4BCWA

Carbonic anhydrase ix mimic in complex with (e)-2-(5-bromo-2- hydroxyphenyl)ethenesulfonic acid
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
Knots found
sequence length
257
structure length
257
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBONIC ANHYDRASE 2
publication title Sulfocoumarins (1,2-Benzoxathiine-2,2-Dioxides): A Class of Potent and Isoform-Selective Inhibitors of Tumor-Associated Carbonic Anhydrases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 78
structure length 257
sequence length 257
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 4bcwA00
1G4JA 4IDRX 3M1WA 3M1JA 3TVNX 4E49A 1CVAA 2WEHA 1FR4A 4RN4A 5BYIA 1FQRA 4Q99A 4ZWZA 3FFPX 4Q8ZA 1LGDA 1ZH9A 4YXOA 4Q7PA 5A6HA 6CA2A 1KOQA 3MHOA 2NXSA 1TBTX 3CYUA 3VBDA 3PO6A 3RJ7A 3IBUA 4Q09A 4ZX1A 1CNGA 1IF4A 1FR7A 1HEAA 5SZ7A 3Q31A 3BETA 1XPZA 4KAPA 1YDBA 5FLTA 1FSRA 3M3XA 1IF5A 1URTA 2EU3A 1CALA 1RZBA 1RZDA 3ML2A 1BNVA 3TVOX 5DSJA 4COQA 4RFCA 1IF6A 3RYXB 4HEZA 1BNMA 1YO2A 1CCTA 5EHVA 2HKKA 3S77B 5DOGA 4C3TA 1HEBA 1DMXA 1I8ZA 1BN4A 1OKNA 4M2WA 5E2SA 4QTLA 1TH9A 4IWZA 3MZCA 4MDMA 3V7XA 3P58A 3OIMA 5FLRA 1V9IC 1CNIA 1Y7WA 1MUAA 3DAZA 4QJWA 1ZFKA 5FL4A 4XIWA 3S72B 2OSFA 3NB5A 1CVFA 4QEFA 3U7CA 1CNYA 3JXHC 5DSIA 3OKVA 4CNVA 4RIUA 3P5AA 3KWAA 3T5UA 5JEPB 1G52A 1UGCA 5C8IA 3FW3A 3M98A 5DSPA 3FE4A 2EZ7A 4X5SA 4E5QA 3D0NA 4RFDA 5E2NA 3OILA 3IBNA 1CA3A 3M5EA 4E3GA 4YGJA 4LHIA 4Q87A 1TEUX 3V3HB 3LXEA 4RH2A 4FIKA 3KIGA 4YVYA 1AM6A 1TTMA 1DMYA 1CNKA 5FNKA 4YX4A 3JXFA 3RYZA 1TEQX 4FU5A 3S71B 3RZ7A 5EHEA 2FW4A 3DC9A 1BZMA 1CAIA 1LZVA 4QK1A 2WEOA 3DCSA 1CVEA 4BF1A 2NWOA 3DC3A 2NNVA 1CCUA 4ETQC 4Q7SA 3S76A 3T83A 1DCBA 8CA2A 5L3OA 1I9LA 3V3GB 1RZEA 3MNJA 4Q8XA 1T9NA 1BN3A 2FOUA 5JQTA 2Q1QA 1A42A 3MNIA 3EFIA 3R16A 4ITPA 3BL1A 3MDZA 2ABEA 2CBDA 5DOHA 4Z1JA 4L5UA 2VVAX 5JESB 1G46A 3S9TA 1TG3A 7CA2A 9CA2A 1ZGFA 5SZ0A 5E28A 4ZWXA 4GL1X 4FL7A 4HU1A 1I9PA 1UGDA 1JD0A 4QJ0A 1HUGA 3K2FA 2EU2A 1XEVA 3M67A 4LP6A 1I9MA 1FQLA 3PJJA 3SAPA 3MNAA 4QIYA 2NWZA 4JS6A 1CINA 3S78B 1XQ0A 4Q08A 3UYNA 3D9ZA 4MDLA 3RZ5A 4E4AA 4HEWA 4BCWA 1HECA 3M2NA 4PYXA 4Q9YA 3MWOA 1OKLA 4QJOA 4Z0QA 2NMXA 1G3ZA 3MHCA 4JSAA 3RG4A 3IEOA 4ITOA 3IAIA 1G0FA 4HT0A 1FSQA 3OIKA 4DZ7A 2IT4A 3ZNCA 4L5WA 1G6VA 1F2WA 2NWYA 1DCAA 2CABA 1Z93A 5CLUA 2H15A 5EKMA 1H4NA 1CAOA 2OSMA 5EH7A 1CAHA 1BV3A 3CAJA 3T5ZA 3V3IB 1G0EA 1RAYA 1I91A 5HPJA 1CVBA 2NNOA 3OYQA 4KV0A 5FNJA 3V2JA 4WL4A 5FDCA 4CNRA 3P3JA 5G03A 5SZ5A 1CIMA 5E2MA 4E3DA 2HL4A 1ZNCA 3KOKA 4E3FA 3PYKA 3M5TA 1LG5A 1CAZA 4Y0JA 1KWRA 3M40A 4YGFA 3V2MA 4KUVA 1OKMA 4FPTA 4Z1EA 3NJ9A 4Q7VA 2F14A 1CNCA 3KKXA 1RZCA 3KONA 1I9NA 5G0BA 3ML5A 2FMGA 4KNJA 4E3HA 3S97A 2NXRA 1KOPA 4RUYA 3DV7A 1ZSBA 1CNHA 5CJFA 4L5VA 1CNWA 4QY3A 4FVOA 3OY0A 5FNGA 1BNTA 3P44A 5SZ4A 1H9NA 4ILXA 5EIJA 1TG9A 2FOYA 3B1BA 3P55A 4K0SA 4M2RA 3D8WA 4JSWA 3N0NA 4QJXA 4YXUA 4G0CA 1Z9YA 4RIVA 2X7SA 3HFPA 4JSZA 3P4VA 3IBIA 3M2YA 1CILA 1I9QA 4HEYA 4Q8YA 3L14A 3U45X 4KNMA 3RZ0B 3P5LA 5G01A 1CVDA 3QYKA 4WR7A 4QJMA 1CVHA 2WEJA 3KLDB 3CZVA 4M2VA 2NWPA 4MTYA 3DD8A 3DA2A 5FNHA 1I90A 5CACA 5E2KA 2NNSA 5LMDA 