4ZZ3A

Human gar transformylase in complex with gar and pemetrexed
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trifunctional purine biosynthetic protein adenosine-3
publication title 6-Substituted Pyrrolo[2,3-d]pyrimidine Thienoyl Regioisomers as Targeted Antifolates for Folate Receptor alpha and the Proton-Coupled Folate Transporter in Human Tumors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 58
structure length 200
sequence length 200
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4zz3A00
4IQFA 3TQQA 1RC1A 3DA8A 3AV3A 3O1LA 4QPCA 4ZYUA 1ZLYA 4YFYA 5J9FA 3LOUA 1C3EA 2CFIA 3DCJA 4EW2A 1YRWA 3AUFA 4QPDA 1RBYA 1FMTA 4S1NA 4DS3A 4TS4A 1MENA 3GARA 4ZYYA 1CDDA 1CDEA 3KCQA 4PZUA 3R8XA 4ZYZA 4ZZ3A 1GARA 4Q12A 4EW1A 4EW3A 4ZZ0A 2YWRA 1RBMA 1MEJA 2FMTA 3OBIA 1RBZA 3W7BA 3TQRA 4ZYTA 2BLNA 1C2TA 3N0VA 3NRBA 4ZYWA 1ZGHA 1ZLXA 4TT8A 4ZYVA 2BW0A 5J63A 1JKXA 1NJSA 3P9XA 4TTSA 1S3IA 3Q0IA 1GRCA 4YFVA 1RBQA 4ZZ2A 4R8VA 4NV1A 5CJJA 4ZZ1A 1MEOA 4ZYXA 2GARA 1RC0A
chains in the Genus database with same CATH superfamily
2BD0A 5KYUB 4PS0A 2WDZA 3JPWA 5IC6A 1NW6A 1BD3A 3F9IA 4MLZA 1NVFA 2VWQA 1ZY2A 4JLNA 4QSMA 3UY4A 4X6UA 3DE7X 2WHEA 3CC8A 1KF0A 3KLPX 4JJ6A 5FI0B 3I4LA 4JEIA 5EKUA 2JLSA 3BXHA 1CY1A 1KFEB 1CY7A 5HTOA 1Q7TA 3MBOA 3BWBA 1MH1A 3BQMB 4KYTA 1RWPA 2ZJZA 5FORA 1XU4A 2ZZMA 2CLEB 4I50A 4D3YA 1ISGA 1YBVA 4UFPA 3H6HA 4P7GA 2Z6QA 3PXAA 1CD5A 2FZEA 3OWXA 4LDRA 1O9GA 2G5TA 2BJVA 1VIVA 2PFKA 3PHCA 5CU7A 5DSTA 3TMAA 1P7PA 4CF5A 1WB5A 3C4QA 4DDWA 3L6RA 1U2GA 2BFBA 3CVUA 1G21B 1LPAB 3EPPA 3DOUA 1PR2A 1AQYA 3H13A 3HB7A 3E2IA 4KH1A 4EHAA 5LR6A 3H9BA 4HX9A 3RSGA 2OAQ1 3AHIA 3A9SA 1USVA 4LJRA 1ODFA 1DAPA 1PGPA 1KHHA 4IDNA 4MX8A 3RAPR 4DGQA 4H1HA 5HFNA 1UK9A 4RKYA 2OP1A 5FBQB 1IM2A 2A9JA 2EFHB 1Q0ZA 3RC8A 4OHKA 1B73A 3HFSA 2X8JA 3LOQA 4I9GA 5FBWB 4KGZA 4MQFB 3RT7A 4F8EA 1KNXA 3DL7A 4UREA 3A06A 4NBNA 1EWYA 5COBA 1XN4A 2OLEA 1RXYA 3A4LA 2UUOA 4RD3A 1XTVA 4KO2S 2J7PA 4DMFA 1KVRA 1SXGA 4X7PA 3AK4A 3MJVA 4B6RA 4OJNA 1A82A 3RRYA 3ECSA 1SXPA 2Q3FA 2ZBGA 2VHXA 1Q3TA 2AXEA 1XAJA 2CMGA 1OWLA 2WIKA 2HNBA 3QF4A 4BKMA 4BFUA 1S2LA 3LC1O 1YBAA 2P4SA 4IJQA 4KMOA 1GPH1 1O94D 5I9TA 1L3BA 2O7SA 1XCMA 3Q0TA 3RVDA 3WGJA 4CM7A 5DE3A 2EGHA 1SUAA 1C4WA 1JTVA 3QWBA 2ZRNA 3EZLA 3X3HA 1Y1PA 1K2WA 2X42A 1HOXA 4D5EA 3T06B 3S3TA 5C5DA 2GERA 2IH5A 3UFBA 2JVJA 3P2JA 3A9RA 3C8MA 1XR3A 1OFVA 3HCAA 4RMIA 1NVUQ 3FSGA 4BFZA 2GO1A 3EY9A 4NYMQ 2B36A 2BJHA 1F8FA 1H6CA 2CFIA 3SIRA 1NUSA 1E9FA 2D8AA 2PBRA 4LRXA 4PWZA 4R54A 5DNAA 3SBXA 3TD2A 3ZNNA 1YVPA 2DBVO 4LQ4A 2FLKA 2JLUA 2CDRA 4XJVA 5AM0A 2OFPA 3IPRA 1WEHA 3O91A 2GYVA 3EIUA 3HC7A 5E38A 2V98A 2B82A 2PN1A 3V9AA 1PL8A 4D3ZA 4P4GA 3GQBA 2HMWA 1V7CA 4CV2A 3EBPA 1L5NA 1GVNB 4DCGA 2XXBA 4P5EA 4EECA 3ORRA 4I99A 5JHHB 2F8TA 1RI3A 3DXYA 2PD4A 1TF2A 5JPDA 1NVDA 4D0RA 1E2PA 1OA0A 2JFNA 1SBHA 4J0KA 3MJ4A 4ER6A 3BXXA 2HQSA 3MTBA 4J0GA 2W2PA 4B3SB 1I32A 5C80A 2GBCA 4GRAA 4KDEA 2XUPA 2C83A 3COWA 3EEYA 1J97A 4DQDA 1WNTA 1Q1AA 5ITWA 3KTFA 4ZK2A 2IYEA 4L08A 4IRUB 4AS1A 3A6GA 1GEGA 3EDRA 3T9AA 2QL5A 1ZI8A 1XRLA 3KXKA 3HKCA 2AXQA 4TTJA 5JFGA 4LRQA 1QPGA 4MRMA 1RM4A 3D54D 5JSYA 1ZGCA 2ID8A 3BK7A 1ZZGA 3OZCA 3PFHA 4U2DA 3H99A 4Y2TA 4E0BA 2JH8A 1T24A 2C8VA 2F48A 3BB1A 3DC2A 2GHRA 4LHWA 4BN5A 1MEOA 4LKOA 2Z4TA 3RSFA 3JZDA 4TLCA 3TG8A 4MV8A 2Q6KA 4MYDA 1XZCA 1GQRA 3PYXA 4Y6RA 2XVZA 4MW2A 1YZHA 3GDGA 3ZLJA 3A25A 4NZ9A 1YB6A 221PA 3G0DA 4QYIB 2WHPA 3N8IA 5EGNA 1NFRA 4BTVA 4PBRA 4ZIRA 1OAOC 1D2GA 2VHEA 4YIKA 1PFKA 4MUJA 4F84A 3WMGA 2XIQA 4OHXA 4KB5A 5HS4A 2GT1A 2VZEA 3BE6A 2WMOB 3NT4A 4KQJA 2WJPA 3QYJA 3UO8B 4FVTA 5DTIA 1Z0ZA 2ZJAA 4MROA 5CFMA 1CR0A 2ZANA 3G0CA 3NANA 1WTAA 4KQ2A 4BNTA 1UMCB 1D6JA 1HQCA 3GXBA 1MAVA 1KARA 2HF7A 4FIZA 4M37A 2ZYGA 4KR0A 4Y7DA 2C1ZA 1JE1A 1JVSA 1XZQA 3KDAA 2NU9B 2OXIA 3ZR4B 4CW7A 5F7OA 2EKDA 4NCHA 1NVAA 3UICA 1XEAA 1JKJA 1XAHA 2J0UA 2J9XB 3Q87B 2DCMA 4KX5A 4MICA 1XELA 3JQ8A 5JROA 5JW6A 3PD1A 3RJTA 1L0BA 2PSDA 2X1MA 4X91A 2FZ4A 2ZS9A 3RUDA 2HAEA 1EK5A 5EQTA 1ZNZA 3CNHA 2ZW9A 4D9GA 1GV1A 1KIMA 2IXGA 4WOPA 1RXCA 5CVJA 3W7BA 2VDOB 1W46A 5CB8A 3AQIA 2G08A 1OPXA 1PEKE 1YMUA 2JZOA 3IV6A 4I66A 5CHEA 2P1RA 3TF5A 3HSKA 3LP6A 3QVWA 1NVKA 2P68A 4OH1A 4G0NA 4A9AA 2PEYA 3L8YA 1SVWA 4P4LA 1LGYA 3O8OA 3HCRA 3NTUA 3PITA 4YROA 3PP8A 1ECCA 1YS4A 2E37A 3KOWA 1W4RA 3HRIA 2KYRA 3NM5A 1SOMA 4FT4A 1T8RA 1Z4OA 4Q02A 4EUNA 4AKEA 1DT5A 2PMWB 1QYDA 1I80A 4EUHA 1M54A 5H4GA 5AVRA 4NF2A 2FN4A 3LWZA 2G9UA 4DA0A 1U8YA 2VCYA 2EJVA 3FDFA 3O9VA 5L51A 1PNQA 3W1EA 4BZWA 4B45A 1I4OA 5ILQA 2WHQA 3T38A 1OJLA 4WNYA 1VGRA 2FJUA 4HCJA 4UMEA 1SCKA 1C7EA 2V7VA 4MR9B 5JZVA 1DZIA 4GECA 2HF8A 2A1TR 5MF6A 3DMPA 4Y6PA 4DPMA 3H2IA 4K46A 3P9QA 4E94A 3PTAA 3R6DA 4PZCA 3K05A 2ZJ4A 3QYFA 4IDGA 5FULA 1I13A 1JG1A 4RCZA 4TWRA 3D7MA 4CIBA 4IJ6A 3OFSA 3W3AD 3WAGA 5SZJA 4KWCA 1AGYA 4ZCMA 3H5NA 1WMFA 4I8DA 1LZLA 4ARUA 1AS0A 3GRPA 1ADYA 1NSYA 2A4KA 1EHCA 2CLCX 3OPMA 5A04A 1FS5A 1L7PA 2GEBA 3I45A 1HG0A 4FFOA 3AM3A 1GNRA 5GV8A 4ABYA 3KSBC 4RZQA 4DV7B 1VLQA 4M54A 4OSOA 2YASA 4UQLA 3I9JA 3KLBA 