SA 4WY5A 5BV1A 5F51A 3UF0A 3Q3VA 3QVJA 3HBNA 1SVIA 1J2TA 4GR9A 1CUJA 1KQPA 1YJ8A 5AKYA 2D54A 3D8NA 4YK7A 4XQ9A 2VZ8A 1BWPA 2D3TA 2IITA 1G9XA 2IBIA 4Y7CA 3ESYA 2V45A 4RGYA 4BB5A 1QFZA 4X1IB 1V5EA 5DM0A 4RHTA 3OCUA 4X95A 3MJEA 4OUDB 1N1EA 2YWHA 1ADFA 1MKYA 3H8BA 3AUJB 4LPSA 2BELA 4YRRA 1RQLA 1YKSA 3I09A 4JUDX 2ZTLA 4ZVPA 1U7WA 3LOUA 5LU8A 5EJAA 1BRTA 2B4TO 4TZ6A 1CRPA 1U9VA 2I66A 4JGIA 1LF0A 3IDSA 4JNCA 3LBIA 4ERNA 5JS6A 1H5UA 3SF0A 3AW9A 3U31A 4XWKA 1D3AA 4JB2A 2G0TA 5JPIA 3O8CA 4K6KA 4CDNA 1PS0A 2C5FA 3JWIA 3EGOA 2JJYA 2WWGA 3MEQA 2DWCA 4ENQA 2R6AA 3AXTA 5AI8A 4RF4A 5AVWA 1RQGA 2IZ6A 2REXB 1AKUA 3M0EA 1OFIA 6Q21A 3JZIA 3IHTA 4XYLA 3ZOKA 1EFRA 4G1VA 1YJXA 2DFLA 2IUTA 2ZI3A 5IVDA 2FKNA 3NBQA 2X0EA 1YRAA 2WAAA 3H5IA 3DNPA 4OQFA 4R2WA 4MEAA 4YRMA 3W9BA 5AI5A 2MSKA 1E0KA 1Z3CA 2E89A 3KPYA 3S70A 3MWEB 3PJGA 5EJ9A 1WCIA 4C7VA 1XLVA 3DAYA 2ORIA 3FVWA 3R6GA 4IQGA 4QZVA 2NVOA 2OBXA 4RLHA 4RH3A 1B26A 1RQ7A 1JDVA 2Z3VA 3TVDA 2IE8A 2F55A 1PR9A 4UMFA 1YZUA 3IH5A 5IDYA 4DMMA 3N0WA 1VJRA 3GL9A 1QIHA 1UZLA 4BNDB 1G5FA 4OHMA 1NF3A 2ZK7A 3U4AA 4X1IA 4FDTA 3OJEA 1NPZA 2SKEA 2WJJA 3PFGA 2X2EA 5BN5B 5K5EA 4JWKA 1I6KA 2BFNA 4M22A 2OUIA 4TS1A 3K6SB 3JRNA 2DC1A 2HADA 4AY5A 2IOFK 3EHEA 2HKIA 2PT5A 4FGWA 1J24A 1V1RB 4D0SA 2AOXA 1GYPA 3MAAC 4RPLA 1CJCA 2GLUA 4JB8A 1ZNWA 3TOXA 3NU1A 1Z75A 4L51A 4PPGA 5K0FA 2FPPB 1W36D 3EVGA 3QENA 2PN1A 1XHEA 3V34A 5JG7A 1W1UA 1T5IA 1TKAA 4P3PA 1OY1A 5P21A 2WIGA 1LPNA 2VAMA 3AM3A 3TUJC 4OX9Y 1GAWA 4GKJB 2ATOA 1P9LA 1PD1A 1PW5A 2OBFA 1ITZA 1YI0A 4DLVA 1S8OA 4QBHA 3ZHBA 3ZPXA 2HT1A 3HNOA 3AM1A 5F3RA 1UOQA 4AJIA 2I4NA 4EI2A 1CYDA 3H84A 1WVIA 4II7A 4PYKA 4BE9A 3EEQA 3OF8A 1L8LA 1E2LA 1OBHA 2VYVA 2OOKA 2R7KA 4MIKA 7MHTA 4WJLA 1XD9A 2FRXA 3SVLA 4FBLA 1U9IC 1ZNZA 2P9TA 5CW1A 1ZJWA 3BH6A 1YK8A 3ZU4A 3KSBC 1XDSA 2R1VA 3I6BA 1GTG1 4HGYA 2PVPA 3FSJX 3MWDA 1QF7A 3TQHA 2ZYGA 2OILA 5LYJA 4BO5A 2QDXA 1OKKA 3WA6A 3RKUA 5DISB 3IVRA 1HUQA 3T0IA 3W8RA 4OXRA 4NBKA 3U3OA 2DPLA 5IH7A 4J0QA 5AK3A 3IAAA 3L6EA 1H2RS 3NIWA 2ZG6A 4I7EA 4MP8A 5I7AA 1UBEA 3DDHA 3D6UA 3QWHA 5EZQA 5HBRA 3K30A 4B3XA 3I23A 3OX3A 4BQPA 4KO2S 3WL5A 4ZD6A 