3M5SA 4RUZA 2NXTA 1XEGA 3RLDA 1ZSCA 3R17B 4K0ZA 3N2PA 3RZ1B 1CAKA 3MNHA 3M1QA 3SAXA 4MDGA 2ILIA 1UGEA 4KNIA 3MNKA 5E5RA 12CAA 2POWA 5EH8A 3KOIA 1BNUA 2X7TA 3N3JA 1TB0X 5IPZA 4Q6DA 3DVDA 3MHIA 3RZ8A 5EHWA 3M1KA 3HKNA 1Z97A 5FL6A 2POUA 5A25A 4QSBA 5JEHB 5SZ1A 1CNBA 1CNXA 4PZHA 4K13A 1KEQA 5FNMA 3GZ0A 3T84A 1IF7A 4JSSA 3M2ZA 2FMZA 3D93A 4N16A 5EH5A 2FOSA 2GEHA 4KUWA 2NN1A 1BNQA 4QSIA 4WUQA 5DSQA 2FNKA 2O4ZA 2NN7A 5DSLA 3RYYA 4MLXA 5J8ZA 4HBAA 4YGNA 1BCDA 4Z1KA 3NI5A 3F4XA 3OKUA 5EKJA 3S75B 4QSJA 1CANA 4KNNA 1ZGEA 5DSRA 4K1QA 2POVA 3TMJA 1HVAA 4XFWA 3KNEA 5JDVB 1RAZA 1ZSAA 4E9OX 3W6HA 1JV0A 3V3FA 1LG6A 3ZP9A 3MNUA 3C7PA 3P3HA 4QK3A 5BRWA 5BNLA 2GD8A 4ZAOA 3RYJB 5FLPA 5L6KA 3HKUA 4XE1A 4R59A 4Q90A 4Q81A 5FNIA 5BRVA 5EKHA 3RGEA 4ZX0A 1LUGA 1CA2A 4QJPA 5DSOA 5FL5A 1CAJA 1HCAA 1IF8A 5DSMA 4WUPA 4CNWA 3MHLA 2Q38A 1OQ5A 3SBIA 1ZFQA 3U47A 3HKTA 3W6IA 3M96A 5FLOA 2H4NA 4Q6EA 1J9WA 1MOOA 2CBAA 2CBBA 3DVBA 4KP5A 4ZWYA 5JG3B 5AMDA 4YGLA 3JXGA 1BNNA 1RJ5A 2FNMA 3HKQA 3SBHA 2QO8A 3HLJA 1KWQA 1G4OA 4XZ5A 1FLJA 4YHAA 3V3JA 1FQNA 4Q7WA 1I9OA 4TWMA 4UOVA 4TWLA 3OYSA 2NNGA 2W2JA 1BICA 4FVNA 5SZ6A 3N4BA 3MHMA 3RG3A 1YDAA 3DCCA 1AZMA 1V9EA 4DZ9A 1CNJA 4KP8A 5FLSA 4M2UA 4QK2A 4MLTA 5EOIA 4RUXA 1THKA 3DCWA 2WEGA 1CRAA 3K7KA 5SZ2A 1JCZA 1BN1A 2ZNCA 1G45A 3MMFA 1UGFA 5G0CA 4HT2A 2FOQA 1FSNA 4QSAA 3IBLA 2HD6A 4HF3A 1HCBA 4PXXA 2AW1A 3T82A 3BL0A 3U3AX 5AMGA 2CBCA 4CA2A 2HNCA 2CBEA 4YWPA 2VVBX 4LU3A 3S73B 3DVCA 1IF9A 4QIZA 4CNXA 2HOCA 4YYTA 5JQ0A 1YO0A 1G54A 5DRSA 5EZTX 3B4FA 1EOUA 3M2XA 4YGKA 5JEGB 3CA2A 1BNWA 3DBUA 1H9QA 1UGAA 1ZE8A 2QOAA 4Q0LA 1G53A 2WD3A 1CAYA 4N0XB 4PQ7A 3IGPA 5DSNA 2HFWA 2X7UA 1CVCA 2QP6A 4Q07A 3UYQA 4XIXA 3KS3A 5SZ3A 4WW8A 5FNLA 4BF6A 3MYQA 3D92A 3V5GA 1CZMA 3S74B 4Z1NA 5DSKA 3F7UA 4MO8A 2FOVA 4YXIA 3T85A 1HEDA 4CACA 1YDDA 1RZAA 4FRCA 2FNNA 5FLQA 4Q83A 4KUYA 4WW6A 3HS4A 5E5UA 2AX2A 1YDCA 4K0TA 5JG5B 3S8XA 1G1DA 3M14A 1HUHA 1CAMA 1RJ6A 1YO1A 1UGBA 4G7AA 4R5AA 5JGSB 4Q78A 2Q1BA 3K34A 2CA2A 3DD0A 1TE3X 4CQ0A 1FQMA 1CCSA 3EFTA 5JGTB 3F8EA 4PYYA 5E2RA 1UGGA 5FDIA 4ZWIA 4Q06A 5BRUA 5CA2A 1AVNA 4Q49A 4R5BA 3F7BA 5AMLA 3RYVB 1G48A 5DVXA 1CRMA 3M04A 2WD2A
chains in the Genus database with same CATH superfamily
1G4JA 4IDRX 3M1WA 3M1JA 3TVNX 4E49A 1CVAA 2WEHA 1FR4A 4RN4A 5BYIA 1FQRA 4Q99A 4ZWZA 3FFPX 4Q8ZA 1LGDA 1ZH9A 4YXOA 4Q7PA 5A6HA 6CA2A 1KOQA 3MHOA 2NXSA 1TBTX 3CYUA 3VBDA 3PO6A 3RJ7A 3IBUA 4Q09A 4ZX1A 1CNGA 1IF4A 1FR7A 1HEAA 5SZ7A 3Q31A 3BETA 1XPZA 4KAPA 1YDBA 5FLTA 1FSRA 3M3XA 1IF5A 1URTA 2EU3A 1CALA 1RZBA 1RZDA 3ML2A 1BNVA 3TVOX 5DSJA 4COQA 4RFCA 1IF6A 3RYXB 4HEZA 1BNMA 1YO2A 1CCTA 5EHVA 2HKKA 3S77B 5DOGA 4C3TA 1HEBA 1DMXA 1I8ZA 1BN4A 1OKNA 4M2WA 5E2SA 4QTLA 1TH9A 4IWZA 3MZCA 4MDMA 3V7XA 3P58A 3OIMA 5FLRA 1V9IC 1CNIA 1Y7WA 1MUAA 3DAZA 4QJWA 1ZFKA 5FL4A 4XIWA 3S72B 2OSFA 3NB5A 1CVFA 4QEFA 3U7CA 1CNYA 3JXHC 5DSIA 3OKVA 4CNVA 4RIUA 3P5AA 3KWAA 3T5UA 5JEPB 1G52A 1UGCA 5C8IA 3FW3A 3M98A 5DSPA 3FE4A 2EZ7A 4X5SA 4E5QA 3D0NA 4RFDA 5E2NA 3OILA 3IBNA 1CA3A 3M5EA 4E3GA 4YGJA 4LHIA 4Q87A 1TEUX 3V3HB 3LXEA 4RH2A 4FIKA 3KIGA 4YVYA 1AM6A 1TTMA 1DMYA 1CNKA 