1LS6A 1UBJS 2BCJQ 3UMBA 5AVZA 2FGJA 3TE6A 2V7EA 5HWSA 4RSRA 5F51A 4GZLA 5FTMA 1FW6A 5IM5A 1ZD1A 1MX9A 1HPLA 3A3PA 4RK1A 2HNKA 3WI7A 2C1EA 2R1UA 1TZJA 2IOQA 1SCIA 3H65A 4M8SA 5EMNA 5FTKA 5KOJB 4Q9KA 5H1YA 1E5LA 4GU5A 4PG4A 4C89A 4BUZA 1T4CA 3EZ6A 1ARZA 2JRLA 3L7AA 5C4MA 3BCSA 1KEZA 3KXDA 1KFBB 4NP6A 5F1PA 3HZRA 1Z7BA 5G3YA 3WP0A 3ZTTA 4BVAA 3OTGA 1JJIA 2PRIA 5LMZA 3A6PC 2GSDA 1RYYA 2HRDA 3DONA 1EX7A 4TGLA 4WZBB 2WQ6A 3ZV6A 1DXOA 2XAAA 1J9GA 4B3DA 4KU4A 1DFIA 1ZU4A 2FPPB 1WXFA 4RD1A 1EG2A 3O3MB 1KEUA 1HEIA 4GEGA 4YRTA 1AY0A 1B1CA 2ZB4A 3BMOB 1P80A 2VJPA 1HY3A 1QYCA 1M8PA 2ZTMA 3H3FA 3CA8A 4IKEA 1EXDA 2GF9A 2W2LD 1SWWA 2REQA 1ZONA 4RTPA 3GJZA 5HCIA 2FZLA 3PZRA 4R7TA 1JHQA 3CLHA 4Y1GA 3SGLA 3AM4A 3MK31 2D06A 4D98A 1E2HA 1Q7BA 3ZVLA 1XNGA 1LBQA 5KKNB 5J40A 3W6OA 5C8YF 2R2GA 3KVOA 3R7AA 3ENQA 4IXDA 4M88A 4FMPA 4NBVA 3I04M 4QBGB 4NI5A 4QRIA 4BZPA 1R6XA 2RJOA 2AEJA 3VO2A 2JGDA 2CT8A 2ETXA 5EIAA 4LCJA 3MBKA 2ONZA 4R1NA 4M1EA 2D0DA 2C98A 5LXTB 2Y76A 1ULAA 3OU7A 3K1YA 1M2FA 5D51S 2Q1TA 3WGOA 5CVVA 4IV5A 3EZ2A 1C9EA 1UDWA 1NW3A 4GPIB 1GAEO 4PFQA 3EDQA 1CR4A 4L4ZA 2AJTA 2J46A 3A6JA 2ZTVA 1CJKC 1R8SA 2Q5QA 2Z43A 4R41A 4ALNA 4AG6A 4F1JA 1NVXQ 5C1DA 4MVJI 3AF1A 4DUZB 4Q3KA 1G5TA 3JAWA 2Z4RA 1EFCA 3U60B 3UJ7A 4I4CA 2R62A 1X7ZB 4MRAA 2ZFUA 2W6PA 3HL0A 3K8ZA 5HG0A 4GFDA 4NCXA 1CUWA 3OTIA 3H17A 2HK9A 5CUQA 4NJEB 5CXXA 1J24A 4I3FA 4TKVB 1KQFA 4X6YA 1VSTA 3T4EA 4P4SA 1T9KA 5CAEB 3DVAB 1FVXA 1V9SA 1OXSC 1VE1A 1A98A 3BHMA 1QLJA 1C7ZA 5GTDA 1D2EA 3VSDA 5D5PA 4P7KA 5JNLA 1GGVA 2L2QA 4BXOB 1Z16A 1G5PA 4K9SA 5EGSA 1NJFA 5DBGA 3FCYA 3AHEA 3FXAA 3CJTA 2JEOA 3Q3EA 3KOOA 3AFHA 1YT5A 4HG2A 4YJHA 3RKSA 3I6IA 1YB7A 1ZA2A 4G5OA 1MMFB 2P9YA 3OJLA 5I7SA 1N2SA 3UUFA 3W5JA 5CLIA 1J07A 4QJBA 4FFRA 4ZV7A 3M5PA 1E3EA 1FA9A 3K4QA 2F8LA 2L19A 5FIUA 4K05A 5F33A 1DKUA 2XUAA 3SNKA 3VV3A 4D7AA 1Z5VA 4AWBA 1K27A 4AFNA 2R7NA 1EUCB 1ORDA 2IRWA 5CXSA 3NWBA 3NIFB 1MQ9A 2Z8YM 5BUSA 3AHHA 1TA0A 2F6RA 1MF7A 3LYLA 1XYVA 2CNDA 2UZ4A 3MSCA 2EGUA 4MUGA 4DQUA 9ABPA 5IFLA 4XDGA 3WNVA 4ZT2A 2EZUA 5G4LA 1YKSA 3EGWA 3P9YA 3GFSA 1LTHR 1E8DA 1JVBA 4J1TA 4ZD6A 5B4TA 2QZPA 3H75A 1G3QA 4YJKA 5EIOA 2WM3A 5BV8A 1FZTA 4GKVA 2IXEA 3ETJA 4DLSA 2XRZA 3WZLA 1YR6A 1WX1A 3N1UA 4Y2HA 4C76A 1MDBA 4B3TB 3TFQA 5E6UB 5L40A 2VWHA 4WN3A 3L8ZA 5TPWB 2RGWA 1ODKA 1F8UA 1JQLB 1QO0A 3RG2A 2F3SA 1VM6A 3DVAA 2ID4A 3T0IA 5F7XA 3MWEA 4JU9A 4Y1FA 4RV9A 4DLWA 5JPCA 4QDTA 4YCMA 1DE0A 4YV1A 1L4YA 5D5QA 1POWA 4DVGA 5GINE 1TYEB 2QOEA 1FNDA 4X6LA 3NJ4A 3CZ5A 4ZGGA 4DR7B 5A0TA 5DYGA 4OREX 4DW8A 4WOBA 2R1VA 4JZKA 4MCAA 1I9CA 2NU6A 1HYGA 4RA6A 2AX4A 2BGKA 2DJ5A 2SKCA 3A1CA 3PDIB 2AFIB 4Y1RB 3VR6A 4AUEA 2OCDA 5A03A 1MHPA 1N1MA 1WB4A 3LF1A 1SKUA 5CLJA 2XNDD 5HE9A 2IV7A 4CIDA 2D1RA 2HSZA 5B7QA 1ZR2A 4U7HA 3LYUA 2PCJA 1JDVA 4ID3A 1P2SA 3IHWA 1WPQA 3TZLA 4MEBA 4Q3OA 1KQ3A 1H22A 1S01A 3FPSA 1NL3A 4M53A 2W0SA 2XCQA 2NUAB 4E21A 1DU4A 4I81A 1QIDA 1DBIA 5C5CA 3KJHA 2P2ZA 3KYBA 4QC2A 1HE2A 5GPBA 3DSRA 3ICCA 3KJIA 2GPBA 3UKJA 3SX2A 5K8UA 4JROA 1MXHA 4ASUA 1P61B 2CZGA 4R8RA 1U65A 4RWZA 3FPBA 3PBKA 3EDCA 5SY6A 1EUZA 3UKDA 3BIOA 3WA6A 2BHSA 3SJUA 1ZAKA 3GBVA 5K8TA 1XCLA 2RK4A 2TMYA 2FMKA 2FEOA 2PLAA 3CH5A 3ENWA 4JUCA 4NV3A 4WUTA 4KK3A 3OOJA 2WLSA 4ZPJA 2BWJA 4KO3S 2PL5A 4OYHA 4KSCA 3VPHA 3ZE7A 3K71B 1A4RA 2QAGA 3KELA 1R5NA 1NM5A 4ZDIA 1XTTA 1AUVA 1MRNA 4KO8A 1FW8A 1UFKA 2PGNA 4AW9A 5G0VA 1XXHA 1YL7A 3MSXA 3PIDA 5JI2E 2QMEA 3U19A 1LCIA 2COKA 4AZ3A 4RFLA 1IY2A 3KZKA 1XCBA 1KDZA 3OCXA 3L1JA 2G88A 1RTKA 1NX9A 3RS4A 4AMVA 3ZY3A 1HDGO 2BLNA 4ND2A 4MTCA 1UXHA 4X7MA 3UHOA 3VO1A 3HABA 3ZE1B 2UZ1A 2AKEA 3ZWXA 1S0UA 1ECBA 2HDWA 2YXEA 1F4VA 1GG8A 2ZTUA 4YR7A 2I3GA 3HE3A 3IAAA 3PE4A 4Q00A 5AIAA 1N0HA 4ZV9A 3W8EA 3RK1A 4AJEA 5BXQC 1TRHA 1W29A 4UHKA 4UUBA 3GIWA 2J3IA 2JAUA 2VATA 1GSIA 1V8BA 1R0XA 2ZXFA 4JP2A 2ZT6A 3LLUA 4NU5A 4K9NA 1OTXA 3UT6A 3NOQA 4F38A 3QP9A 1ZAYA 1UKEA 3IOEA 1XNRB 1XD9A 2JGNA 3OM0A 3Q7SA 1K0FA 2BI4A 2IPAB 1U3TA 3CM0A 4NZNA 5A7GA 1SXHA 1AQNA 2BTEA 4UU0A 1XTQA 1DJPA 4O4JB 1X8LA 4CTOA 4YUZA 5CEEA 1W2HA 2OB2A 1RLTA 1FRZA 2IU4A 4TWIA 1TC2A 2Y66A 3HJNA 3KEMA 4YGXB 1ZW1A 1C3OB 4AO8A 1CZKA 5AKLA 2QW1A 5FBZA 2FPRA 1GP2A 2NYRA 5UKDA 3SHWA 3BORA 3AXTA 2JZCA 5KQRA 3GLVA 3I5UA 4K6CA 3IUQA 3BMQB 4R2XA 2BEUA 4GYJA 1QX3A 4ND3A 2CJPA 3ZD9A 1AKUA 2IDKA 3QQPA 3CLTC 3QH4A 4LUCA 1XDZA 4YAIA 3LOPA 4EMBA 3D7RA 3I2HA 4KIUA 1QH1B 2JS7A 5DN9A 3N0RA 1UKAA 3V4FA 1FLAA 1I3MA 5JRZA 3SVZA 1LPPA 3CZCA 3PUKA 4NU8X 3H2BA 2A88A 2M6RA 3P52A 4LYGA 1ELOA 4MGKR 1X0VA 4ZCIA 1I2MA 1WZ2A 2XKKA 1L6RA 1MB3A 3T5GA 3LM8A 3NOVA 5AVYA 3ILSA 2P41A 5I4CA 3NAZA 4MVJF 3E5NA 1ECGA 4IQGA 4LC9A 2BGNA 4JC5A 4EEZA 2WTUA 3EXEA 1IWBB 1S2DA 1HDZA 1U3UA 1AKNA 4QIHA 1S6YA 2WM2A 3IQZA 4NBUA 3RKRA 4WADA 3RJMA 4S1NA 1POXA 2ZS7A 4BRWA 4CLHA 1QR6A 4RIEA 9MHTA 3WYEA 1PV4A 2HA0A 3SYNA 4MUAA 5DYWA 1VSBA 4M0EA 1JX6A 3M6LA 5E6RB 1Q83A 2UYOA 1U5CA 2XR1A 2ZUCA 2X0FA 2D5IA 2V58A 4GI1A 4L1KA 3RGGA 4KZPA 1XRSB 2O2SA 1JJ7A 3T7AA 2AZ4A 5C8XA 2DHRA 2GGSA 2OLKA 1P73A 1M0SA 2FY8A 5JS2A 4E22A 5CCXA 2VF7A 3ZVMA 4DJAA 3SJBA 4BVJA 2QMUA 