1AYUA 4D4MA 4MLPA 2BFBA 1J70A 4S0XA 5TT1A 1NXQA 2GQ0A 3PUVA 1ZONA 3D2CA 4AZVA 4PP2E 2AOTA 2KMLA 2D4AA 4UDOA 5B1DA 2F8LA 3KPJA 4PZ9A 1MIOB 2VC2B 1W29A 2R68A 3D54D 2LCFA 3T95A 3HXOA 2ZVJA 1AKVA 1P1JA 1T9HA 4CFSA 1E60A 4NOKA 1BE6A 1GZUA 2ZRCA 1XB2A 4E5YA 4ETWA 3GBPA 3HCBA 1XTJA 2OEPA 2XE8A 1NIJA 2WVHA 3EZFA 4EVQA 1TCVA 2P2YA 4FUTA 4RF0A 2FPIB 1QF9A 1FMTA 4EHLA 3BE6A 4B6GA 2XUFA 4HPXB 4OSOA 4HUQB 3O3MB 1JXMA 4ZC8A 3FCEA 5K4AA 1AXGA 3BDIA 3K8YA 3LSTA 5CK4A 3UXEA 3H2BA 2UVPA 2E9SA 1NMEA 2VH5R 3P2OA 2I4LA 4MQFA 4YI5A 3L0OA 2O7NA 4DXAA 4Z9XA 3L49A 3U3MA 1PGNA 2ZBEA 1DZIA 5JWHA 2Q0HA 4OY3A 1CV2A 4FGZA 2FDCA 3IYLW 3QPWA 4RDCA 3IHKA 3GG9A 1X1CA 4F9GA 4GC5A 3DL7A 1E61A 1E3SA 5DIFA 1AGNA 1M8GA 3ZD9A 4NATA 1KKUA 4ZZ2A 3QELA 1U1CA 2C2HA 2JARA 1U28A 3COVA 5B37A 5EHNA 3EIFA 5HKKA 5K9ZA 3TVYA 1HFWA 1TD9A 4LHXA 5K16A 1Y6ZA 4MKIA 3RIMA 2AN4A 1CUFA 4TSFA 4O2RA 3AQ4A 5F1OA 2QYSA 3IJRA 2AK2A 5EPUA 4MUHA 4F1JA 6YASA 5BORA 3D6VA 4DSUA 2P0EA 5H59A 1XTUA 1X8JA 3WLRA 3AMVA 4BNGA 4QFDA 3B1VA 4XJXA 3JQAB 4BDTA 5KSWB 3Q1KA 3PPWA 2EDCA 4TYMA 4CMIB 4N65A 4JYBA 3UJ3X 2RIPA 3ZX4A 1I01A 3ES9A 1GPMA 5DGHA 3VPHA 2DQZA 2X1MA 4UFPA 2G0NA 1GZSA 3GXOA 3OT4A 4CDDB 5ESRA 4KUEA 1W0JA 4YCDA 3HVJA 1DDOA 2HU8A 2O8BA 2PCJA 2WF7A 4R1QA 3STYA 4BNYA 4EY5A 2LR0A 4F4CA 5KIAA 2EFEB 4HFRA 2UUCB 3VPXA 4XGKA 1A4IA 4LHEA 5CTAA 2E49A 1ZZGA 4JLOA 4I08A 4IINA 2XXAA 1STFE 2WQZA 2QSJA 4FDVA 4PPQA 1W8DA 4UVIA 4I2NA 4OO3A 3U9TA 3PEVA 4B4DA 4IPTA 4F85A 1U2GA 4QTTB 5CURA 1NGSA 1PGJA 1WO8A 2B21A 3NC4A 4LPKA 1OIXA 3WGMA 1WW8A 4J0JA 2Y99A 3R76A 1U8FO 5NLLA 1SNYA 1J1UA 1MEOA 4LXQA 1AKYA 2J4CA 1FRQA 2VRNA 3FLMA 4HNVA 4TN5A 3THXA 3G02A 1GQQA 1YZYA 2Q3EA 3HKEB 1RHKA 3JQ7B 4CL0A 1YJQA 3G9XA 5KNCD 3ET4A 1R6XA 1M33A 3EPHA 2PKEA 3PGJA 4LGCA 3DVQX 2XUHA 3B7GA 3EK2A 4L6CA 4BBZA 3NQ41 1UUFA 2HX1A 1BEUB 2OHFA 4JLDA 3WG9A 5A3QA 1EGVB 3K92A 4IDAA 5FQNA 2X5OA 5HDBB 5JT1A 1P39A 3GEDA 3VYUB 1HA3A 4OQQA 4EY8A 4UFOA 2G9VA 4FD2A 2PGIA 2HEIA 4S1WA 4U2CA 3PNYA 1ESCA 2B8EA 3TXAA 1U9CA 5D84A 4JT4A 2QAGA 3WGZA 3JAMA 3DP9A 5EPOA 2QZZA 3CO0S 2QRNA 4IX9A 3DMHA 1CUYA 1IOLA 1TCCA 3H4TA 4HDKA 3O92A 4PLYA 5DXAA 