5FNKA 4YX4A 3JXFA 3RYZA 1TEQX 4FU5A 3S71B 3RZ7A 5EHEA 2FW4A 3DC9A 1BZMA 1CAIA 1LZVA 4QK1A 2WEOA 3DCSA 1CVEA 4BF1A 2NWOA 3DC3A 2NNVA 1CCUA 4ETQC 4Q7SA 3S76A 3T83A 1DCBA 8CA2A 5L3OA 1I9LA 3V3GB 1RZEA 3MNJA 4Q8XA 1T9NA 1BN3A 2FOUA 5JQTA 2Q1QA 1A42A 3MNIA 3EFIA 3R16A 4ITPA 3BL1A 3MDZA 2ABEA 2CBDA 5DOHA 4Z1JA 4L5UA 2VVAX 5JESB 1G46A 3S9TA 1TG3A 7CA2A 9CA2A 1ZGFA 5SZ0A 5E28A 4ZWXA 4GL1X 4FL7A 4HU1A 1I9PA 1UGDA 1JD0A 4QJ0A 1HUGA 3K2FA 2EU2A 1XEVA 3M67A 4LP6A 1I9MA 1FQLA 3PJJA 3SAPA 3MNAA 4QIYA 2NWZA 4JS6A 1CINA 3S78B 1XQ0A 4Q08A 3UYNA 3D9ZA 4MDLA 3RZ5A 4E4AA 4HEWA 4BCWA 1HECA 3M2NA 4PYXA 4Q9YA 3MWOA 1OKLA 4QJOA 4Z0QA 2NMXA 1G3ZA 3MHCA 4JSAA 3RG4A 3IEOA 4ITOA 3IAIA 1G0FA 4HT0A 1FSQA 3OIKA 4DZ7A 2IT4A 3ZNCA 4L5WA 1G6VA 1F2WA 2NWYA 1DCAA 2CABA 1Z93A 5CLUA 2H15A 5EKMA 1H4NA 1CAOA 2OSMA 5EH7A 1CAHA 1BV3A 3CAJA 3T5ZA 3V3IB 1G0EA 1RAYA 1I91A 5HPJA 1CVBA 2NNOA 3OYQA 4KV0A 5FNJA 3V2JA 4WL4A 5FDCA 4CNRA 3P3JA 5G03A 5SZ5A 1CIMA 5E2MA 4E3DA 2HL4A 1ZNCA 3KOKA 4E3FA 3PYKA 3M5TA 1LG5A 1CAZA 4Y0JA 1KWRA 3M40A 4YGFA 3V2MA 4KUVA 1OKMA 4FPTA 4Z1EA 3NJ9A 4Q7VA 2F14A 1CNCA 3KKXA 1RZCA 3KONA 1I9NA 5G0BA 3ML5A 2FMGA 4KNJA 4E3HA 3S97A 2NXRA 1KOPA 4RUYA 3DV7A 1ZSBA 1CNHA 5CJFA 4L5VA 1CNWA 4QY3A 4FVOA 3OY0A 5FNGA 1BNTA 3P44A 5SZ4A 1H9NA 4ILXA 5EIJA 1TG9A 2FOYA 3B1BA 3P55A 4K0SA 4M2RA 3D8WA 4JSWA 3N0NA 4QJXA 4YXUA 4G0CA 1Z9YA 4RIVA 2X7SA 3HFPA 4JSZA 3P4VA 3IBIA 3M2YA 1CILA 1I9QA 4HEYA 4Q8YA 3L14A 3U45X 4KNMA 3RZ0B 3P5LA 5G01A 1CVDA 3QYKA 4WR7A 4QJMA 1CVHA 2WEJA 3KLDB 3CZVA 4M2VA 2NWPA 4MTYA 3DD8A 3DA2A 5FNHA 1I90A 5CACA 5E2KA 2NNSA 5LMDA 3M5SA 4RUZA 2NXTA 1XEGA 3RLDA 1ZSCA 3R17B 4K0ZA 3N2PA 3RZ1B 1CAKA 3MNHA 3M1QA 3SAXA 4MDGA 2ILIA 1UGEA 4KNIA 3MNKA 5E5RA 12CAA 2POWA 5EH8A 3KOIA 1BNUA 2X7TA 3N3JA 1TB0X 5IPZA 4Q6DA 3DVDA 3MHIA 3RZ8A 5EHWA 3M1KA 3HKNA 1Z97A 5FL6A 2POUA 5A25A 4QSBA 5JEHB 5SZ1A 1CNBA 1CNXA 4PZHA 4K13A 1KEQA 5FNMA 3GZ0A 3T84A 1IF7A 4JSSA 3M2ZA 2FMZA 3D93A 4N16A 5EH5A 2FOSA 2GEHA 4KUWA 2NN1A 1BNQA 4QSIA 4WUQA 5DSQA 2FNKA 2O4ZA 2NN7A 5DSLA 3RYYA 4MLXA 5J8ZA 4HBAA 4YGNA 1BCDA 4Z1KA 3NI5A 3F4XA 3OKUA 5EKJA 3S75B 4QSJA 1CANA 4KNNA 1ZGEA 5DSRA 4K1QA 2POVA 3TMJA 1HVAA 4XFWA 3KNEA 5JDVB 1RAZA 1ZSAA 4E9OX 3W6HA 1JV0A 3V3FA 1LG6A 3ZP9A 3MNUA 3C7PA 3P3HA 4QK3A 5BRWA 5BNLA 2GD8A 4ZAOA 3RYJB 5FLPA 5L6KA 3HKUA 4XE1A 4R59A 4Q90A 4Q81A 5FNIA 5BRVA 5EKHA 3RGEA 4ZX0A 1LUGA 1CA2A 4QJPA 5DSOA 5FL5A 1CAJA 1HCAA 1IF8A 5DSMA 4WUPA 4CNWA 3MHLA 2Q38A 1OQ5A 3SBIA 1ZFQA 3U47A 3HKTA 3W6IA 3M96A 5FLOA 2H4NA 4Q6EA 1J9WA 1MOOA 2CBAA 2CBBA 3DVBA 4KP5A 4ZWYA 5JG3B 5AMDA 4YGLA 3JXGA 1BNNA 1RJ5A 2FNMA 3HKQA 3SBHA 2QO8A 3HLJA 1KWQA 1G4OA 4XZ5A 1FLJA 4YHAA 3V3JA 1FQNA 4Q7WA 1I9OA 4TWMA 4UOVA 4TWLA 3OYSA 2NNGA 2W2JA 1BICA 4FVNA 5SZ6A 3N4BA 3MHMA 3RG3A 1YDAA 3DCCA 1AZMA 1V9EA 4DZ9A 1CNJA 4KP8A 5FLSA 4M2UA 4QK2A 4MLTA 5EOIA 4RUXA 1THKA 3DCWA 2WEGA 1CRAA 3K7KA 5SZ2A 1JCZA 1BN1A 2ZNCA 1G45A 3MMFA 1UGFA 5G0CA 4HT2A 2FOQA 1FSNA 4QSAA 3IBLA 2HD6A 4HF3A 1HCBA 4PXXA 2AW1A 3T82A 3BL0A 3U3AX 5AMGA 2CBCA 4CA2A 2HNCA 2CBEA 4YWPA 2VVBX 4LU3A 3S73B 3DVCA 1IF9A 4QIZA 4CNXA 2HOCA 4YYTA 5JQ0A 1YO0A 