1FXWF 2HN9A 3BILA 5BURA 2O0LA 5HZMA 1ZP6A 4QYTA 3H2KA 1K08A 5THXA 4EDFA 1Z5PA 3A4NA 3D7SA 4IAOA 1T1GA 4X54A 4QPCA 4FFNA 4BQOA 2XVYA 4GYWA 4EM6A 1XQWA 5A6SA 3NFRA 2PTGA 1F0KA 4P82A 3B3GA 4EY5A 4BQNA 1QBGA 5AK3A 1F8XA 3DXFA 4PXYA 5FL3A 1E7SA 2G25A 4TSFA 1RT9A 5I7AA 2E1PA 1L5OA 1S96A 2FWNA 5HM8A 3HCFA 1SG9A 1V6AA 5B3JC 1Y1LA 5KVAA 1IUPA 1M2VB 3A10A 3FN4A 2QI9C 3DTTA 3RARA 3NV9A 2XVMA 2BL4A 1W88B 1UBEA 4FE7A 3EAFA 4MHSA 1IN7A 2G04A 2ZSUA 4ACBA 3MWYW 5BVHB 4PXSA 1YF3A 4NCBA 5D3MA 1M34B 4MWEA 5ECDA 3ROEA 5CIYA 2QUJA 3PK0A 1IQPA 3HVIA 4KXUA 3SHVA 1ADFA 5L6MB 4MW4A 1GXSA 3OLVA 2BCGY 1EZ1A 4Q4AB 1A50B 4L6IA 3LGXA 1FFXA 3AMVA 4YFYA 4E5SA 5JMWA 1UBFA 2RGXA 1TQ4A 4IEIA 3X1XA 4L0CA 2PZMA 4YUAA 2HNAA 4XFDA 1W0KD 3DH0A 3PS9A 3R40A 4S1OA 4IDEA 3RTDA 1DQPA 4LSWA 4MIEA 4FHFA 1A76A 1RKQA 3T1VA 1MG5A 4K1XA 2OBFA 4PLWA 4AMYA 1W5EA 3I1IA 4RLQA 1JI0A 2B4TO 3FB1A 3IXLA 3LPDA 2D2EA 4JQOA 4JJKA 4WL0A 5HRAA 3ZWAA 1C9NA 1KAHA 1R8YA 1ZC3A 2MINA 2OY0A 2WJ3A 3BSWA 4KE9A 3OF3A 1KGDA 1L9XA 2ORYA 2MYUA 5G3ZA 4JJ7A 3ZDXB 5IHXA 5JADA 4CN8A 2WIAA 3ZOZA 1XCOA 2JIBA 1RLIA 2X7JA 1V9LA 5J4VA 4GZ5A 2NPOA 4DWWA 1UQRA 3B9BA 5I7HA 4S35A 3OIGA 3ZCPA 2O2DA 1PZFA 3O1IC 2GN9A 2FSVC 2PGXA 4HWGA 5DLYA 3V8RA 1FTNA 3ADCA 1E1YA 3D8BA 2IGBA 4OGGA 1CHDA 3AP2A 2ODTX 3TKAA 2WYWA 4BTEA 1ZD3A 1MLDA 4RGVA 1DAOA 2R6ZA 2X8LA 2WP8J 3JQ9A 4CLOB 5JQGF 1GPMA 3TGLA 2QLNA 2RFLA 1XRPA 1ZEJA 1PHPA 5CH8A 4XWGA 5CXQA 5DOVA 5ALXA 3DMRA 4HI0E 3UOAB 3LLCA 4WA7A 4W8HA 4PZDA 5A3VA 3KQMA 4G5GA 3C3MA 3LHKA 2JBAB 3O0DA 3K0AB 1SOWA 1FX0A 4Z4QA 1WDTA 3G85A 4PYLA 2X3UA 3Q3JB 2PZFA 1T29A 4HT3B 4N6GA 1WA5A 4B3GA 1S8FA 3LQKA 2QUIA 3LI2A 5HKKA 4MV9A 1FE8A 5G4KA 2UUBB 1V5WA 4D79A 5I9LA 3WB9A 4UXIA 1GKYA 5ADVA 3EULA 2PL1A 1TT7A 3HO8A 1LV8A 1SZPA 4J4HA 5AKXA 5EE1A 4EGSA 1T36B 4TV8B 4X1KA 5AJWA 5KC8A 3T1YB 1OWMA 1Z6QA 3ETLA 1TM1E 3M70A 2D2FA 4ZU1X 2CFRA 4Z2YA 3W5AA 4PSCA 3P9XA 5D6NA 4MYTA 4PYQA 5T67A 4B3HA 5KJ6A 4OXRA 3R76A 2Y1EA 2XYVA 2P2NA 2BGRA 3BS4A 5B4VA 6LDHA 1TZBA 5DM70 1YONA 1Q0TA 1IK4A 3RNLA 5H9VA 3DTVD 1Y3DE 4QFBA 2ZJ5A 1YQ9A 1O0BA 3RVMA 3GK3A 3SQWA 4FEEA 1PKEA 3ETGA 2JD0A 3EG9B 3H2GA 1J9EA 1PD1A 3E1GA 4G65A 4IW3B 5H3LA 3REGA 3ZU4A 2BEUB 5E4TA 2DUJA 3OA2A 2XTZA 3IH5A 4PQEA 1M2OA 1CRPA 2BFBB 2I0FA 3R7WB 3LZDA 2ZSDA 3OE4A 2W2VA 2R87A 1OIXA 2W2OA 2BHTA 5G0SA 1D0SA 2H4YA 4PCLA 3VMMA 3O8OB 4JYMA 3UN1A 2BTOA 1TA9A 6ABPA 3EH2A 1UBNA 1R6VA 3KB6A 3S27A 5DM60 1EPUA 2JHGA 4DN6A 3H18A 5K3AA 1Q14A 1L5MA 3SQNA 2BMEA 1YS9A 4AURA 3ITEA 3DZGA 4MSUA 1LLUA 2MYPA 5DEIA 3A28A 4CKXA 3QE3A 2XT9A 4K9QA 4I0WB 4CUKA 2AW5A 1M6NA 2YZ2A 3LL4A 2ZETA 5E0KB 3EOAI 3G23A 4CL3A 1WZEA 1U2QA 5DBFA 2AEEA 4PBTA 1JHUA 2CXSA 5CJPA 2YN0A 2XWBF 3BRWD 3O4VA 4IJKA 4H59A 4JQYA 4XJTA 1ZOOA 1S5PA 4QOFA 1HLPA 1XJQA 2FMFA 3KOUA 2WWGA 1Z4QA 2VYNA 4MHOA 5EWLA 3EPJA 1TT5B 1W9MA 3I73A 4NMLA 2OZVA 1E9AA 3RVRA 4ZOAA 4CQMB 3F6CA 3H1GA 2UZ0A 3O26A 4FGZA 2PT5A 2J9FB 2PUWA 4LZLA 2K7ZA 3A9CA 4FE3A 2YBEA 2XYQA 4D9EA 1E5QA 4AZWA 4AZVA 3UMYA 4I3GA 4ZAZA 1H4QA 1TMGE 1KMHA 5CFQA 1X70A 3DQQA 4YREA 3PTZA 2NVOA 2W42A 1CIVA 3V4LA 2EFYA 3DAYA 4IDAA 1A9YA 3DEZA 5EWJB 3SYTA 2FETA 1G2IA 4N76A 1E3SA 2GA9A 2NTVA 2C9CA 3OQHA 4WKOA 1M5TA 3KVYA 3W3AH 3WLTA 1LEHA 4IQ4A 1CF4A 1V3VA 1JHZA 3OJ0A 4OK3A 4GWLA 4QUBA 4BUJA 3KBOA 2JIPA 4LRSB 4OB8A 4UNPA 4DCNA 1YQDA 2Z56A 1BE6A 1RC1A 2QD2A 3V6LA 1U2TA 4ECEA 1KVUA 1XMQB 2XB9A 2QVZX 4FZJA 5GM1A 4LF6B 1JB1A 3RTBA 4IUBS 1P2GA 4MIOA 1IM5A 4IIEA 1ISRA 4Z9FA 2FXIA 1EBBA 3C87A 4BEBA 2MTBA 2Q5OA 3NFYA 2QRNA 4GOXA 3UGJA 5EUCA 3D8RA 2OYSA 1RRVA 1C1XA 1ZJYA 1QC5A 3CLSC 4UPDA 4WKPA 4YMWA 4BB0A 1L1QA 4KV7A 2BYTA 5B12A 2GZDA 4E14A 5K4HA 1LTQA 2D5AA 4LRUA 1JTEA 2FQWA 4OXNA 1O97C 3ROZA 5LBUA 2QT9A 4J3FA 2EU8A 4O4IF 1RYBA 2X4DA 1M2WA 3PEFA 3F9CA 3VC1A 5IHPA 3IPLA 5JQGA 2ERXA 4G24A 3NBFA 3MJCA 4KGXA 2RHMA 2HHLA 1C7RA 1PT5A 1A88A 4KFTA 3TVDA 4XRGA 5T4FA 1EVYA 4LJYA 1V9CA 2H8GA 4KQCA 5DN6D 3U16A 3SS8A 4DQLA 1GITA 5GY7A 1W4CA 1D9XA 2QD1A 1KTIA 1JWAB 2C2XA 4MV5A 4HL6A 1FS4A 2RAFA 1FTYA 1DUSA 2V4MA 4FYXA 4NESA 4PZPA 4MRRA 4QNRA 5IM4A 2UYCA 3NETA 4GM1A 1YZKA 2G4LA 1IPEA 3EB9A 4NDAA 4LF7B 1MQAA 3A36A 1Y8QA 4BB6A 5E1OA 2VBCA 3DW3X 3D31A 4IS2A 4HB0A 3E9DA 5KCZA 2W4MA 3CN9A 1OCEA 3O84A 5HF5A 1BN6A 3WGGA 2C59A 3FMFA 4DJDC 1N1DA 2H00A 7REQB 4EUSA 4CG1A 3UWKA 1Q3KA 2CUKA 1THZA 4JGGA 3NOOA 4C0QC 5JC1A 4LHEA 1V1MA 1QC5B 4DMCA 2ZI9A 6ADHA 2LTAA 3EC2A 2NTNA 1R10A 1UODA 5IH3A 4QDZA 1N0UA 2Z2ZA 5C32A 3HJAA 1H4TA 4FDTA 3WL5A 2ONCA 1ILWA 1N5DA 4CFYA 2QJFA 2Z04A 4B48A 3N2NA 1TUBB 5FCDA 1G7TA 2C96A 4DZTA 2Z5VA 3ZBQA 1QJCA 4MEJA 1FQOA 2IPMA 3C0KA 1W85B 4DJJA 4HOYA 1YE3A 1ZUNB 2IZ1A 1YFJA 1EUQA 1TZMA 1CQXA 2V3WA 1KYZA 1UBUS 2BEVB 3QFRA 2FR0A 4OB6A 3RCBA 4DLNA 4B75A 3QVLA 4O4HA 5L7WA 4BE7B 2WWWA 3DFIA 5FEMA 1J20A 1G19A 3FPEA 3DF9A 3OX3A 3RUCA 1C81A 1HMYA 4R8VA 2F59A 3KYDA 2ZE7A 3MMSA 1DSSG 4EGJA 3AETA 2YWJA 3HKEB 3T9BA 2ODAA 3H5WA 2C2OA 4JOCA 1SB9A 4IICA 5BNFA 4OSEA 4UDNA 1LLQA 1C1YA 3JVUA 5BRJA 5JBIA 1NBMA 3OCWA 4LDPA 4W9NA 2XQIA 5HK8A 4TMFA 3NPMA 1C3JA 4QPDA 1EUDA 4HO1X 4MS4A 1QTQA 4GGMX 4ZTUB 