3SCZA 4DS3A 4EKNB 5DN6D 1TKCA 3JASA 2YVQA 4F93B 5TPZD 3KZKA 3R0VA 5BNWA 1KK0A 4C4ZA 1I24A 3MOGA 4WBNA 2WTBA 3BXOA 3UVEA 4XDGA 3X3HA 3RAGA 3BC3A 4JK3A 4LF7B 1KFJB 1H6BA 1P0PA 3P71T 1D8AA 3NNSA 1CUDA 2AI3A 3QBTA 5GGXA 3OICA 5TXGA 4F4UA 3VMMA 2BHNA 4F56A 1X9YA 1GSAA 4C3UA 1DG3A 1VHTA 3A36A 3KD2A 1M1NA 1PRYA 3TW0A 1AA6A 2ZZNA 3GDOA 4OCZA 2XMQA 3PXXA 3G88A 4KXLA 1YR3A 1Z6AA 4M98A 1NE2A 3MELA 5ULLA 1E3TA 2PSHA 3LH5A 4XX1A 4JP5A 2CLCX 3EF0A 4FOSA 3WQSB 4M0FA 1RE0A 2G63A 4YRCA 2PNJA 4XWOA 4DA0A 2I7DA 2PL9A 2WYHA 3BICA 1NE7A 3TRKA 1M66A 2IZ1A 3VH1A 1NJ1A 2DJ5A 3VU9A 3QVTA 5L6LB 3RBVA 1QP0A 3KPWA 4IIFA 1V4BA 1R8YA 1Y6JA 3AL3A 4HLUA 4LCJA 1IFXA 2ACEA 3N1UA 1DKPA 4MW9A 2JZNA 3N70A 2NZJA 2OWDA 3IKJA 1EM8A 3UMBA 1CVRA 1FTYA 4ZZ3A 4FFLA 2OC9A 2NU7A 4PSUA 4WFQA 4ZPJA 2V7XA 3SIPA 1CVLA 1WD5A 3BREA 3OE5A 3PC8C 3DE6X 3WLEA 4E22A 3ADBA 1JB9A 4CKWB 5L3QA 1VKRA 4I0WB 4K9SA 4M1QA 1KVQA 3I9MA 2VCYA 4Q3NA 1A7UA 4YYRA 1P4GA 4BX8A 1NWHA 3W7BA 1EJ6A 2QTCA 3AUSA 2EFJA 5JZVA 3NBXX 2FZKA 2XNDD 3EVTA 3TH5A 4B0PA 5C46F 4K6OA 4KJZA 2AOWA 3QU2A 3EUWA 4AT1A 2BMFA 2R3SA 2ZAIA 2JLQA 1O6GA 1PK9A 1B00A 4B3BA 3OHPA 4B6QA 3DE3X 3CVWA 3TZ6A 2VA9A 3N2GB 3GO4A 1GR0A 1HF3A 4X3OA 5DI3A 5JFOA 2NSYA 3NVDA 4TTPA 2RHLA 4TPKA 2BI8A 3LOQA 2HC9A 1QO0A 1YMQA 4A8TA 4LGYA 2F48A 1UC5B 2R6R1 1O94A 3EPRA 4ND1A 4QRHA 3G9QA 4A36A 1V1MA 4QHSA 3UJAA 4HQLA 2RCYA 3PKIA 5K3FB 3KHUA 3NRJA 1VRVA 2A5JA 1U9JA 2W2TA 1IVSA 2X7JA 4B71A 2C5SA 3NJ4A 2PEZA 3IRVA 5DN6A 2PH3A 3B8HA 1LLFA 3EZ2A 1DHTA 4BNLA 4MI3A 3SR3A 1CZRA 3TGPA 3B1YA 1E32A 4EW6A 2MMCA 1Q21A 5HQJA 4RA6A 2OCGA 2G7ZA 1EWKA 1UOPA 3CNEA 5BWOA 4LOIA 2BCGY 3MINB 4KXNA 5DWQA 2FT2A 1JMYA 4ZVOA 1ZN7A 3FTQA 1OXKB 2PGAA 3CGGA 4J16A 1SCJA 3BXEA 3VR3D 2HF9A 1DFIA 1VRCA 2V6JA 2QJFA 3UQYS 2HI0A 1L7RA 1ZD4A 2GPTA 2WUWE 2YJ5A 2X8BA 4WOKA 1PYDA 2HCBA 2VDUE 2EF0A 3N05A 4D9BA 1BKSB 5BRAA 3T7AA 4R69A 3H5AA 4RF5A 2I99A 3HN6A 3IEKA 3HCPA 5G1OA 4W5TA 3ZDCA 3I1IA 1SULA 4O2BB 3MTVA 3U5ZB 3M6WA 3UK1A 2WM2A 3E3MA 3EGCA 3UKJA 3I6YA 4F3KA 4ZQBA 3PRHA 3U48A 1XTTA 2AE1A 2OMEA 1G4UR 4YIKA 1RM3A 3H2SA 5LWHA 3WDMA 3IOMA 2J0QA 3BCNA 1XXHB 2BEWA 2B1QA 4B4KA 