1G54A 5DRSA 5EZTX 3B4FA 1EOUA 3M2XA 4YGKA 5JEGB 3CA2A 1BNWA 3DBUA 1H9QA 1UGAA 1ZE8A 2QOAA 4Q0LA 1G53A 2WD3A 1CAYA 4N0XB 4PQ7A 3IGPA 5DSNA 2HFWA 2X7UA 1CVCA 2QP6A 4Q07A 3UYQA 4XIXA 3KS3A 5SZ3A 4WW8A 5FNLA 4BF6A 3MYQA 3D92A 3V5GA 1CZMA 3S74B 4Z1NA 5DSKA 3F7UA 4MO8A 2FOVA 4YXIA 3T85A 1HEDA 4CACA 1YDDA 1RZAA 4FRCA 2FNNA 5FLQA 4Q83A 4KUYA 4WW6A 3HS4A 5E5UA 2AX2A 1YDCA 4K0TA 5JG5B 3S8XA 1G1DA 3M14A 1HUHA 1CAMA 1RJ6A 1YO1A 1UGBA 4G7AA 4R5AA 5JGSB 4Q78A 2Q1BA 3K34A 2CA2A 3DD0A 1TE3X 4CQ0A 1FQMA 1CCSA 3EFTA 5JGTB 3F8EA 4PYYA 5E2RA 1UGGA 5FDIA 4ZWIA 4Q06A 5BRUA 5CA2A 1AVNA 4Q49A 4R5BA 3F7BA 5AMLA 3RYVB 1G48A 5DVXA 1CRMA 3M04A 2WD2A
chains in the Genus database with same CATH topology
1G4JA 4IDRX 3M1WA 3M1JA 3TVNX 4E49A 1CVAA 2WEHA 1FR4A 4RN4A 5BYIA 1FQRA 4Q99A 4ZWZA 3FFPX 4Q8ZA 1LGDA 1ZH9A 4YXOA 4Q7PA 5A6HA 6CA2A 1KOQA 3MHOA 2NXSA 1TBTX 3CYUA 3VBDA 3PO6A 3RJ7A 3IBUA 4Q09A 4ZX1A 1CNGA 1IF4A 1FR7A 1HEAA 5SZ7A 3Q31A 3BETA 1XPZA 4KAPA 1YDBA 5FLTA 1FSRA 3M3XA 1IF5A 1URTA 2EU3A 1CALA 1RZBA 1RZDA 3ML2A 1BNVA 3TVOX 5DSJA 4COQA 4RFCA 1IF6A 3RYXB 4HEZA 1BNMA 1YO2A 1CCTA 5EHVA 2HKKA 3S77B 5DOGA 4C3TA 1HEBA 1DMXA 1I8ZA 1BN4A 1OKNA 4M2WA 5E2SA 4QTLA 1TH9A 4IWZA 3MZCA 4MDMA 3V7XA 3P58A 3OIMA 5FLRA 1V9IC 1CNIA 1Y7WA 1MUAA 3DAZA 4QJWA 1ZFKA 5FL4A 4XIWA 3S72B 2OSFA 3NB5A 1CVFA 4QEFA 3U7CA 1CNYA 3JXHC 5DSIA 3OKVA 4CNVA 4RIUA 3P5AA 3KWAA 3T5UA 5JEPB 1G52A 1UGCA 5C8IA 3FW3A 3M98A 5DSPA 3FE4A 2EZ7A 4X5SA 4E5QA 3D0NA 4RFDA 5E2NA 3OILA 3IBNA 1CA3A 3M5EA 4E3GA 4YGJA 4LHIA 4Q87A 1TEUX 3V3HB 3LXEA 4RH2A 4FIKA 3KIGA 4YVYA 1AM6A 1TTMA 1DMYA 1CNKA 5FNKA 4YX4A 3JXFA 3RYZA 1TEQX 4FU5A 3S71B 3RZ7A 5EHEA 2FW4A 3DC9A 1BZMA 1CAIA 1LZVA 4QK1A 2WEOA 3DCSA 1CVEA 4BF1A 2NWOA 3DC3A 2NNVA 1CCUA 4ETQC 4Q7SA 3S76A 3T83A 1DCBA 8CA2A 5L3OA 1I9LA 3V3GB 1RZEA 3MNJA 4Q8XA 1T9NA 1BN3A 2FOUA 5JQTA 2Q1QA 1A42A 3MNIA 3EFIA 3R16A 4ITPA 3BL1A 3MDZA 2ABEA 2CBDA 5DOHA 4Z1JA 4L5UA 2VVAX 5JESB 1G46A 3S9TA 1TG3A 7CA2A 9CA2A 1ZGFA 5SZ0A 5E28A 4ZWXA 4GL1X 4FL7A 4HU1A 1I9PA 1UGDA 1JD0A 4QJ0A 1HUGA 3K2FA 2EU2A 1XEVA 3M67A 4LP6A 1I9MA 1FQLA 3PJJA 3SAPA 3MNAA 4QIYA 2NWZA 4JS6A 1CINA 3S78B 1XQ0A 4Q08A 3UYNA 3D9ZA 4MDLA 3RZ5A 4E4AA 4HEWA 4BCWA 1HECA 3M2NA 4PYXA 4Q9YA 3MWOA 1OKLA 4QJOA 4Z0QA 2NMXA 1G3ZA 3MHCA 4JSAA 3RG4A 3IEOA 4ITOA 3IAIA 1G0FA 4HT0A 1FSQA 3OIKA 4DZ7A 2IT4A 3ZNCA 4L5WA 1G6VA 1F2WA 2NWYA 1DCAA 2CABA 1Z93A 5CLUA 2H15A 5EKMA 1H4NA 1CAOA 2OSMA 5EH7A 1CAHA 1BV3A 3CAJA 3T5ZA 3V3IB 1G0EA 1RAYA 1I91A 5HPJA 1CVBA 2NNOA 3OYQA 4KV0A 5FNJA 3V2JA 4WL4A 5FDCA 4CNRA 3P3JA 5G03A 5SZ5A 1CIMA 5E2MA 4E3DA 2HL4A 1ZNCA 3KOKA 4E3FA 3PYKA 3M5TA 1LG5A 1CAZA 4Y0JA 1KWRA 3M40A 4YGFA 3V2MA 4KUVA 1OKMA 4FPTA 4Z1EA 3NJ9A 4Q7VA 2F14A 1CNCA 3KKXA 1RZCA 3KONA 1I9NA 5G0BA 3ML5A 2FMGA 4KNJA 4E3HA 3S97A 2NXRA 1KOPA 4RUYA 3DV7A 1ZSBA 1CNHA 5CJFA 4L5VA 1CNWA 4QY3A 4FVOA 3OY0A 5FNGA 1BNTA 3P44A 5SZ4A 1H9NA 4ILXA 5EIJA 1TG9A 2FOYA 3B1BA 3P55A 4K0SA 4M2RA 3D8WA 4JSWA 3N0NA 4QJXA 4YXUA 4G0CA 1Z9YA 4RIVA 2X7SA 3HFPA 4JSZA 3P4VA 3IBIA 3M2YA 1CILA 1I9QA 4HEYA 4Q8YA 3L14A 3U45X 4KNMA 3RZ0B 3P5LA 5G01A 1CVDA 3QYKA 4WR7A 4QJMA 1CVHA 