1TQHA 4TVSA 1TUEA 3OAAA 3PJRA 4S05A 3ORFA 2JGRA 4HGZA 4RPHA 3UOGA 2XQFA 1TQ8A 3BTOA 2QSZA 2AN9A 4JUBA 3G9ZA 3U6KA 3PHJA 5T5QA 1MB9A 1Y9EA 5T3YA 2BRUA 2JI7A 4RTKA 4YO8A 3HM9A 1I7NA 3WMEA 4EA6A 3T7SA 3V8EA 3OCCA 4YB8A 1ZK0A 4DR1B 1U9IA 4GVPA 4LWOA 3GJ5A 5CCDA 3WDSA 1EE1A 4IO0A 1W96A 4QWWA 2ERYA 4FDMA 4CMCA 2R60A 2JLWA 3V8NA 5JU6A 4FFPA 4DR5B 4MKHA 4IOLA 4LSZA 3I52A 1C80A 1Z7GA 2B0CA 2W5UA 3I6ZA 4EW6A 1Y1RA 4Y9RA 4KIGA 2C3MA 3GARA 2W6JD 4D74A 3A1FA 2JC3A 2OESA 3HBMA 1N75A 1XMJA 3RUPA 3M81A 1WXDA 3WLIA 3CINA 5AUNB 4P0QB 5JNTA 4L76A 4ALJA 1FYVA 4BN0A 3PU6A 3E5HA 3PQ2A 5B1DA 4EKIA 1BXGA 2BKAA 3A6FA 3ZGVA 7ABPA 1UWVA 1IK6A 4IKOA 2N75A 1KO4A 2ZATA 1K06A 1QIGA 3DHEA 4FT2A 5TVGA 1HSZA 1GCIA 3ZEIA 5HEKA 4MLDA 1DFGA 1YCHA 5IW8A 3SF0A 1P1JA 2EBFX 3DOHA 2J4DA 3CB2A 3MUNA 3NATA 1I30A 3RSCA 3ZG6A 5JO9A 2X0JA 3PC8C 2R68A 4O02B 3W1VA 4F3KA 4QL3A 3ST7A 4K6HA 1V2HE 3TOSA 3OZBA 4RK6A 4RE5A 4NG5A 2J3JA 3HP1A 3T9FA 2EEPA 1P2VA 4TRNA 4PQRA 3R7WA 2IT1A 3A6DA 3GFFA 4KACA 4ZJPA 3ZGZA 2NO4A 1BIFA 1LZKA 2GBPA 3NUQA 4Q9AA 1LK7A 3AKDA 3D4BA 4M2LA 4CU2A 3KZNA 1T0BA 2WHPB 4X90A 5EERA 4ZIRB 1NQAO 2TYSB 2RGAA 2WQZA 2LWIA 2QLTA 1WP9A 4XQCA 2I1LA 5JLAA 4UFNA 3HR8A 4QKQA 1JVNA 2GUWA 4EGFA 3FHTA 4XTCS 1DG1G 2XE7A 4P2GA 2Q5HA 3C7TA 1EJ2A 1G6Q1 3R1IA 2XUFA 5TQVA 1Y9AA 2CXUA 2G82A 3B60A 1T1RA 4G4SO 1V45E 2O9JA 4WXEA 1M8FA 3FCAA 3PD7A 5LMNB 1R4NB 2BC9A 2SBTA 4RTMA 4C43A 5JANA 4H18A 3L1IA 5CFPA 1U8TA 4J0EA 1ZUNA 2RGCA 3Q7IA 3OQIB 4IIBA 3CKLA 1GKUB 1E7QA 2QQEA 4JC0A 3R7LA 3R8XA 4PXAA 4ZYZA 3D5QA 1Y48E 1KJZA 3JAKA 4H3VA 4BWGA 3HBLA 4GE0A 3LPMA 1MAHA 3B1KA 4N6NA 3AEQA 1RBZA 2YFQA 3QVVA 5BNIA 3HLKA 3P4YA 3KKZA 2GHIA 3K0BA 2R84A 3NC0C 3QE0A 2XDQB 4JJ8A 5CNMA 1ZJ6A 5AKJA 2L17A 2ZQYA 1WDKA 3N76A 1ULBA 3V6MA 3RADC 3GPIA 1M34A 4QTUB 1ZICA 3CCBA 5GZ3A 4ETIA 2XDAA 3OWHA 5C4IA 2YVAA 1PUJA 1SD5A 1U3CA 2I62A 2YOFA 4URHA 4EJ2A 3LOUA 1B4DA 3LA8A 3PX7A 4K6KA 4M3NA 3WO0A 3ID6C 4BU0A 4TWAA 2A9OA 4D9NA 3CISA 4MS4B 3PC7A 4RUKA 4L02A 1A1SA 5DT2A 5L6LB 1EYZA 3VAZA 2BR4A 2CYBA 3MD0A 4HDQB 4MRSA 4P98A 2RGGA 1J5EB 2BTQA 4LA4A 4BNDB 3PFFA 2XSZA 3WNQA 3GLFB 3PE3A 4LXIA 2FN7A 4KJXA 1J0AA 1EWQA 4FMDF 4I9FA 2Q5IA 1KZ9A 4AKSA 4EKDA 2GB4A 5ESWA 2SICE 3VZSA 1KQGA 2AXNA 4F4FA 3P45A 1WSAA 1U0JA 5CLFA 2YY6A 3AVPA 3C3PA 1VPEA 3TNJA 2IUUA 5FA5A 3I23A 4P4TA 4FYKA 1SPBS 4KUGA 2XUQA 2NP6A 2PUFA 3G59A 1VLZA 5FOWA 1O4WA 1CUZA 3LDAA 4EA8A 4F4HA 4Y9UA 5KC9A 2VKTA 2XMGA 3EMKA 3FLMA 3PVCA 2DP4E 4Q6BA 4HZUA 1F0NA 3ZK9A 8ATCA 2ERCA 4BHTA 2A6PA 2SHKA 2R79A 3I9MA 2BR5A 2WJIA 4CGYA 1G2QA 1NQVA 1JHDA 1HFEL 2YQ4A 2Y6UA 1UFQA 3GEMA 3G49A 3I9KA 3Q8MA 1U7XA 1QNLA 3M3HA 5DEOA 1OLXA 1JHXA 2YIVX 4A6XA 3PEEA 2PV7A 4BNNA 2FX3A 3GP3A 2DOKA 5AM4A 4HXFB 4F1WA 4C20A 1X87A 4YP9A 3JRNA 2OUIA 2PSEA 2QV0A 4ZQCB 4KR6A 3ZC3A 1YQUA 3DWFA 3WB1A 4RTLA 5CA1B 5E0OA 3CMCO 1EUDB 4HQKA 5D8DA 1F2TB 1JBQA 3AQ4A 3ICOA 3DDZX 3EVCA 2I22A 2QHXA 4JCOA 5CP8A 3JAWB 5FI5A 2HIMA 2A3RA 2YIDA 2CL0X 1SRQA 3GRCA 4JKIA 2ZIVB 1DKOA 2AA3A 4UXJA 1J8YF 1RJDA 3ZWMA 2W6IA 3I8OA 3MS7A 1EIZA 1K7EB 2V7BA 3K5PA 1UXIA 2OBMA 3COYA 3LHSA 2B1IA 2CXRA 3OAAD 1VBNA 4RLSA 1DC3A 1T15A 5TV2A 3WR5A 3HXKA 2YY7A 4RJTA 5JVDF 3TXXA 2ZBVA 2G1AA 4OMDA 3W7VA 4YJGA 4OLAA 3JQ9C 1Y9DA 3GDFA 1U1CA 1YC2A 4IG4A 5FPYA 4DY6A 4WACA 5JJ5A 3F6RA 3JQDA 3ZU6A 4DIUA 2WHXA 3K1AA 4N47A 1OQAA 3D0KA 1MFPA 1J0DA 1X7XB 2AQHA 4E30A 2JI4A 3PEYA 2EFCB 5KWIA 1T0UA 5TMBA 3HXTA 2QNRA 1G20A 3I72A 3PT9A 1Y6JA 4LVUA 4M9UA 3UJ8A 5IK2D 1TO1E 1T2EA 3ACCA 3MLEA 4YO7A 3EHDA 4B6SA 4UBMA 3WNDA 3AI1A 3SZOA 4HAIA 2GILA 1YU6A 3BGOS 1CB0A 3LRTA 5BOSB 4EELA 4Z54A 4EPVA 1N5RA 2VDUE 4E46A 4I8XA 4JU8A 4Q03A 4D5GA 3IUNA 5AJTA 2VJBA 4GPAA 1SOUA 2WJ4A 1CUXA 1G7RA 1K3FA 3K0CC 5DK4A 4RESA 4Z5XA 2GLTA 3DUFB 3U7QB 2H1IA 1T9HA 1OB5A 4J1NA 1DZ3A 4LN1A 1AHNA 1MOSA 4B5KA 5K0FA 4DCOA 1HE3A 3AERB 3EJ6A 5IBCA 2O54A 5A3SA 1TKBA 1O03A 2V3VA 3AJRA 1QQAA 4XIYA 1UBGA 3WYNA 3IEKA 1TL7C 3PEUA 5KQGA 4YWJA 4FS8A 2B4KA 2IGTA 4M1WA 1FLNA 3L2OB 4KWHA 4EQ6B 5A3QA 2PZBA 2A67A 5FPKA 1GL9B 3U4QA 3PSHA 3TUZC 5LC1A 1GNVA 2Q6IA 4UHFA 1GGFA 1V8PA 3K4PA 4TUYF 4N0MA 2HW8A 2OZLA 3RK0A 4UUNA 1AUXA 2XY4A 3PGKA 4UDXX 2HGSA 1MC8A 5GJCA 2FPIB 2CXXA 4G2TA 4KE8A 1K9SA 1TI7A 4QTZA 1QP7A 3G1WA 2YHIB 3M9LA 3KRTA 1OMOA 4WCFA 5ERYA 4ZTBA 4W5TA 4CEJB 1PVDA 2Z57A 1IHYA 1S2NA 4QDJA 1SBYA 1TLLA 1T0JB 1LRJA 1Z0JA 2B21A 4TMWA 1GZVA 4G5YA 2IDZA 4LBZA 3UMVA 5HUJA 5HILA 3AUJB 1DJLA 1T3GA 1G9SA 1NVVR 1UKZA 2FRDA 2O59A 5F2OA 3A4IA 3QWAA 1ZMOA 3L9XA 5I4IA 2VQ3A 2FEMA 4OJKA 4Y6SA 1G8SA 2C1XA 1WW2A 3LCMA 2IU3A 1TYBE 1N5MA 1C30B 1GTZA 2P0EA 4QJ4A 1XRJA 4TTSA 2ZYRA 2FR1A 1QHHB 1Z0DA 3BJMA 3CW8X 3FJYA 4FNMA 2J5QA 4DA6A 4EH1A 3KFVA 3I0MA 4GZ3A 3EC1A 5JMOA 4KX3A 3D6HA 3AR7A 3G0OA 3OX2A 1U1FA 2FH5B 4DIFA 3MQFA 2GTIA 5AJUA 4EQ6A 5L3SA 2HC9A 2OK7A 5BXYA 4DR4B 5F3DA 1NNLA 2AYXA 5LZ9A 4N7MA 2GAAA 3B38A 1EFPB 3F78A 4XX0B 1BWSA 3OOYA 2RGRA 2ZE5A 1BJTA 1HDRA 1SHJA 2DR3A 3N2IA 2F4VB 3SLKA 3AVVA 1UPTA 3IMEA 4WOJA 1T9GS 1X7GA 3GJYA 1NW9B 1QWSA 1U9IC 2NYAA 2P30A 3V8PA 5FX2A 4ZMSA 5KSZA 1XPUA 1UDBA 3ZWYA 4ZVMA 2R5FA 2GXAA 