5CFQA 4L9WA 1Y5LA 2RD2A 1U0FA 4XFKA 3TI9A 1Y5IA 1KMMA 3NI2A 2VLIA 3CRNA 3GGPA 3O75A 3AI8A 3DUWA 4DV4B 3AH8A 3I8OA 1XX6A 2QJWA 4G65A 2G09A 5JASA 3ISTA 3H1TA 4ISCA 1D1QA 3WBFA 4EGCB 5C53B 2W4QA 5T67A 4QYIB 3KQPA 2Q5QA 2BTEA 1Y8AA 3EWSA 1PSZA 1X87A 2BEJA 2NNLD 3N2EA 3IPCA 1GZVA 5LXTB 1X1DA 4BO9A 2IT1A 2QP4A 2H2AA 2YWDA 4HTFA 4RLFA 3UFXB 2Q3LA 4ZQEA 4GKAA 5H8WA 1PUJA 3OKCA 3I0ZA 3HY4A 1G5PA 1LCIA 2FMHA 4MMYB 4NARA 4TMZA 5AQEA 1H4SA 2I6XA 5T8KC 2Q5IA 4KQ9A 2COKA 3G2NA 4MHOA 1I30A 1CY6A 4URUR 2P1RA 5K6RA 4ARUA 3SHFA 2ARYA 3NV9A 6PADA 2OQRA 3AEKB 3RRNA 4ZYLA 1I9CA 4KVZA 5AIBA 2UYCA 1C4OA 2ZT7A 3HEAA 3R3VA 3EVAA 5GZ6A 2WWRA 3ANYB 4D9IA 1TA0A 4I9NA 3SIRA 5HWSA 1AIPA 5IUKC 2H4HA 4XZXA 4I50A 2YRFA 2QROA 1YVEI 2H4JA 2PFGA 4QTUB 4ZU1X 4LBVA 1UQTA 4FHDA 4RZUA 3S1LA 5IABA 4ZV7A 3OFND 4N8EA 3EDYA 3QLTA 2BTOA 3TYXA 2EYUA 4NL4H 4YP0A 3AFGA 3L43A 4D3SA 2GEFA 4CGZA 5KU7A 1Z2CA 3HXKA 3T06B 2FZCA 1QQ7A 5CD9A 3N6XA 2VR1A 4LJ4A 4C89A 1Y4DE 1EUCB 2MTBA 2R65A 4YPOA 3W3ZB 4ZGWA 2C7RA 5C7YA 3SGLA 1TI7A 4N5NA 2HGZA 3H2GA 1Q83A 2D74A 4Y2HA 2BKVA 5F98A 1D6NA 4DQDA 1X19A 4BKMA 5A6VA 4NV1A 2R4UA 2CT8A 4X8HA 4MVJF 1WHSA 4WCVA 5FNZA 3UH1A 2BFDA 1TYEB 4EUSA 3USVA 1WMSA 2J9GA 1T5SA 3HKCB 1QB7A 1PR5A 4L3OA 3DTTA 3TW8B 5LC1A 2ZFUA 3QKRB 4E88A 4P6EA 2M9MA 3K6JA 4GMHA 3ITKA 3E5RA 4Y2XA 1Z73A 1HNWB 4MKRA 1SXQA 4R1PA 1SXJC 1W36C 2RKBA 5KOYA 4TMKA 4ACAA 5HHTA 4U6QA 3ZIDA 3E9EA 3VAYA 1PK7A 1YZGA 2O5VA 1Z6GA 4PW0A 5JMOA 4NZ9A 5EP3A 1SHKA 1KI2A 4YQZA 2VK1A 5KHLB 4GYKA 3PNLA 4YVAA 3QW4B 4RY2A 4RHCA 4RADA 4YIHA 1RC1A 2FSVC 2X9GA 3FAKA 4RSHA 4UQPA 4BOYA 1CB0A 2Y0PA 3BK7A 2Q6LA 3IBFA 3HD3A 3PR2B 2WABA 5BN4A 1UBTS 4AKSA 5EXEA 3IP7A 3GNSA 2O2JA 5L6MB 4NH4A 2H3EA 1NN5A 3D3WB 5EIBC 1TUGA 3RAEC 1RPJA 3A1NA 2AOUB 3ABRB 1YQUA 4QQNA 4UMEA 5TQ2A 3ROXA 1GSIA 5L4SA 1GTMA 1Q0UA 1N6PA 3RVPA 2DWUA 4ZHQF 2BLLA 4ND8A 1C8BA 3EPLA 4QAQA 1ZBQA 2WI8A 2Q0SA 4WT7A 3ROGA 5DGXA 3UJPA 5G41A 1U5IA 2K4MA 1AX9A 4AIIA 1EQUA 2YIMA 2PLAA 3B38A 4JCCA 2CJYA 4TV9B 3I2KA 1CVIA 2ILTA 4J4HA 4L5BA 2AN3A 2WYWA 3D0KA 3DBOB 3H0CA 3IMGA 3NTRA 2A14A 5FI5A 3WLNA 4EGJA 5IM4F 3R5XA 5LZ8A 2VOEA 4YACA 1XRMA 