2WEJA 3KLDB 3CZVA 4M2VA 2NWPA 4MTYA 3DD8A 3DA2A 5FNHA 1I90A 5CACA 5E2KA 2NNSA 5LMDA 3M5SA 4RUZA 2NXTA 1XEGA 3RLDA 1ZSCA 3R17B 4K0ZA 3N2PA 3RZ1B 1CAKA 3MNHA 3M1QA 3SAXA 4MDGA 2ILIA 1UGEA 4KNIA 3MNKA 5E5RA 12CAA 2POWA 5EH8A 3KOIA 1BNUA 2X7TA 3N3JA 1TB0X 5IPZA 4Q6DA 3DVDA 3MHIA 3RZ8A 5EHWA 3M1KA 3HKNA 1Z97A 5FL6A 2POUA 5A25A 4QSBA 5JEHB 5SZ1A 1CNBA 1CNXA 4PZHA 4K13A 1KEQA 5FNMA 3GZ0A 3T84A 1IF7A 4JSSA 3M2ZA 2FMZA 3D93A 4N16A 5EH5A 2FOSA 2GEHA 4KUWA 2NN1A 1BNQA 4QSIA 4WUQA 5DSQA 2FNKA 2O4ZA 2NN7A 5DSLA 3RYYA 4MLXA 5J8ZA 4HBAA 4YGNA 1BCDA 4Z1KA 3NI5A 3F4XA 3OKUA 5EKJA 3S75B 4QSJA 1CANA 4KNNA 1ZGEA 5DSRA 4K1QA 2POVA 3TMJA 1HVAA 4XFWA 3KNEA 5JDVB 1RAZA 1ZSAA 4E9OX 3W6HA 1JV0A 3V3FA 1LG6A 3ZP9A 3MNUA 3C7PA 3P3HA 4QK3A 5BRWA 5BNLA 2GD8A 4ZAOA 3RYJB 5FLPA 5L6KA 3HKUA 4XE1A 4R59A 4Q90A 4Q81A 5FNIA 5BRVA 5EKHA 3RGEA 4ZX0A 1LUGA 1CA2A 4QJPA 5DSOA 5FL5A 1CAJA 1HCAA 1IF8A 5DSMA 4WUPA 4CNWA 3MHLA 2Q38A 1OQ5A 3SBIA 1ZFQA 3U47A 3HKTA 3W6IA 3M96A 5FLOA 2H4NA 4Q6EA 1J9WA 1MOOA 2CBAA 2CBBA 3DVBA 4KP5A 4ZWYA 5JG3B 5AMDA 4YGLA 3JXGA 1BNNA 1RJ5A 2FNMA 3HKQA 3SBHA 2QO8A 3HLJA 1KWQA 1G4OA 4XZ5A 1FLJA 4YHAA 3V3JA 1FQNA 4Q7WA 1I9OA 4TWMA 4UOVA 4TWLA 3OYSA 2NNGA 2W2JA 1BICA 4FVNA 5SZ6A 3N4BA 3MHMA 3RG3A 1YDAA 3DCCA 1AZMA 1V9EA 4DZ9A 1CNJA 4KP8A 5FLSA 4M2UA 4QK2A 4MLTA 5EOIA 4RUXA 1THKA 3DCWA 2WEGA 1CRAA 3K7KA 5SZ2A 1JCZA 1BN1A 2ZNCA 1G45A 3MMFA 1UGFA 5G0CA 4HT2A 2FOQA 1FSNA 4QSAA 3IBLA 2HD6A 4HF3A 1HCBA 4PXXA 2AW1A 3T82A 3BL0A 3U3AX 5AMGA 2CBCA 4CA2A 2HNCA 2CBEA 4YWPA 2VVBX 4LU3A 3S73B 3DVCA 1IF9A 4QIZA 4CNXA 2HOCA 4YYTA 5JQ0A 1YO0A 1G54A 5DRSA 5EZTX 3B4FA 1EOUA 3M2XA 4YGKA 5JEGB 3CA2A 1BNWA 3DBUA 1H9QA 1UGAA 1ZE8A 2QOAA 4Q0LA 1G53A 2WD3A 1CAYA 4N0XB 4PQ7A 3IGPA 5DSNA 2HFWA 2X7UA 1CVCA 2QP6A 4Q07A 3UYQA 4XIXA 3KS3A 5SZ3A 4WW8A 5FNLA 4BF6A 3MYQA 3D92A 3V5GA 1CZMA 3S74B 4Z1NA 5DSKA 3F7UA 4MO8A 2FOVA 4YXIA 3T85A 1HEDA 4CACA 1YDDA 1RZAA 4FRCA 2FNNA 5FLQA 4Q83A 4KUYA 4WW6A 3HS4A 5E5UA 2AX2A 1YDCA 4K0TA 5JG5B 3S8XA 1G1DA 3M14A 1HUHA 1CAMA 1RJ6A 1YO1A 1UGBA 4G7AA 4R5AA 5JGSB 4Q78A 2Q1BA 3K34A 2CA2A 3DD0A 1TE3X 4CQ0A 1FQMA 1CCSA 3EFTA 5JGTB 3F8EA 4PYYA 5E2RA 1UGGA 5FDIA 4ZWIA 4Q06A 5BRUA 5CA2A 1AVNA 4Q49A 4R5BA 3F7BA 5AMLA 3RYVB 1G48A 5DVXA 1CRMA 3M04A 2WD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G4J A;  4IDR X;  3M1W A;  3M1J A;  3TVN X;  4E49 A;  1CVA A;  2WEH A;  1FR4 A;  4RN4 A;  5BYI A;  1FQR A;  4Q99 A;  4ZWZ A;  3FFP X;  4Q8Z A;  1LGD A;  1ZH9 A;  4YXO A;  4Q7P A;  5A6H A;  6CA2 A;  1KOQ A;  3MHO A;  2NXS A;  1TBT X;  3CYU A;  3VBD A;  3PO6 A;  3RJ7 A;  3IBU A;  4Q09 A;  4ZX1 A;  1CNG A;  1IF4 A;  1FR7 A;  1HEA A;  5SZ7 A;  3Q31 A;  3BET A;  1XPZ A;  4KAP A;  1YDB A;  5FLT A;  1FSR A;  3M3X A;  1IF5 A;  1URT A;  2EU3 A;  1CAL A;  1RZB A;  1RZD A;  3ML2 A;  1BNV A;  3TVO X;  5DSJ A;  4COQ A;  4RFC A;  1IF6 A;  3RYX B;  4HEZ A;  1BNM A;  1YO2 A;  1CCT A;  5EHV A;  2HKK A;  3S77 B;  5DOG A;  4C3T A;  1HEB A;  1DMX A;  1I8Z A;  1BN4 A;  1OKN A;  4M2W A;  5E2S A;  4QTL A;  1TH9 A;  4IWZ A;  3MZC A;  4MDM A;  3V7X A;  3P58 A;  3OIM A;  5FLR A;  1V9I C;  