2AMFA 3C7AA 1CVRA 3EGOA 4GBGA 4LGMA 4ZREA 3KT3A 1ZXBA 2FQ1A 1DC7A 1OZGA 4JJAA 2IYAA 2DG2A 1P1HA 1SXIA 2FSUA 5J2TF 3WMXA 3DEHA 1HNWB 5DISB 5LP6B 5LSAA 3JAKB 1VMEA 2A0WA 2GD2A 2OZPA 3G17A 2HRRA 3GRVA 3HYTA 5KJCA 4JI3B 1BU8A 4EYEA 2ZYIA 1DS6A 3TPFA 1Y63A 1TVKB 4X97A 3ROMA 4D57A 1TU0A 5LL6P 1ECJA 2H31A 4HGQA 4OOFA 2I71A 3ZNPA 2VHZA 1DB3A 4RD6A 3UG7A 2BFEA 1D8AA 3WYBA 2LXNA 1YMVA 1Z82A 4LK2A 2GN8A 5DXAA 3WGTA 2HHHB 2GEDA 3AKEA 2H17A 3C3AA 1E18A 3FR8A 2E0IA 2DFNA 3ESQA 4N40A 1UMCA 1A9PA 1E0KA 1YVUA 1UJ2A 3UGTA 3G7UA 4URYR 5TJHA 4M7WA 2JZNA 3S2GA 3GGSA 2TSYB 4PO8A 3DDSA 3P2OA 1KEWA 1P0QA 2FFHA 2RAVA 2VG8A 5D1NA 3GLGE 4YCDA 5BWCA 4Y67A 2CKDA 4BLVA 3LT5A 1P4GA 1KSGA 1H2XA 3FCCA 4C4SA 6PFKA 4RQBA 5B3AA 3HO1A 2C78A 1A7KA 3F4LA 2H1OA 1II8B 1UXKA 4I1OA 5AVWA 2O14A 3R0VA 2V5UA 1CYEA 2FWPA 2J1LA 1U31A 3RVLA 4JFRA 5IXSA 3O4IA 5FOVA 4E5DA 3TZKA 2CUTA 2I2XB 1CW2B 1L4NA 3JYLA 3B6MA 5B3JA 2BFMA 3D9QX 4F45A 1AO0A 4YASA 1TF5A 2Y1OA 1TJ5A 1WD5A 2ZRBA 1ST2A 2HU8A 3A4VA 4FFDA 3HKCB 4H31A 4JY7A 5AUOB 1WU8A 1N33B 4HVAA 4Y9TA 2G8LA 2Q9BA 4E70A 4N41A 3S1AA 4EJ6A 3QE4A 4A92A 4DYHA 3T1TA 5L7TA 5EZYA 5H8WA 3B6KA 3FPJA 3GU3A 1PFGA 2XHZA 3A9VA 3C16C 4I4TB 3JQRA 1E9SA 4YRPA 4PWYA 4BRUA 5JZSA 1HBJA 3PUXA 3ZBUA 1B8PA 2CLSA 5K0GA 2CMHA 3T3NA 2FN8A 2OR3A 1VJGA 2WV7A 2OAEA 1OXMA 4C0XA 1P18A 1Z6ZA 2NNLD 4IIVA 4ZHSA 1AJEA 3DEYX 4HDMA 5FUWA 5B1YA 5DTQA 1T9BA 1PL0A 1YWGO 2F7SA 2H57A 3AT1A 3EYAA 4U2KA 1ECPA 2V7WA 2TECE 4U7DA 2FPUA 4BLOA 3BTSA 3KQWA 4R9SA 2R00C 4GMGA 3BREA 3DAGA 1MN6A 3QVJA 4JASB 5IVDA 1WV0A 2IVFA 2YUIA 4MUEA 1A5AB 5DYYA 1A4IA 5G1OA 4D45A 4CNBA 4GH5A 4OQYA 3QVGA 5H4HA 4Q1BA 4NARA 1QFSA 1UXJA 1Z0SA 2XDYA 2VPQA 3ESDA 3KYDB 2TMGA 1Y8RA 3C41J 1RZVA 3OEHA 2EW8A 3FRJA 4KR2A 4L5AA 4BNYA 3PT5A 8GPBA 1ST3A 4N3GA 1Y7IA 4QPJC 2GZSA 2REBA 4RPIA 5AUPB 5KKCA 1X8JA 5C5EA 1UXGA 3RAEC 4LV8B 3MRTA 4MKFA 2HV9A 5JAZA 2DFLA 3ZE0B 4X64B 5BR4A 1C4KA 2I67A 2QX4A 2X0IA 5IF9A 1GTL1 4JV5B 3CE9A 3L4BC 4JVLA 4WK0B 3FOZA 1CP3A 2KBFA 4HDNB 2XZOA 5FOSA 1X74A 2JPDA 4N8DA 4AP9A 3KJFA 3PR2B 1JP7A 2CXNA 3T3MB 1RJWA 2IUEA 3ZLBA 1WKVA 1PD0A 1X3LA 2Q0SA 3Q0IA 4PC3A 4DABA 1RACA 3S1LA 3V42A 3L3BA 1SCAA 1WUTA 2EIHA 3AV3A 4A03A 1ZD4A 4LV5B 1BDJA 1WXEA 4HKTA 1THMA 2WE7A 3MFYA 3O8DA 2RGDA 4H7DA 1KL7A 3BWMA 5JVDB 2NYVA 2PH1A 2F4NA 4X8MA 2OFWA 3NUZA 3ZZ1A 3M8KA 1LKZA 1P8AA 3OCJA 4CDNA 5J2TA 4WTOA 3F49S 4BC0A 4WVLA 3HEBA 1P3JA 3FCXA 4PVDA 2PSFA 2W2QA 4BMXA 1EP3B 3KU4A 3E3AA 1MW9X 2YWDA 2XNCA 1KMQA 4I1RA 4V3CA 5JI3E 5IUJC 3USZA 4NCJA 4D4LA 1RC8A 5JS8A 5ALQA 4JI4B 3SYKA 2JIMA 1ZM3A 4IHQA 1IE3A 1SB8A 2GASA 3LMKA 4FMBB 2XNSA 1TXGA 2JHPA 3LPNA 4RBNA 4X60A 5DBOA 4ZVLA 5HSGA 4XGQA 3UQZA 2ZE8A 1E59A 4YIHA 2C4UA 2ZKIA 1A95A 4FI3C 4RVCA 2XUOA 1X80B 2E4ZA 5BVGA 2AJ8A 4JNCA 3U4DA 2CFCA 3GNLA 3IPAA 1LDBA 2O6HA 5F4ZA 3OIFA 1D1SA 2WT9A 1DP4A 2C2MA 1SOVA 1HE8B 2HA7A 4X41A 3O3CA 1TVEA 4LV6A 2NV6A 3SC4A 3D8HA 3C3WA 5ETJA 1R3DA 2OD9A 4IYRA 1T8TA 3M4JA 4CKBB 2HY7A 3E48A 4YJ2F 3RIXA 4OHWA 1EI9A 2AG0A 3UEOA 1T0PA 3WSVA 1T6XA 2H9YA 3SF8A 1CJCA 5KYWB 1KEVA 2W8BA 1H2EA 3GQVA 3G0GA 1CJSA 4WOKA 4WZAB 3VR5D 2KLHA 3R20A 5JECA 2O0HA 3OIUA 5DP1A 5F1OA 4AN1A 1S89A 2ZP1A 3A70A 1C7IA 2POCA 1C7QA 1U5AA 5FLYA 2GPYA 3WGUA 5JTUA 3KV1A 3AG6A 1WMEA 1WABA 1PL6A 1PT7A 2LGJA 3I92A 3JALA 3Q1KA 4Q24A 4RHCA 5KPJA 3EWAA 3O4JA 1M83A 3E18A 1J42A 4KXWA 1ABEA 2I6FA 3DBHB 5CNKA 4IMPA 2JIQA 1RE1A 1MOPA 2AR0A 3QXCA 1U28A 3W78A 2JIRA 4ZI7B 3I9LA 3LPLA 4JLKA 4V3BA 1Z2PX 3TLGB 3LV8A 1DDGA 4K87A 5DBEX 4ZZ2A 3NI2A 1U9YA 2IIVA 4GS5A 1LS1A 3EQZA 3QW2A 1KY2A 3MMXA 2OCXA 3VYSB 3MAGA 5BWNA 2E6KA 4XR9A 3HMQA 5CB0A 1W9HA 1OYYA 5J23A 2UZ3A 3E9RA 3KVNA 4E2XA 3K0SA 5CT6A 1IEWA 5BWMA 2YHSA 3Q8XB 1L5LA 1YRBA 4KZKA 1GAJA 2XUIA 3NOXA 5EIFA 4MQUA 2O8EB 4LDAA 2P2DA 3RYHB 4O2BB 1E2BA 1THTA 2C57A 4JBYA 5AXAA 1VL2A 3M82A 4RW0A 3DF7A 1RFGE 2EL9A 5G40A 3W6ZA 2QD3A 1TJNA 3RQIA 1SBQA 2VOJA 2JFOA 3B5EA 4YCJA 4XFJA 3N7TA 1G6HA 5LOVB 2X5OA 4INZA 3I34X 3LVFO 3CGGA 2FUKA 2X1LA 4NE7A 4AJ4A 2A7XA 3NHWA 4QFCA 3OZVA 3VPAA 3MW8A 5FA6A 3TRDA 2ZB3A 3PRYA 4XQEA 1EQUA 1YC5A 3L7NA 3H1FA 3QVTA 1GQ2A 1M7HA 3KJGA 2J9GA 1C0PA 2ZJYA 1XZEA 4J0DA 4JIGA 1KMCA 4PFSA 2O0KA 5FO0A 1KKMA 1XRQA 2OZEA 1OX6A 1MD9A 3DMTC 1JDNA 2DECA 4XA8A 3PGVA 4KWIA 4RXMA 1XMOB 1CIJA 4M86A 2OMEA 3JQCA 4E5UA 4KFUA 4F4IA 1CY2A 5BMVA 1JQBA 3DGFC 3SZGA 4EHNA 4XW2A 3JVVA 1OXKB 4DFDA 5KOYA 4DV5B 4EITA 1BW9B 3EW7A 1KE1A 2JFVA 1MOQA 1ND5A 1EDEA 2XT6A 1H0HA 1OV4A 5A4IS 5K45A 1SEPA 2W6OA 3GNSA 2BFCA 4MQLA 2MMCA 4M9ZA 1VPTA 4BVEA 1ZLYA 4W5OA 4R8KA 5TQJA 3VR4A 3T6KA 4M1YA 4MDHA 4I4TA 5AKGA 3IBYA 2RC6A 3LS2A 1QS0A 4XB2A 3SSAA 4IH4A 1NYRA 1QYXA 1X9GA 2P9JA 2I91A 3OTOB 2HR1A 5E3JA 4L4XA 1DBWA 1L5SA 4IGAA 3KQTA 4QHYA 3WICA 2JHFA 4LPSA 2XYGA 4KCGA 2NM0A 3FR7A 3G9UA 3G5UA 5F21A 4E2ZA 2WMNB 2Q4BA 1E61A 3BIWA 1WCWA 2R7KA 3ORSA 4GMKA 1DAKA 3DDWA 4V0NA 3RRFA 5K3CA 1RC0A 3FF4A 3SQMA 3V1UA 3CQ9A 1VB3A 2FUG6 1XNJA 1UBRS 3DDHA 3TKLA 3DCJA 2O7RA 3RU9A 5IF3A 3OZGA 3OPYA 1Z8DA 2QT1A 3U4HA 4CR7A 4LBWA 3ZI7A 2JCBA 2CB9A 2WNHA 4DTCA 5HCNA 1RQPA 3OURA 4DV6B 3ZJ4A 3V1LA 