3OZ7A 2JATA 4WNIA 5EWJB 4K2AA 2FMKA 1BQ4A 1IXKA 2IGTA 4G54A 3PTLA 2LXNA 1BCRA 3G2JA 1YIOA 5E4TA 3REQA 5JVDA 4R8MA 4ZYTA 1RPTA 1XLWA 2Q6IA 3OLVA 3C1AA 4B48A 5REQA 1U0NA 2H54A 2XGOA 4TT3A 4E5UA 2AC4A 2GCNA 3C4VA 1CY4A 3UFBA 3MJTA 3GP8A 4UVEA 3DC7A 2OM2A 1A8PA 3GH1A 1GNQA 3CRZA 2O6XA 2NZWA 2VDOB 3QE0A 2BTWA 1KQNA 3A8TA 1GVHA 4ES6A 2V6GA 2CFSA 2FMUA 2V6MA 2XNDA 1Y34E 3CWQA 3FCAA 3OKAA 1G21A 4R1LA 4RA9B 4AMBA 2X0FA 1SZJG 3BOWA 2GASA 3KIPA 1E3MA 1T9GS 4LRTB 3ZYCA 3PHJA 2FEMA 2J1LA 3NEPX 1E1RA 1BYUA 3AERB 3OEHD 2CDRA 4C6SA 5IT9A 1PP4A 4EI8A 3D8UA 4XDZA 3RLIA 1XFAA 3UY4A 3V3KA 1PR0A 4CKYA 4H9GA 1C4KA 2C61A 4EYEA 5CT8A 1CLUA 4LFAB 3S29A 3GVPA 5EKXA 3D7LA 4FFRA 2P6MA 3L7JA 3LGXA 1JQ3A 3R9XA 1G9SA 4J4TA 3HJNA 4MPTA 1CIJA 1D0IA 1CKEA 3AETA 1ZRSA 4KBGA 4ZJYA 3U3XA 4TTQA 5BO5A 4B80A 4B3FX 1SQ6A 2PS1A 2DTDA 1DJLA 1HTBA 1RHMA 3VPDA 1DDGA 2VUUA 2JJ2D 4BBJA 1DFGA 2UKDA 3UKOA 2P3QA 1SCNE 2W2QA 4UZEA 5LCXA 3LHKA 4LNHA 1KZHA 3HU1A 4ER3A 3U61B 4P4UA 3QXHA 1ME4A 1ZJYA 5CB0A 3V1UA 2DY0A 3IDQA 2PUEA 3ZQUA 1Z9BA 1MHTA 2DGDA 1XMXA 2YMQA 5KYYB 1A0OA 1KPHA 4IH4A 3LMKA 3SKYA 1E2EA 1FUEA 2ZETA 3MRVA 4M37A 5DTQA 4D9FA 3H3FA 4Q7KA 1RCTE 2HDHA 4OSEA 5CA0B 3K31A 4ZANA 1GG8A 1MJFA 1G3QA 3ELUA 3F73A 1JQPA 3O91A 1QHGA 5BWLA 2COEA 4MGEA 4OATA 2AIRA 4G1CA 5IJXA 4IBOA 1H2WA 4D5GA 4M8IA 4R1SA 3OA2A 4QVGA 2QXYA 4BRSA 5KTYA 2J4FA 2NQ8A 5DM2A 4BVHA 3NIFB 5KTNA 4AJ9A 1TT5A 1MNQA 3IXLA 4IJQA 4ITUA 5CYGA 3LC7O 4A92A 3B3GA 2QVZX 4RSGA 3EIQA 2O3SA 3FYTA 3PDJA 5FI3A 5JAOA 3FOEC 2OZKA 4YRQA 2R97A 3WLTA 3CRMA 4KQKA 2WU8A 3ZHZA 1K8ZB 3W5CA 1BYIA 1FRVA 4F1WA 3FNBA 4KQ2A 2R7MA 4R1TA 4EY7A 1VPDA 3E1GA 1BY8A 2P9YA 3AXSA 4KN9S 5B2EA 1DQRA 3T41A 4WBSA 3A9RA 4ZVRA 2XGGA 3FJYA 4E5SA 2PRSA 2RAFA 1CULC 2DRIA 1FP6A 3RWOA 4QDXA 3ZU2A 3OUUA 1Y1QA 5D5HA 2J3JA 2C4MA 2JASA 1KO1A 3JARA 2VXCA 5IN5A 3S8EA 3K53A 3DXYA 1STOA 4MRVA 4N7RA 1U0SY 2FLKA 2BDTA 2O2YA 3EC7A 3ND7A 5L7YA 3PZRA 3P9YA 3UIEA 3V4SA 1IULA 1YQXA 1X0XA 1MB3A 3I73A 3BB1A 4ER0A 4BNHA 3GFOA 1D4FA 1M54A 4LX0A 2I67A 3NBMA 3RCBA 3ZOZA 3LZCA 1B0ZA 1ECBA 1RIFA 2CUTA 4L8LA 2X0DA 5C35A 3KHKA 2AKYA 3IVAA 4HYYA 5KVAA 5LD2B 5D3ZA 