1CNI A;  1Y7W A;  1MUA A;  3DAZ A;  4QJW A;  1ZFK A;  5FL4 A;  4XIW A;  3S72 B;  2OSF A;  3NB5 A;  1CVF A;  4QEF A;  3U7C A;  1CNY A;  3JXH C;  5DSI A;  3OKV A;  4CNV A;  4RIU A;  3P5A A;  3KWA A;  3T5U A;  5JEP B;  1G52 A;  1UGC A;  5C8I A;  3FW3 A;  3M98 A;  5DSP A;  3FE4 A;  2EZ7 A;  4X5S A;  4E5Q A;  3D0N A;  4RFD A;  5E2N A;  3OIL A;  3IBN A;  1CA3 A;  3M5E A;  4E3G A;  4YGJ A;  4LHI A;  4Q87 A;  1TEU X;  3V3H B;  3LXE A;  4RH2 A;  4FIK A;  3KIG A;  4YVY A;  1AM6 A;  1TTM A;  1DMY A;  1CNK A;  5FNK A;  4YX4 A;  3JXF A;  3RYZ A;  1TEQ X;  4FU5 A;  3S71 B;  3RZ7 A;  5EHE A;  2FW4 A;  3DC9 A;  1BZM A;  1CAI A;  1LZV A;  4QK1 A;  2WEO A;  3DCS A;  1CVE A;  4BF1 A;  2NWO A;  3DC3 A;  2NNV A;  1CCU A;  4ETQ C;  4Q7S A;  3S76 A;  3T83 A;  1DCB A;  8CA2 A;  5L3O A;  1I9L A;  3V3G B;  1RZE A;  3MNJ A;  4Q8X A;  1T9N A;  1BN3 A;  2FOU A;  5JQT A;  2Q1Q A;  1A42 A;  3MNI A;  3EFI A;  3R16 A;  4ITP A;  3BL1 A;  3MDZ A;  2ABE A;  2CBD A;  5DOH A;  4Z1J A;  4L5U A;  2VVA X;  5JES B;  1G46 A;  3S9T A;  1TG3 A;  7CA2 A;  9CA2 A;  1ZGF A;  5SZ0 A;  5E28 A;  4ZWX A;  4GL1 X;  4FL7 A;  4HU1 A;  1I9P A;  1UGD A;  1JD0 A;  4QJ0 A;  1HUG A;  3K2F A;  2EU2 A;  1XEV A;  3M67 A;  4LP6 A;  1I9M A;  1FQL A;  3PJJ A;  3SAP A;  3MNA A;  4QIY A;  2NWZ A;  4JS6 A;  1CIN A;  3S78 B;  1XQ0 A;  4Q08 A;  3UYN A;  3D9Z A;  4MDL A;  3RZ5 A;  4E4A A;  4HEW A;  4BCW A;  1HEC A;  3M2N A;  4PYX A;  4Q9Y A;  3MWO A;  1OKL A;  4QJO A;  4Z0Q A;  2NMX A;  1G3Z A;  3MHC A;  4JSA A;  3RG4 A;  3IEO A;  4ITO A;  3IAI A;  1G0F A;  4HT0 A;  1FSQ A;  3OIK A;  4DZ7 A;  2IT4 A;  3ZNC A;  4L5W A;  1G6V A;  1F2W A;  2NWY A;  1DCA A;  2CAB A;  1Z93 A;  5CLU A;  2H15 A;  5EKM A;  1H4N A;  1CAO A;  2OSM A;  5EH7 A;  1CAH A;  1BV3 A;  3CAJ A;  3T5Z A;  3V3I B;  1G0E A;  1RAY A;  1I91 A;  5HPJ A;  1CVB A;  2NNO A;  3OYQ A;  4KV0 A;  5FNJ A;  3V2J A;  4WL4 A;  5FDC A;  4CNR A;  3P3J A;  5G03 A;  5SZ5 A;  1CIM A;  5E2M A;  4E3D A;  2HL4 A;  1ZNC A;  3KOK A;  4E3F A;  3PYK A;  3M5T A;  1LG5 A;  1CAZ A;  4Y0J A;  1KWR A;  3M40 A;  4YGF A;  3V2M A;  4KUV A;  1OKM A;  4FPT A;  4Z1E A;  3NJ9 A;  4Q7V A;  2F14 A;  1CNC A;  3KKX A;  1RZC A;  3KON A;  1I9N A;  5G0B A;  3ML5 A;  2FMG A;  4KNJ A;  4E3H A;  3S97 A;  2NXR A;  1KOP A;  4RUY A;  3DV7 A;  1ZSB A;  1CNH A;  5CJF A;  4L5V A;  1CNW A;  4QY3 A;  4FVO A;  3OY0 A;  5FNG A;  1BNT A;  3P44 A;  5SZ4 A;  1H9N A;  4ILX A;  5EIJ A;  1TG9 A;  2FOY A;  3B1B A;  3P55 A;  4K0S A;  4M2R A;  3D8W A;  4JSW A;  3N0N A;  4QJX A;  4YXU A;  4G0C A;  1Z9Y A;  4RIV A;  2X7S A;  3HFP A;  4JSZ A;  3P4V A;  3IBI A;  3M2Y A;  1CIL A;  1I9Q A;  4HEY A;  4Q8Y A;  3L14 A;  3U45 X;  4KNM A;  3RZ0 B;  3P5L A;  5G01 A;  1CVD A;  3QYK A;  4WR7 A;  4QJM A;  1CVH A;  2WEJ A;  3KLD B;  3CZV A;  4M2V A;  2NWP A;  4MTY A;  3DD8 A;  3DA2 A;  5FNH A;  1I90 A;  5CAC A;  5E2K A;  2NNS A;  5LMD A;  3M5S A;  4RUZ A;  2NXT A;  1XEG A;  3RLD A;  1ZSC A;  3R17 B;  4K0Z A;  3N2P A;  3RZ1 B;  1CAK A;  3MNH A;  3M1Q A;  3SAX A;  4MDG A;  2ILI A;  1UGE A;  4KNI A;  3MNK A;  5E5R A;  12CA