1FFGA 1WCIB 1QHSA 2QQ5A 1ZN7A 1REQB 1KETA 1RAGA 2X14A 3GL9A 5AXBA 3U7QA 5ALEA 1DAHA 3VI3B 2J48A 3LIPA 4INPA 4YLGA 4G0YA 3VKHA 5C53B 5LQCA 1OLXB 3X2FA 4XD7A 1DBRA 3DBLA 4US0R 3AJEA 1EBFA 1TECE 2G77B 4PTYA 3WLPA 3ERCA 3PUWA 4HQOA 3TZEA 3TBKA 2SCUA 5IUKC 4OIFA 4C7JA 4D6XA 1A2OA 3HADA 1AK1A 1MPTA 1ODCA 1T10A 3O8NA 2HJHA 3CNOA 2BF7A 3CEJA 3TLMA 1JLSA 1W5SA 1OXVA 1VOTA 3AHFA 1GUBA 2D4AA 1GG5A 4L5CA 2X3YA 1YXMA 4LJ9A 1JLRA 1M1XB 2OD7A 4LQCA 4MPPA 4O2BA 1BH2A 2CBZA 2QB5A 3P9NA 4TV9B 3UHAA 1JXQA 1Q0PA 4FWBA 4KGVA 3UK6A 3LXXA 4YMSA 5SY9A 2OHOA 1ILEA 1MB2A 3CZRA 1CC1S 4BQQA 1QCYA 2JGEA 4EB6A 4ZOLA 5IZCC 5GIOE 2D1SA 1FK8A 1NW5A 4UTPA 2HPVA 2I4IA 1WVIA 3BD8A 1K6EA 4PLVA 1NJ1A 1XLTC 1OI4A 1DVRA 3RT1A 4F91B 2OORA 2X86A 2P9CA 1XD2A 2OCGA 1V11A 5ILGA 3CXRA 2GARA 3QA3E 5SICE 1U1IA 1V6CA 2IYSA 5JWOA 3IP8A 3IKLA 2FCAA 5IARA 1RRMA 1ZOPA 2QRLA 3RFTA 4FC7A 1MRZA 1WCIA 2QTLA 3EUAA 4H1UA 4V0KA 4QVIA 2CSXA 1E3MA 4TSKA 3EZGA 2FW6A 4O0LA 1AT1A 2NSJA 3HBNA 4V0RA 4Z4FA 3COVA 3A8TA 1JLLA 3A1VA 1E1CA 3P0JA 3B5IA 2JJYA 3D6JA 5DI9A 4YRBA 1V5FA 2WR8A 3BX1A 3OZEA 2PQ2A 3BTVA 4UHJA 2OP0A 2H5LA 3AV0B 3K70D 1E3WB 3KJNA 1LBSA 3VU1A 5JSUA 1KO1A 2F64A 1VG9B 4PO9A 1XQ9A 4C0AC 1TYDE 2NQ2C 2NXCA 4WBNB 1PBTA 1K63A 3T5AA 5BO5A 2QJRA 3CEHA 4F7WA 2O3JA 3UAOA 4XVCA 3ROKA 1NZDA 2GCEA 4M7OA 1YE5A 3U9LA 2QUKA 1OC4A 2XUHA 4QTYA 4PSUA 3VJLA 3EAGA 5IC4A 5IT0A 1IXYA 4TYWA 2UYGA 1ESDA 1W5TA 2CJFA 3CX4A 4MO2A 4ZU3A 3RG8A 1UT8A 3DE5X 3NHAA 3REQA 4G3XA 3TIVA 4BWYA 1M72A 2YW2A 3L06A 2Z95A 3Q4GA 4OI4A 4TN1A 3CRW1 5B7PA 4W5NA 1Q0RA 5LP6A 4N8EA 1DAEA 3LDHA 1IXRC 5EUBA 4MDFA 5EZ5A 1AC5A 4RK0A 1RYDA 2H4ZA 4IR7A 2IYRA 1Q1NA 2QMYA 3RYCA 2O4UX 4IIFA 2P9QA 2D54A 1VFPA 2O07A 2QYHA 4G1BA 1E1KA 1XFAA 1KP2A 2XYRA 3I6YA 9ATCA 2V6IA 5E1MA 1F4PA 1Q7EA 2MIIA 1SXJA 4FUQA 4GNRA 4DM4A 1US8B 2OTCA 3U2QA 5JWRA 4DIKA 1RZ3A 3P9ZA 5DNCA 1CEEA 1WXHA 5ALYA 5DULA 5K20A 1UBSB 1OXUA 2N1BA 3L8MA 1OFTA 4OQDA 2J67A 4DV3B 4EF4A 3H6GA 1LPMA 3BJIC 1U7OA 5DXFA 1PDVA 3V3TA 5HGXA 4URFA 1S7CA 2QM0A 3MGGA 2GUGA 3PVZA 3TXAA 1RWQA 2VHTA 3NBMA 1MP0A 4D26A 1F3LA 1W5AA 4DSUA 5KX5B 4ZCRA 1JH9A 1RXVA 3WJ7A 3MCWA 3C8DA 5K0JA 2OV8A 1CUGA 1G9TA 4ES6A 1NNUA 4IOMA 4LJ5A 1TM7E 1SUDA 4JYBA 4ZO4A 1Y82A 3ICWA 2BM1A 4IJVA 4YNBA 4E13A 1KEKA 5LQNA 2J08A 3E61A 1IJBA 2NU8B 3U40A 2HBZA 1Y6GA 1S8AA 1LVUA 4G0MA 2HMYB 1OYVA 2G6BA 2PKEA 3LUAA 2COUA 2QN9A 2BGMA 4UHBA 1IQRA 2QYSA 3L4SO 3KKEA 4B8ZA 2A9PA 4RHYA 5FYDA 5T4BA 2MDTA 1XTIA 2WD9A 5LDHA 3QUQA 3E9EA 2FPMA 3V9PA 2BGWA 3E3MA 1R0SA 3AY3A 4IF6A 3C6QA 1HA3A 3I83A 3NXKA 3L0SA 3RC1A 5ECYA 1UDCA 3UWSA 1AKWA 2GZAA 2QY6A 1JHPA 5JD3A 4RTSA 2XOEA 2B5WA 4DCUA 1OAKA 4JI1B 1QANA 2HF2A 2VYCA 3ZE6A 2XCSB 4NXNB 4WCDA 2N3ZA 4IRMA 1H6DA 2V7XA 4C9BA 3WNBA 4BKUA 1P2TA 1TK2A 1X1DA 3WK6A 3GJRA 4DSAA 1J56A 2Y6VA 1M2VA 2ZRHA 4FILA 4P08A 4PZ0A 5TIIA 1CR1A 2A35A 1JAZA 2DHQA 2GN1A 3SM9A 4HS4A 5F9FA 1YAJA 5E4FA 5EE5B 1QB7A 3UCEA 5HBGA 3TMYA 3CEPB 1WQ1R 3DR3A 3GV0A 5KNCA 1SQ6A 4NAHA 3AF2A 3S81A 1R4MA 1SUBA 2PPVA 4XM0A 1USKA 4IJWA 3LLSA 5T64A 2OBNA 4JYPA 4OHYA 2EBHX 2O8CB 3VNBA 4D92A 1EQAA 2PD3A 4RKRA 1PR1A 2FSVA 5K0LA 1L5VA 3Q2KA 2GSWA 4MRVA 2AJLI 1T36A 3DZIA 4X1KB 4CT0A 4BQPA 3TBFA 3BIFA 3RC7A 2IIPA 4HB4A 1W59A 1V37A 4MUXA 5D3MB 1G3IA 2Q4RA 1CULC 3U6BA 3FVTA 4YTEA 3F7MA 4NZOA 3W4JA 2B3TA 3VAYA 3LRPA 4QSHA 1XYGA 4HDAA 1CJBA 1IG3A 2BBTA 2HSWA 2PR2A 3HEMA 4C2AA 3G2LA 5FUQA 1SXQA 4DIDA 4TQUS 5ESDA 5LLSA 4RYDA 2ADMA 3C3YA 1YIDA 1Y1SA 1QCDA 4KBYA 2V9ZA 1JEDA 4X8OA 5EXDA 3AEKB 4FW8A 4AVYA 3C5VA 1W1IA 3C3EA 3A7DA 3IUYA 1BOOA 4NZPA 3RLFA 2I6SA 3PCXA 2LE0A 1E2NA 2IXAA 3O2SB 1N6PA 1E1QA 4FDVA 1GUFA 4WRRA 2V59A 2QD5A 3OJWA 4NBLA 1HC7A 2B92A 4L0QA 5TQ2A 4UJ5A 3DNPA 3EGXA 2XQVA 2FW8A 2CJXA 3MMPA 4MVJM 421PA 5KTKA 4REOA 4QOIA 4G1UC 1OSNA 5EQDA 1REQA 4Z3KA 2OV6A 3RYTC 4EY7A 5IXJA 3K6JA 4HDSA 2E4UA 4B84A 1JFTA 2NMVA 2IJGX 2ZCJA 2BFNA 2FTKE 2DT5A 5DRYA 3EQ9A 3AYZB 4YAOA 3ROQA 1ZCZA 1SXJD 3T3IA 4G8DA 2GDZA 2XUDA 1FTGA 3AVWA 1I9GA 1Z4KA 2CVPA 1TIPA 3CX8A 4IV0A 1GA1A 1GKLA 3PDJA 4GOLD 3IQHX 4HRVA 1CHNA 4TOIA 1F1BA 4BYMA 3ZD6A 1DBPA 1HKHA 2XTJA 3H1BA 2NXWA 3L8CA 3BGWA 5AKYA 2GAFA 3B6ZA 2F9LA 2JGJA 1N8SA 3M9WA 1LRLA 2FCRA 3NBAA 3NB0A 1G4HA 3GJ6A 1VRWA 4P1ZA 1QF7A 1RABA 1IM8A 4RF3A 1UBCA 1D2MA 1ZG3A 2O7NA 3NUGA 1G20B 1YZUA 1MV5A 4EKGA 2F55A 1FCJA 1WCXA 2V4ZA 5AW3A 1C1XB 2Z1DA 1U63A 1E32A 1E3DA 5KQSA 3BL6A 1PX2A 2LW7A 4NFLA 3ZIAD 4ZAGA 1KI8A 1FP6A 3P9RA 1E8NA 1KS9A 5AKKA 3WHIA 1PR3A 2VP3A 1W49A 2PAAA 3TLKA 3M4YA 5KQPA 3IE1A 3FLAA 4U7JA 4ARVA 2XI4A 4XWAA 1ZGHA 2XEDA 2V3CC 5T8KA 4RMHA 2ZSHA 3O3OB 3TDNA 3VC2A 3DR5A 3QI2A 2Q4DA 4JI0B 1FDTA 1ZMTA 4P7FA 1XMXA 5FBRB 2RKBA 1S9DA 1XTSA 3ASYA 4LY3A 3E0XA 1AK2A 4RPKA 3RSOA 5D5HA 1BDBA 3C70A 1VTKA 3IS3A 5REQA 2O2HA 1QGUB 2ZOSA 5JVDA 1RMTA 1RJ9A 1SCUB 3C6MA 4RVDA 3S70A 1R4MB 4BFVA 5IAAA 2ZQZA 5EJ5A 4GM0A 1M73E 1CEYA 3ZYCA 1H3FA 3HI4A 3LO5A 1H3EA 1KRWA 4XQ9A 1XOIA 1EG7A 1IEVA 2WSSA 1MC1A 4J9UE 4QEZA 1WPRA 1J0CA 2VWPA 4GMXA 4HQ0A 3V97A 1Y4UA 4BNIA 9GPBA 3R6LA 3SYMA 5D3KA 5JAUA 2MT9A 2DFVA 2J6HA 3EEQA 1CQZA 2ZM6B 4OBEA 1W36B 