3LD9A 1A50B 4WY8A 1ZDMA 5IH3A 5B4VA 5BNZA 3PWTA 4BIMA 2W37A 3IAUA 4JU8A 2V74B 4HNGA 2DC7A 3L18A 1R8QA 1ZIPA 4OQEA 3A6HA 5KI6A 1BOFA 2AOTB 1BDJA 3PXEA 2A5GA 4MYHA 3LT5A 5DSZA 5CB8A 4Z4QA 4JYZA 3KYBA 5D3QA 2GCEA 4US1R 1UBFA 1P4JA 4B87A 1A8QA 2UV8A 3IDAA 4Z4GA 2H2DA 4PYJA 1Q15A 3HGMA 1I36A 3MLAA 1P2SA 3NATA 3GA0A 3NHZA 3MLEA 3IR6A 2GILA 4OK5A 3WLJA 3ZKWA 1N36B 1QTQA 5T57A 4P3OA 3VZBA 1G38A 3TZKA 1S1MA 3ZK8A 2QUIA 1CDDA 2JFWA 4LZLA 4G07A 1S8NA 2ONCA 2LIPA 2O48X 2E7ZA 4ZICA 1NDHA 1FQJA 2I29A 3FWKA 2EKQA 2XLBA 2O2HA 4J0DA 4WOBA 5DBEX 2P2DA 1LGYA 3PUYA 3D6JA 4A2WA 3TTXA 1CEQA 1ZUNB 3UTCA 4PAQA 2CJXA 2FOIA 1HI9A 1MS6A 4BQNA 4KRGA 3B1WA 1OMOA 1P5RA 3MYYA 5ITWA 4UJ5A 2ZYUX 1BD3A 5CYFA 5GM1A 4NTZA 3TM5A 4IMIB 5JQGF 3DNMA 1QHXA 3A6ZA 2V5AA 3AESA 4YYEA 3T1HB 1SHLA 4N0MA 1X6VA 1ZK0A 3L4JA 2DJFB 3VDRA 2YIVX 3V1LA 3VOBA 2OHOA 2JAWA 1NZFA 4HVCA 1HK7A 2V7WA 2AJ8A 2UZAA 5I3ZA 3EZYA 4ALLA 1EGHA 1X94A 3IV7A 3FKJA 4OLBA 1DUVG 2DQ4A 3ADCA 5AOBA 1D2NA 1HMPA 5IG2A 3HB9A 3FKSD 4CZ2A 4C05A 4GVPA 4I8XA 2HK8A 2J85A 3X1KA 1W581 1FMCA 1YB1A 2J46A 2QRZA 4NR0A 4QO7A 4WE3A 4ZALA 1QAMA 2J33A 3DONA 1XDZA 1E6UA 3Q12A 1MXHA 1PJTA 2XDQB 2WWFA 3WLQA 2JHFA 3E3OA 2YH2A 3ONFA 4QUKA 4TYQA 3LUGA 5HF8A 2JJ2A 4YCJA 1KA9H 2XVMA 2QY6A 2XT6A 3DDSA 3LXRA 1G8SA 1QANA 3A0UA 1Z17A 1J8YF 1P75A 3LKVA 4I55F 4NJEA 4QU8A 5IM5A 5J2TF 1N0VC 1Z5WA 2VT2A 3JYOA 5I45A 2F43B 2A9RA 1G7TA 3SEZA 3EG9B 5A4AA 4G5XA 2FR1A 3OECA 5T3YA 1WR8A 4D8YA 2P79A 3A1WA 5EYPA 2JQGR 2VTVA 5AKIA 1VQ1A 3IALA 1HLFA 5CK5A 2DR2A 3AUYA 3ER8A 1P74A 1YK0A 1EFDN 5LFAA 1A9TA 2D1TA 2HJVA 1L4NA 5F1KA 8MHTA 1JIIA 1WMFA 3K0CC 1OREA 4TMWA 3I62A 2DQYA 4OM7A 2GHTA 5EJ6A 4ROSA 5DV9A 3RTAA 3IQZA 4CM5A 5FV7A 4D2IA 5LNK1 2Y9PB 3EGWA 3I9KA 4H7IA 3WXBA 3I5AA 2HCFA 4ILEA 2J3KA 4P80A 4HEHA 4RIGA 1X39A 1H22A 1TT7A 4IOLA 3IBYA 3VR3A 4D57A 2EZTA 3OHMA 3MG9A 3UPTA 1D6SA 1E99A 5ILOA 3DVAA 1ZUD1 1X1AA 3JTMA 1AGXA 2FFHA 4MJ3A 4DBLC 1H69A 2I1WA 1V3TA 5BP7A 1TC2A 5FOWA 3U7GA 3CEHA 4DJDC 4N8DA 3EXIB 4DEYA 4MAMA 1DV1A 4BX9A 5LP6A 4HQRA 2X0JA 1II0A 1KFUL 1FDIA 1X7DA 1L5SA 3NDRA 3NT4A 4FNOA 2ID8A 4ND3A 2KBFA 4GW3A 4Y6LA 1X9HA 4AJOA 