A;  2POW A;  5EH8 A;  3KOI A;  1BNU A;  2X7T A;  3N3J A;  1TB0 X;  5IPZ A;  4Q6D A;  3DVD A;  3MHI A;  3RZ8 A;  5EHW A;  3M1K A;  3HKN A;  1Z97 A;  5FL6 A;  2POU A;  5A25 A;  4QSB A;  5JEH B;  5SZ1 A;  1CNB A;  1CNX A;  4PZH A;  4K13 A;  1KEQ A;  5FNM A;  3GZ0 A;  3T84 A;  1IF7 A;  4JSS A;  3M2Z A;  2FMZ A;  3D93 A;  4N16 A;  5EH5 A;  2FOS A;  2GEH A;  4KUW A;  2NN1 A;  1BNQ A;  4QSI A;  4WUQ A;  5DSQ A;  2FNK A;  2O4Z A;  2NN7 A;  5DSL A;  3RYY A;  4MLX A;  5J8Z A;  4HBA A;  4YGN A;  1BCD A;  4Z1K A;  3NI5 A;  3F4X A;  3OKU A;  5EKJ A;  3S75 B;  4QSJ A;  1CAN A;  4KNN A;  1ZGE A;  5DSR A;  4K1Q A;  2POV A;  3TMJ A;  1HVA A;  4XFW A;  3KNE A;  5JDV B;  1RAZ A;  1ZSA A;  4E9O X;  3W6H A;  1JV0 A;  3V3F A;  1LG6 A;  3ZP9 A;  3MNU A;  3C7P A;  3P3H A;  4QK3 A;  5BRW A;  5BNL A;  2GD8 A;  4ZAO A;  3RYJ B;  5FLP A;  5L6K A;  3HKU A;  4XE1 A;  4R59 A;  4Q90 A;  4Q81 A;  5FNI A;  5BRV A;  5EKH A;  3RGE A;  4ZX0 A;  1LUG A;  1CA2 A;  4QJP A;  5DSO A;  5FL5 A;  1CAJ A;  1HCA A;  1IF8 A;  5DSM A;  4WUP A;  4CNW A;  3MHL A;  2Q38 A;  1OQ5 A;  3SBI A;  1ZFQ A;  3U47 A;  3HKT A;  3W6I A;  3M96 A;  5FLO A;  2H4N A;  4Q6E A;  1J9W A;  1MOO A;  2CBA A;  2CBB A;  3DVB A;  4KP5 A;  4ZWY A;  5JG3 B;  5AMD A;  4YGL A;  3JXG A;  1BNN A;  1RJ5 A;  2FNM A;  3HKQ A;  3SBH A;  2QO8 A;  3HLJ A;  1KWQ A;  1G4O A;  4XZ5 A;  1FLJ A;  4YHA A;  3V3J A;  1FQN A;  4Q7W A;  1I9O A;  4TWM A;  4UOV A;  4TWL A;  3OYS A;  2NNG A;  2W2J A;  1BIC A;  4FVN A;  5SZ6 A;  3N4B A;  3MHM A;  3RG3 A;  1YDA A;  3DCC A;  1AZM A;  1V9E A;  4DZ9 A;  1CNJ A;  4KP8 A;  5FLS A;  4M2U A;  4QK2 A;  4MLT A;  5EOI A;  4RUX A;  1THK A;  3DCW A;  2WEG A;  1CRA A;  3K7K A;  5SZ2 A;  1JCZ A;  1BN1 A;  2ZNC A;  1G45 A;  3MMF A;  1UGF A;  5G0C A;  4HT2 A;  2FOQ A;  1FSN A;  4QSA A;  3IBL A;  2HD6 A;  4HF3 A;  1HCB A;  4PXX A;  2AW1 A;  3T82 A;  3BL0 A;  3U3A X;  5AMG A;  2CBC A;  4CA2 A;  2HNC A;  2CBE A;  4YWP A;  2VVB X;  4LU3 A;  3S73 B;  3DVC A;  1IF9 A;  4QIZ A;  4CNX A;  2HOC A;  4YYT A;  5JQ0 A;  1YO0 A;  1G54 A;  5DRS A;  5EZT X;  3B4F A;  1EOU A;  3M2X A;  4YGK A;  5JEG B;  3CA2 A;  1BNW A;  3DBU A;  1H9Q A;  1UGA A;  1ZE8 A;  2QOA A;  4Q0L A;  1G53 A;  2WD3 A;  1CAY A;  4N0X B;  4PQ7 A;  3IGP A;  5DSN A;  2HFW A;  2X7U A;  1CVC A;  2QP6 A;  4Q07 A;  3UYQ A;  4XIX A;  3KS3 A;  5SZ3 A;  4WW8 A;  5FNL A;  4BF6 A;  3MYQ A;  3D92 A;  3V5G A;  1CZM A;  3S74 B;  4Z1N A;  5DSK A;  3F7U A;  4MO8 A;  2FOV A;  4YXI A;  3T85 A;  1HED A;  4CAC A;  1YDD A;  1RZA A;  4FRC A;  2FNN A;  5FLQ A;  4Q83 A;  4KUY A;  4WW6 A;  3HS4 A;  5E5U A;  2AX2 A;  1YDC A;  4K0T A;  5JG5 B;  3S8X A;  1G1D A;  3M14 A;  1HUH A;  1CAM A;  1RJ6 A;  1YO1 A;  1UGB A;  4G7A A;  4R5A A;  5JGS B;  4Q78 A;  2Q1B A;  3K34 A;  2CA2 A;  3DD0 A;  1TE3 X;  4CQ0 A;  1FQM A;  1CCS A;  3EFT A;  5JGT B;  3F8E A;  4PYY A;  5E2R A;  1UGG A;  5FDI A;  4ZWI A;  4Q06 A;  5BRU A;  5CA2 A;  1AVN A;  4Q49 A;  4R5B A;  3F7B A;  5AML A;  3RYV B;  1G48 A;  5DVX A;  1CRM A;  3M04 A;  2WD2 A; 
#chains in the Genus database with same CATH topology