4ZT3A 3ONDA 3OQVA 5A4MS 1O6GA 2R1TB 3VPCA 4CF3A 3CW2A 2J0QA 1CUIA 3DLAA 3N59A 2C4TA 1GZUA 5JCZA 5FQOA 1ONOA 2PFSA 1IXSB 2AGVA 1Z8HA 2XLBA 3NM6B 5ALFA 2XHEA 5ERXA 1CBUA 2WYIA 4AG5A 4HWRA 4EG1A 1Z5UA 2CXTA 4QLAA 3NH6A 3ZDRA 3QVMA 1DRVA 4C7OB 1XVVA 3BDIA 1ZMXA 4FZ5A 3B6EA 3AONB 1U99A 4MGYR 2HD4A 2Q3BA 1D2AA 2WM8A 1STOA 1QF9A 2ASEA 2Y2VA 2O6LA 3IAS6 4H0CA 4J0JA 1E6EA 1JEAA 4N9QA 2GYWA 5AMXA 4ENRA 2DH5A 5A9TA 2B0JA 1EK1A 3A3YA 1ENYA 4MGIR 2G17A 3PGJA 4CWAA 5F2KA 3KOMA 2YRFA 4TXJA 1TVCA 2OSVA 3KPWA 1AN0A 2Y1FA 4ITRC 4JUAA 4ZT5A 3RBVA 2ETVA 4Z7NB 4E3WA 6REQB 2JLVA 4MWGA 1R5BA 4NHEA 5DLEA 4C01A 3K0AA 1UPXA 5EMMA 1P44A 1M0WA 1SC9A 3IVXA 3O2NA 3DKPA 1JG2A 2C88A 4HHEA 4RV5A 4UTNA 2R6AA 3NYIA 3BXFA 4EG7A 1ZUD1 3DZHA 4YRJA 5IS2A 1OUMA 3D64A 3EUFA 2QG4A 3W3ZB 2FSIA 5KO2A 1EFPA 2W6NA 2HHAA 3KLMX 4QGBA 3SK0A 2QUHA 2VDLB 4ME6A 5EIWA 2GPAA 2VJMA 3RIHA 3HSYA 4PBSA 1E2KA 4D9BA 1FLDA 4KP7A 2XTNA 3I30X 2ZWOA 1R9NA 1TCCA 5FWDA 3H5TA 1K4MA 3MWDA 2L0XA 1S3SA 3AUXA 4UHEA 3FMGA 3KFXA 3L7LA 3P7MA 3PQ4A 1N9KA 1MGPA 3E9CA 2UKDA 4ZZIA 4IRXA 2AOTB 2E4WA 3BL5A 4RKQA 4A8PA 5KU7A 4AMUA 2AFRA 3OF5A 1QZZA 2WSBA 3AEQB 3MCTA 1GNQA 3I2KA 2HA4A 4EJSB 4ZHQB 1ESZA 2H1SA 4N3NA 1A9OA 1OKKD 1TVKA 3O3NB 5DW0A 3AF0A 5TXGA 3SBOA 5A2GA 3OETA 2OM2A 2PH3A 1QKKA 3MINB 2B4AA 4BNWA 1OB2A 4DSOA 1JDJA 4M7PA 5KQMA 1EUYA 4YR9A 2HJGA 1P31A 2JLBA 4POAA 4JBNA 3KHTA 4EGCB 4BVLA 2IS2A 1G1MA 4L50A 3L8GA 4R05A 1ATIA 1ZWKA 3GCWA 3KFLA 1EVIA 3NRBA 5DTJA 2AIRA 2Q50A 4NX2A 1BMQA 1L9KA 4ZYWA 1WY7A 3OFJA 5BYJA 4JEHA 3WP1B 1JEOA 4HXGA 1UJ4A 4JVNA 4ALLA 1H3NA 2GESA 1V8FA 3E35A 4H60A 4L5IA 3ET5A 1OBOA 1GRRA 1WIWA 2RGEA 1ZGGA 1KA9H 2XH8A 3AI7A 5KTRA 2K4MA 2MSKA 1ZUIA 1IBCA 1VGQA 4HWOA 5HR5A 1BDIA 3FAZA 3CZ9A 1XKTA 4ZV4A 4HGOA 4IJ5A 3KUDA 1UKBA 3ZWBA 5ES4B 3LVBA 3X1YA 1GQQA 1I51A 3M4ZA 4UNRA 3H2YA 3NM4A 3DYVA 2CNKA 5ED0A 1ZIOA 3HVJA 2Q29A 1ZX1A 1AKMA 3JQAD 5EIXA 3TKYA 2RHTA 2C5GA 3O82A 3OU2A 1C0LA 3DO5A 2Y93A 2JD1A 1VZ2A 3IVGA 3UUGA 5A06A 2O7VA 4UASA 1O96A 4GP9A 3KVRA 4KLCA 3UATA 3V8QA 3REOA 3MWKA 1M33A 1DIGA 3MF4A 2JFWA 1FJHA 3BXEA 1LC0A 1P9LA 1P2DA 2CHFA 3CY6A 1PL7A 4MRMB 4K9PA 4Q39A 5FTWA 4E5NA 3UMMA 2PWYA 3GYGA 4MWTA 1EESA 3RF6A 1EFDN 3SEQA 2RONA 4TYPA 2NXEA 2R8XA 4QUAA 1E5TA 5EZ6B 2I8AA 3ZQJA 3GVPA 1ZBDA 4W1RA 3GN2A 4FFLA 3IAUA 3ZJYA 2F8MA 5I51A 1P0MA 3UK7A 3F67A 2VJOA 1KYTA 3MWJA 4N0DA 3FGPA 3WTCA 4A82A 4ZCTA 1KYYA 3MEQA 2O8FA 4RK5A 1P4HA 4G56A 1XL0A 2P27A 3LBNA 1JNYA 2W6MA 2RJ3A 2CFOA 2OA0A 5EJ6A 3KQLA 2GPSA 4XCXA 3RM3A 3D6FA 1CZOA 1XJCA 1NI3A 1YACA 4M9CA 4XRRA 1RQGA 5AI9A 2VTBA 2W70A 4OHOA 1O87A 4HVLA 1RHRA 2OV3A 3LCVB 2NZ8A 1PKXA 2OV1A 1U90A 4X65B 4W5HA 2EX4A 2XBLA 1CR2A 1HLDA 1XWIA 3BB3A 2HOQA 4RKEA 4CFZA 1XSEA 2VZLA 3R3ZA 4OK6A 4L0DA 5IFKA 2C4VA 5E1DA 4MV7A 4PAOA 2WD7B 1LY1A 1N7IA 1PS0A 2IZ5A 2FDRA 2VSQA 4PFJA 3UIEA 3WJAA 4HAXA 1JYEA 3HJUA 4DNOA 1A7JA 4MVYA 1LBIA 1XD2B 2HXGA 1GSHA 3P9PA 1RQNA 2WPDD 3OOWA 3OQJA 1LWNA 2V74B 3IT0A 5KYXB 2MINB 2YWFA 1TEHA 2WWFA 3C7DB 1CUAA 1E7YA 4XUCA 4UQPA 4HGRA 5F1YA 3RAGA 3KQYA 4C5CA 2C2KA 2QXTA 2ONKA 3P2IA 5HQJA 1DEHA 1RWKA 4ZANA 1WXIA 3WIVA 1QIHA 2F90A 4DMLA 1BROA 3QBTA 2OUKA 3SC3A 2H48A 1O54A 2M2IA 3ZQ6A 5JSZA 5JDIC 3V1KA 1YJAA 5BMOA 2F43A 4NMWA 3VPFA 2QEQA 4E2YA 1FEZA 1QVRA 1CQIB 3NAMA 2W83A 3B3FA 3FZYA 3VO9A 1CQWA 4YP1A 3ZHRA 3ICEA 1Q1QA 2BRUC 3CT4A 4JVMA 4II3A 3IALA 2CVOA 1Z0IA 3OHSX 3N05A 2BSXA 2I2WA 4DEYA 5L4SA 2WINI 4MB2A 3B3QA 4PLYA 4PRLA 4R1QA 3PHGA 4B7XA 4Z4IA 1UAGA 2QN1A 5TPZD 4BP8A 2V55B 5B30A 2O3QA 1GDTA 4HUQB 4C1BA 5JT1A 1QPZA 4MP3A 3R44A 3DE3X 3DOFA 3K9CA 5FUMA 5ENDA 2QG9A 2ZBQA 3OP1A 2PNFA 2YCBA 4JA2A 1KDVA 4DA7A 1M1YA 3KIPA 5GADl 2BISA 3ESAA 1B8NA 3G6KA 4ED9A 5LD2C 1CE8B 2AOWA 2GJ8A 3T1NA 3Q10A 1QGDA 3BIJA 3ELDA 3IPCA 5HMLA 1PEDA 1JLMA 1AH2A 5INTA 3WYGA 1U2PA 1F14A 1XXLA 4H3HB 1DHTA 1LQ2A 2DHDA 2NN3C 1JA9A 2IEGA 2CBXA 2ORIA 2RHRA 3GRFA 3BHJA 1Z5ZA 3DOOA 3OMWA 5AK6A 3NVKI 3QV2A 3GLTA 1IOWA 1V5IA 3PIRA 3O95A 3D6TB 3CLVA 3ABSB 4UNSA 3TUJC 1CUCA 3C1TA 3LYHA 1GRCA 1SBNE 2TMKA 3I9V1 4Z99A 2EKBA 4UOZA 1XZAA 3P0RA 2NWQA 4J8PA 5GMOA 2A9QA 4I4LA 2NV2B 1NN3A 4AECA 1KH1A 3B3JA 4PTZA 5MFPA 3EXHB 4EHFA 1RXUA 2AD1A 2DTEA 4MYCA 4W99A 3UTCA 2I7TA 3K6RA 3N8DA 5PNTA 1VL6A 5C18A 4TZ6A 3C5CA 3TQSA 2MR6A 5IT9A 1SQ0A 3UWMA 2GN6A 3PNVA 4ZALA 4A27A 5BWOA 1S2GA 5B6IA 5FKJA 3M9XA 1PJQA 4OQNA 3AR8A 3HYCA 2PUHA 3NR2A 4OKNA 4RNDB 1UOOA 1UM8A 4RD2A 3GYBA 2YJ6A 3PZBA 1DCMA 4FHCA 2B2XA 5KX5A 2MSDB 2WFLB 4OHVA 3I0NA 2HHCA 2B61A 4YEDA 4BNDA 2HMVA 4KQHA 1JDPA 2BGUA 3A4TA 3JV7A 3ZJUA 4H4EA 4Y2JA 4BFSA 3O8CA 1ACMA 3O47A 4I1VA 2NO0A 3WKEA 3GZNA 3VH4A 1XZJA 1FTSA 4NJMA 4NFHA 4J2HA 4R01A 2I6UA 2N9UA 3RASA 1FJ2A 1BX0A 2XGSA 5BSVA 2DQZA 3EK2A 2C7GA 1C3OA 1GKIA 1GTRA 1N6NA 4D9CA 4GXRA 4BBPA 1EXMA 1SEVA 1SCBA 2CLMB 2RB4A 1PJ8A 5ARDA 1SULA 1JZTA 3HZOA 3L1UA 5TLSA 3DP7A 3PUYA 1VJTA 4XIGS 5DBIA 3Q8WA 4D41A 3R5HA 4EO4A 1OILA 4I4IA 2B5OA 2QMZA 1M1NB 2G71A 4RABA 4TYMA 1YUBA 1AKTA 3VZRA 3SBEA 1Y7HA 4YVFA 1KPHA 3BH0A 3MJTA 3FCEA 4XOIA 2DPLA 2IODA 1Q95A 2Y0DA 1D4OA 2ECKA 5F52A 3TSWA 2C7RA 5HIIA 1H9CA 4UEJA 