1FS4A 1F8YA 4TUYB 4HN9A 4MKHA 1J5EB 1RWOA 4OYHA 3LLCA 2GBIA 4UQOA 4YLEA 2VWQA 1GDHA 4NJEB 5DH9A 5A7GA 2FW9A 2R5WA 2Y68A 4PNZA 2ZRFA 4UUAA 3CLTC 1W0KD 2AGAA 5EIEA 1CUHA 4I9HA 2RJ3A 3QEJA 1IBMB 2UYYA 3AY0A 2VG8A 2JLSA 1EVKA 1QO0D 3HWSA 3V8EA 4CKBA 2EW1A 4XLLA 5CW2A 3ZDQA 2JD2A 1W94A 2PWBA 3HV0A 3L07A 2ZUSA 3ZLJA 1Y37A 3S0JA 4P98A 1OGIA 3DULA 3QOFA 1TYZA 4LC9A 5IBQA 4Z54A 4HG2A 4KG7A 3OU2A 4PLVA 2YJZA 1QYIA 3A1SA 3SYKA 3ZXXA 1MHPA 3ROTA 4AF7A 4I36A 3FVVA 4OUKX 4M1EA 1VECA 2ATIA 2JH8A 5DBFA 2P0YA 3AY7A 4FQ8A 2H31A 4O4IA 3ZN2A 3LQQA 2X2OA 5KTKA 1UDXA 2YYAA 4ER7A 1US8A 1BGWA 1VDMA 2GEDA 3BBPA 3VR4D 3M9WA 5CNKA 5DT9A 2ZWIA 3U7QB 3H8VA 2QRVA 3PQ4A 2G5PA 1N4DA 1FP4B 2TECE 1MAVA 4XJVA 2PNSA 1KP2A 2SKDA 1QQAA 3WLSA 1C7JA 5T4EA 2OCBA 4GRDA 3R7FA 4WCDA 5ALZA 2FP3A 4TZKA 1TYBE 1YBHA 2JFHA 2HAEA 2XLCA 5BMVA 4IO0A 2C3OA 4J6FA 3K5WA 4M0CA 5ADWA 4PSKA 4AG3A 3GG2A 1U5BB 4MWTA 2ZPAA 3OPVA 3MHPA 4QWWA 1KEVA 1YQQA 1W5AA 4AUEA 4CV2A 3CT6A 1C5KA 3UYKA 4Z49A 1F1JA 3PFHA 1SZCA 4KXVA 5KVQA 2E87A 5E6UB 1C0LA 4PC2A 4HSEA 2CVPA 4PG4A 1ECFA 3BPFA 3B3AA 4WCFB 1ULZA 1IPFA 4FZ3A 1JG3A 1S0UA 1O5IA 4GU5A 3OVZA 3GMDA 3B7PA 4CDRA 5CEEA 2XBMA 2YMMA 4IYJA 2VRWA 3O95A 3AVQA 3WFIA 1TAQA 3TSZA 3ELBA 4LYYA 3R24A 3ZXSA 2WFMA 1ZU4A 4JEMA 2C0CA 1OH5A 2KQUA 2NYUA 2OVBA 5KNCH 3RPEA 1IB0A 1QWSA 1AUOA 2H4XA 4Y2SA 2GD0A 4MCAA 1L7VC 2QX4A 2QTZA 4PBRA 5K3AA 3UAVA 1WQ3A 4OELA 4BMNA 1A9QA 1JLLB 2FUG1 3JQ9A 3PTZA 2OXIA 1LTHR 3PFIA 4G4GA 2I78A 3VC2A 2DM6A 2H1HA 1RAHA 3GLHA 1YDGA 4B47A 5AMXA 4DLTA 5KSOA 5KHAA 2I91A 3DNFA 1AYWA 3KYDA 4D9HA 4D8EA 4B2LA 2HF7A 1FP1D 1L0BA 1XZCA 3EVBA 3PEFA 3ABOB 3NVMB 1EFCA 2H4YA 4B4VA 4RD2A 4Q37A 5I7HA 1J1IA 1EDZA 2E4VA 5JCJD 3CVXA 1PVJA 2JBHA 3MT9A 3ZWXA 1KJIA 3AVOA 4Z53A 1JQJC 4OEMA 3AGQA 4PEVA 4I81A 1WE2A 3F46A 3HRHA 2CV2A 4P35A 3QVXA 4QPDA 4N0PA 3U4CA 1ENPA 4L95C 1SU6A 1QLJA 2JGNA 2KM1A 4CKCB 1NM5A 2CXNA 1PVVA 4UU8A 2JCYA 2X41A 2AVDA 4DC0A 3WXGA 4QYWA 2FN3A 3IHLA 1O9GA 1U2TA 1F4VA 1GYRA 2EVWX 3B78A 3F96A 4NQZA 4UNIA 1U9WA 2B5VA 1E2QA 3P9PA 1SZPA 3L1JA 1KSGA 1VB3A 4AWAA 4QELA 3FFAA 3R7AA 2XRMA 3DD5A 4KMRA 1LX6A 3D4BA 1R0WA 3PD0A 2C9OA 