3MCZA 1P1BA 5KNBA 3NWOA 1KO8A 3WBJA 1ZUHA 3DLPX 1I1NA 1AA6A 1QZXA 2J3MA 5L95A 2FX2A 4BS9A 5E4JA 1BMFA 2WU1A 1NMEA 2QP4A 3AR2A 4QT4A 3VHXA 4DDHA 5K0EA 2C97A 4ZOEA 2PANA 1QU3A 2PRZA 1B74A 1JT2A 5AJHA 3PXGA 2H4FA 1Q7GA 1U0OC 5IEJA 2YYZA 5E7IA 1TM2A 3U4IA 4YMGA 5JFTA 3PC8A 1RXIA 2NZVG 1YNOA 1PGNA 4LG1A 3TQQA 4WEOA 5HDQA 3PQ8A 2C8JA 3ONWA 1Z6GA 1Y4ZA 2R97A 4LMPA 4BB9A 1JV2B 2OFXA 1DC8A 2HIAA 3S2IA 1XBTA 3HB9A 3QLVC 4XX0A 4AI6A 2XYHA 3K94A 5SYNA 3KJXA 2I4OA 1T6NA 1XRMA 2PZJA 4PCUA 3ER6A 1KZHA 3OEHD 4DGSA 4E4YA 3J81A 1SCJA 1UM9B 1BCSA 1HG1A 3JVIA 1VHTA 3B12A 1OHHA 2AZTA 3R5FA 4MPJA 4X6XA 4ZXPA 2J5XA 4L9AA 5KNLA 4QREA 4CEIA 2Q45A 4WI1A 4Q3DA 3TH5A 1C8LA 4PSDA 3IEPA 4JLDA 1O8CA 1PSZA 1TYAE 2JGMA 4QYXA 3JSAA 4TQGA 4PZLA 3SDSA 1FMJA 5MHTA 3F2IA 2AC2A 5DSZA 5FPPA 5TF0A 4FNAA 1K97A 1LXCA 3RBZA 1SC1A 4LXUA 5IEBA 1CZLA 3KUXA 4O4HB 3WB2A 4CZ2A 1YJ5A 5G0WA 4KW7A 4MWOA 4R40A 3IQXA 3SJCA 4MV1A 4XYEA 1OLSB 4CLRB 4R2KA 2HDHA 4ABTA 2PKCA 2OORC 3M3PA 3BM5A 1DQZA 1FBNA 1UADA 1NBHA 3LBIA 6GPBA 3HNPA 5DNDA 4KE6A 4B74A 3O8BA 4PHHA 5EE0A 1HT1E 2Z8YA 2IZOA 2AF4C 4FYMA 2OQIA 4M4SA 3WGIA 4M22A 3NBKA 4BATA 4O3FA 1NWHA 3HWWA 1O08A 3TAHA 3OZDA 1UR5A 2MSWA 7ADHA 1UFRA 4WZ6A 2I03A 3KP1A 3ZCQA 4EI7A 1MJFA 1SKYB 3Q5DA 2UUCB 3JATB 2H5EA 2YJNA 3HU2A 1U3DA 2VDVE 3FYUB 3EG5A 3LA6A 2AFIA 2QLBA 1PX0A 2YZMA 4CHGA 4Q9NA 2ZI4A 4BNJA 4F3TA 2CF5A 2MSCB 4GSLA 2DQYA 1CCWA 3T5MA 2ATIA 1KZ1A 2IH2A 2Q28A 2YOHA 3VDRA 2R65A 3PTLA 2WV9A 4YRAA 4A91A 3B53X 1DUVG 3KCQA 3QKSA 1N77A 3KQUA 1HYEA 2FXVA 5JAQA 2QRGA 2V7QA 2ZLBA 1ZK3A 2C7PA 2NO1A 1VJ1A 1MAAA 1OTYA 4GOOD 2NSHA 1GFZA 4HAUA 4MQEA 1NW8A 4FOTA 3DQZA 1G21A 3PX3A 1O5OA 1M1ZA 1XCGB 4BP9A 3Q41A 5BQPA 3TJMA 1P1FA 1NPTO 1W0KA 4BNKA 4E3ZA 1PWHA 1DKMA 1FYFA 4G5SA 4RVNA 3V55A 4YCBA 1NP6A 2P3OA 1RAFA 1GAXA 2VJYA 4H08A 1BQEA 4M1MA 4QVGA 3WRXA 1JI3A 1RWXA 3IP1A 4V1CI 5EHXA 4HZIA 2X5KO 4IJUA 4HR7A 3E9QA 2V97A 3EA4A 4Q0MA 3TSAA 2V65A 2A5JA 4P38A 5E2IA 5K8JB 2JAWA 2IDMA 4CMBA 3WHPA 2GBIA 5LKAA 3C6ZA 2EBUA 3UB3A 1VJ5A 4LZNA 4MGEA 1L7NA 4CR6A 4NOLA 2W7TA 2XA9A 4C6TA 5I48A 4M0UA 4ZVUA 4J1SA 1QRSA 4P93A 5K8LA 3KYCB 4LPKA 5C34B 1PR9A 3UAGA 4A16A 2YUTA 4EVRA 1YOVA 3GI1A 4N0QA 3K9LA 4XDYA 3ICPA 4RDIA 1YBHA 5C3MA 5IAEA 3S1AB 3A31A 1EK2A 1WBBA 3PUJA 1NULA 5KSOA 4KR9A 5C7YA 1OFUX 2WF9A 3C8ZA 4KDCA 1DPGA 3DP9A 1YI1A 3PJDA 4CV1A 3RPEA 2KJQA 4DZRA 3AKZA 1V39A 5KMGB 3P2YA 3T5TA 4IWNA 1GLNA 1KRXA 4QEDA 2BGIA 3W04A 3E15A 2PUBA 5D6OA 1YDMA 4ZEVA 3WSWA 1T5DX 3SEAA 2ZRGA 2PIAA 4UM7A 4H77A 1IOZA 1GIAA 1LU9A 1IY8A 3O4RA 2A2ZA 4RIFA 3L0YA 1VFNA 3V2HA 1TGVA 4RS4A 4S12A 4YYEA 4I4TF 3M7IA 6YASA 2DBYA 2NACA 3I2YX 4B34A 4DUGD 3A37A 4PNPA 4XKJA 2CWWA 2LBPA 3OX4A 1E69A 1NLZA 2CN1A 3DDNA 2C29D 4LCBA 1X86B 1B42A 1I3KA 1SUCA 1RYFA 1E4EA 5H59A 3MMZA 3RRMA 3DE4X 1JT9A 1RM3A 1CVLA 1AURA 4R81A 3S2ZA 4UZSA 1I1QB 3EZNA 3TW8B 3L77A 1DIHA 4IG9A 4C03A 2HMUA 1N1EA 3GNTA 5IK2A 5E7MA 2D4HA 1XLTA 1OFUA 3NNNA 3NV7A 4JS0A 1F9AA 4UCQA 3FKSD 4TRRA 1FQJA 5EG5A 4D6YA 4ER5A 5FI1B 5JZMA 3ER8A 1VA5A 1JAYA 4U7WA 5AWFC 2IUYA 3PRJA 1D9ZA 3HWRA 4M36A 5JCOC 5JAMA 1RU3A 2PBFA 2VDNB 5F7JA 1N6HA 1DAGA 1M66A 1B6RA 2DVMA 1KY4A 2G0NA 2Y3IA 3LSTA 4TT3A 4QATA 5L8VA 3O83A 2JEYA 3WLHA 2PSSA 4CQLA 2YIJA 4RQTA 2UZ1B 1G98A 2IUTA 4KXLA 3ZY4A 4BIIA 4ZI2A 1SU8A 1H85A 2XE6A 2LZ0A 3EZ9A 5B55A 5KWEA 1Z12A 2WIGA 3GFRA 4ISBA 5EINA 1YCGA 4CKZA 4FGJA 3WLNA 5HM6A 3HPQA 4YRZA 1QAMA 3NCTA 4IXMA 3HBJA 3VU9B 4YUVA 1JB9A 1GN8A 1OW3B 1SU4A 2GVNA 3NVMB 5IJAA 1FRVA 5AW1A 2GZ2A 1QHEA 1N0WA 1R1DA 2V5AA 3PGA1 3LT0A 4WK4B 4OJQA 5AVOA 2UUAB 1Z73A 4FR5A 1DINA 1GGMA 4Z1MA 3DG9A 1US8A 2R48A 3OIYA 5SV2A 2QQGA 4F4JA 4LMRA 3FTNA 4AJLA 1QHHA 3L6DA 3UJHA 1YFLA 2AQKA 3KTAA 4CR8A 1GCOA 2JVKA 3Q40A 1ML3A 5EE3A 1VB5A 3PR3A 4G4GA 1GN9A 4H15A 1NF8A 5TF4A 1ADJA 3OECA 1Y7LA 1KSFX 2W71A 1Y1QA 3INRA 2Q8NA 5JISA 2H0RA 3KQSA 5F35A 5LZ2A 3IAXA 1WPXA 2HRBA 5HF9A 2ZVQX 4MKZA 4CTNA 3MMNA 1LFDB 3HCEA 4NYIR 4D0SA 1IXZA 3D2BA 4OAOA 3P9SA 1K2VN 4FM9A 4MUMA 5K6TA 3VYUB 4HNRA 5CW2A 2KBEA 4JNKA 4DVJA 3ZWOA 2I65A 4BVFA 5CB4F 2FA9A 4AN0A 1EAMA 2WSYB 5ITVA 1H2WA 1Z08A 3NHLA 1EK6A 2P78A 4DRYA 3DZ8A 4Z7OB 2GJSA 4HGPA 2X9LA 3TLXA 4GYYA 2BZ0A 4PLGA 4YRCA 2OXTA 4A0FA 1YI8A 4G5RA 2DETA 1JZQA 3FRHA 1TGYA 4RA9A 2OM6A 1QIEA 1KGSA 4EEXA 3FMIA 3B6JA 1Z33A 4QUHA 3MCUA 2BONA 3IE0A 3JZMA 3BXGA 5C7LO 1CQJB 2AUTA 3QKUA 4GYKA 1KI6B 1WUYA 2EW1A 2V54A 3VOBA 1W52X 1QAQA 3E82A 4F6RB 3WK4A 1D4AA 4LI0A 5AI5A 5FAXA 2ZIGA 4JA0A 1QK4A 2QX9A 4EFNA 1KBOA 3EA5A 3DUFA 5DLPA 4L3VA 2JIZA 3QUBA 2B7BA 4RLHA 4AJOA 4LF9B 4KIWA 2E21A 1C41A 3V4VB 3WRYC 2IEAA 3G9TA 1F2VA 1M76A 3MGBA 4NDZA 1EFUA 4E2FA 1PJTA 4BE4A 3H0CA 1AZLA 4EW3A 3TECE 3ETDA 2IYQA 3JWIA 3QHQA 2QRUA 4FGWA 1K7FB 4YHHB 2OG1A 2OVBA 3G6WA 3KYCA 3T3HA 2O1XA 1G41A 4W6QA 3VTAA 5J58A 1GKKA 2B8NA 3N86A 3PQ6A 4OI0A 5HKBA 5CPBA 3ONEA 5C5IA 2Z9BA 2I1VB 1NBIA 3A1UA 3R0QA 1N9GA 4MKGA 3OEWA 4Y8VA 5CB4B 2C4MA 5CCEA 2CMKA 4IKPA 4RZHA 5IABA 4QVKA 1B00A 3AHGA 4A36A 3K1TA 4LIPD 4EG3A 2FPIA 1KO5A 4O25A 4OGKA 4PAWA 4YJHB 1RI4A 5LXTF 4AX4A 5JXGA 3JQAA 4AZTA 4FOLA 4ZGWA 4X1IA