3U13A 4N6NA 3WY9A 2J7PD 5B7NA 1N0UA 4CJXA 4MVJA 3SE7A 5AM4A 3UPDA 2OBMA 3MYRA 4LXUA 3RYCB 4DUZB 4TYWA 5JCOC 1PVOA 3B1JA 2G88A 4H77A 3BGIA 1FFYA 1QK5A 3M49A 5BT8A 3CX8A 4NHOA 5TT0A 2WICA 3W5SA 4V0KA 3SZGA 3WYEA 2VATA 1ISRA 1NVWQ 1OV6A 5DT2A 4L8FA 4UHDA 1V1MB 2FKAA 3M99A 2BCJQ 4RANA 1ZESA 1GQFA 3WYFA 1YS1X 2C7PA 3HN2A 5GPBA 3B36A 3TNFA 3ZE8A 2HQSA 4IL5A 4PFJA 1OFUA 3BJRA 1XZGA 4PO3X 4WK6A 2PKWA 2ZJYA 3TQFA 1LRLA 3PVZA 1KO8A 1NYQA 1SOVA 2QE7D 3L0CA 5I9IA 4WLEA 3E9DA 5LP6B 3M6LA 1CY7A 3REOA 4C5AA 3A4YA 4V0ME 2D2IA 2FWBA 4GZ3A 1XA4A 3S1AB 3VC1A 3PC2A 5DYYA 2RHMA 1R3DA 4XQCA 4E51A 1A1SA 3REFA 5LP6F 2JRCA 3D1VA 5KQGA 1E3EA 3H4VA 4LI3X 1VMIA 1KAEA 2C2XA 3DLIA 1QDEA 3O73A 3TAUA 3IIJA 1QYDA 2RGUA 1II8A 4HGZA 2X8JB 2PUGA 1RQPA 2N42A 3NHMA 5A3SA 3LLSA 3JSXA 2X8JA 1K9VF 2B99A 1P44A 4DG8A 2DFKB 4W4TA 3A6GA 4V0LA 3EIUA 4EFMA 1Y89A 1W2GA 2REQB 1BXGA 3KKOA 4X5OA 4JR1A 3WLLA 3RSLA 2FZGA 5K0JA 1TF5A 3RRYA 1U1FA 1LPOA 3ASYA 3GAZA 2Y1KA 1DPFA 3W6NA 4AI6A 5DW0A 1OE0A 3A4NA 4WEOA 4DYHA 4RGBA 5EIBD 2WG2A 3WIEA 2GXQA 5BY2A 3ETCA 2GXSA 1HYHA 4N82A 3M89A 1XZNA 3DWGA 5ALNA 3SZUA 2EARA 4J1QA 4YP7A 3NXSA 4X63A 4HNTA 3D4NA 1U8EA 1OHHD 3AF5A 4QECA 1UADA 1JIQA 2G40A 3EVCA 2QQ0A 1LDMA 3HCOA 1D07A 1X0VA 2B20A 3CRQA 2WINI 5ECWA 2QNRA 5A3VA 3ITDA 2ZJFA 4TVKA 5F7OA 3AHFA 2BFDB 5LQUA 3R3ZA 4FTWA 5FWNA 4RTRA 3HPQA 1C1DA 2VJBA 2VSQA 3PC4A 4HTFB 3UJNA 1PV2A 2Q07A 2WVAA 3PHGA 4MSUA 2JKZA 5THKA 3ZIUA 1F4PA 3K0BA 3BY4A 1ZOLA 3E9NA 3GVCA 3GEBA 5F2NA 5DLDA 2C7QA 3NPMA 3FOBA 1EHCA 4IDHA 4IQ4A 3UJ7A 4D79A 3GLGB 2C20A 2F7DA 2VLBA 3K73O 4S1VA 2CSUA 3L1UA 3DLCA 5J2TA 1PEDA 3BAZA 4WN3A 3RRZA 2DY1A 2IYZA 1OKKD 1H3FA 3F67A 1ULUA 2VZEA 4I1IA 3MHSA 3SJAA 2WBFX 4X8OA 2PMFA 2HN9A 4YASA 4FJ0A 2ZULA 1K97A 4U8GA 2XNCA 2REQA 1COWD 4ZEVA 1VGRA 3P9CA 5JE8A 4CMGA 2DCBA 5E1OA 4JA0A 1TIPA 2PK3A 3BHNA 3Q15C 2YY7A 3SNKA 1PIPA 2Z95A 4GSYA 1HQDA 5F1YA 4EK9A 4F45A 2CD7A 4X97A 4QJIA 4GOLD 2P1DA 3PLNA 1U7UA 3EVNA 4NE7A 2HD5A 5HF5A 1OT3A 5G02A 5FRDA 4M7RA 1GT6A 1WX1A 1LU9A 5G3YA 4H18A 1XF1A 3LCUA 3VH3A 4V2UA 4YT5A 5IZ4A 2R6DA 4FE4A 4ZO6A 2A6PA 2HBZA 3CLHA 4DV5B 3HC7A 1GAXA 5FI1B 4H17A