 1G4J A;  4IDR X;  3M1W A;  3M1J A;  3TVN X;  4E49 A;  1CVA A;  2WEH A;  1FR4 A;  4RN4 A;  5BYI A;  1FQR A;  4Q99 A;  4ZWZ A;  3FFP X;  4Q8Z A;  1LGD A;  1ZH9 A;  4YXO A;  4Q7P A;  5A6H A;  6CA2 A;  1KOQ A;  3MHO A;  2NXS A;  1TBT X;  3CYU A;  3VBD A;  3PO6 A;  3RJ7 A;  3IBU A;  4Q09 A;  4ZX1 A;  1CNG A;  1IF4 A;  1FR7 A;  1HEA A;  5SZ7 A;  3Q31 A;  3BET A;  1XPZ A;  4KAP A;  1YDB A;  5FLT A;  1FSR A;  3M3X A;  1IF5 A;  1URT A;  2EU3 A;  1CAL A;  1RZB A;  1RZD A;  3ML2 A;  1BNV A;  3TVO X;  5DSJ A;  4COQ A;  4RFC A;  1IF6 A;  3RYX B;  4HEZ A;  1BNM A;  1YO2 A;  1CCT A;  5EHV A;  2HKK A;  3S77 B;  5DOG A;  4C3T A;  1HEB A;  1DMX A;  1I8Z A;  1BN4 A;  1OKN A;  4M2W A;  5E2S A;  4QTL A;  1TH9 A;  4IWZ A;  3MZC A;  4MDM A;  3V7X A;  3P58 A;  3OIM A;  5FLR A;  1V9I C;  1CNI A;  1Y7W A;  1MUA A;  3DAZ A;  4QJW A;  1ZFK A;  5FL4 A;  4XIW A;  3S72 B;  2OSF A;  3NB5 A;  1CVF A;  4QEF A;  3U7C A;  1CNY A;  3JXH C;  5DSI A;  3OKV A;  4CNV A;  4RIU A;  3P5A A;  3KWA A;  3T5U A;  5JEP B;  1G52 A;  1UGC A;  5C8I A;  3FW3 A;  3M98 A;  5DSP A;  3FE4 A;  2EZ7 A;  4X5S A;  4E5Q A;  3D0N A;  4RFD A;  5E2N A;  3OIL A;  3IBN A;  1CA3 A;  3M5E A;  4E3G A;  4YGJ A;  4LHI A;  4Q87 A;  1TEU X;  3V3H B;  3LXE A;  4RH2 A;  4FIK A;  3KIG A;  4YVY A;  1AM6 A;  1TTM A;  1DMY A;  1CNK A;  5FNK A;  4YX4 A;  3JXF A;  3RYZ A;  1TEQ X;  4FU5 A;  3S71 B;  3RZ7 A;  5EHE A;  2FW4 A;  3DC9 A;  1BZM A;  1CAI A;  1LZV A;  4QK1 A;  2WEO A;  3DCS A;  1CVE A;  4BF1 A;  2NWO A;  3DC3 A;  2NNV A;  1CCU A;  4ETQ C;  4Q7S A;  3S76 A;  3T83 A;  1DCB A;  8CA2 A;  5L3O A;  1I9L A;  3V3G B;  1RZE A;  3MNJ A;  4Q8X A;  1T9N A;  1BN3 A;  2FOU A;  5JQT A;  2Q1Q A;  1A42 A;  3MNI A;  3EFI A;  3R16 A;  4ITP A;  3BL1 A;  3MDZ A;  2ABE A;  2CBD A;  5DOH A;  4Z1J A;  4L5U A;  2VVA X;  5JES B;  1G46 A;  3S9T A;  1TG3 A;  7CA2 A;  9CA2 A;  1ZGF A;  5SZ0 A;  5E28 A;  4ZWX A;  4GL1 X;  4FL7 A;  4HU1 A;  1I9P A;  1UGD A;  1JD0 A;  4QJ0 A;  1HUG A;  3K2F A;  2EU2 A;  1XEV A;  3M67 A;  4LP6 A;  1I9M A;  1FQL A;  3PJJ A;  3SAP A;  3MNA A;  4QIY A;  2NWZ A;  4JS6 A;  1CIN A;  3S78 B;  1XQ0 A;  4Q08 A;  3UYN A;  3D9Z A;  4MDL A;  3RZ5 A;  4E4A A;  4HEW A;  4BCW A;  1HEC A;  3M2N A;  4PYX A;  4Q9Y A;  3MWO A;  1OKL A;  4QJO A;  4Z0Q A;  2NMX A;  1G3Z A;  3MHC A;  4JSA A;  3RG4 A;  3IEO A;  4ITO A;  3IAI A;  1G0F A;  4HT0 A;  1FSQ A;  3OIK A;  4DZ7 A;  2IT4 A;  3ZNC A;  4L5W A;  1G6V A;  1F2W A;  2NWY A;  1DCA A;  2CAB A;  1Z93 A;  5CLU A;  2H15 A;  5EKM A;  1H4N A;  1CAO A;  2OSM A;  5EH7 A;  1CAH A;  1BV3 A;  3CAJ A;  3T5Z A;  3V3I B;  1G0E A;  1RAY A;  1I91 A;  5HPJ A;  1CVB A;  2NNO A;  3OYQ A;  4KV0 A;  5FNJ A;  3V2J A;  4WL4 A;  5FDC A;  4CNR A;  3P3J A;  5G03 A;  5SZ5 A;  1CIM A;  5E2M A;  4E3D A;  2HL4 A;  1ZNC A;  3KOK A;  4E3F A;  3PYK A;  3M5T A;  1LG5 A;  1CAZ A;  4Y0J A;  1KWR A;  3M40 A;  4YGF A;  3V2M A;  4KUV A;  1OKM A;  4FPT A;  4Z1E A;  3NJ9 A;  4Q7V A;  2F14 A;  1CNC A;  3KKX A;  1RZC A;  3KON A;  1I9N A;  5G0B A;  3ML5 A;  2FMG A;  4KNJ A;  4E3H A;  3S97 A;  2NXR A;  1KOP A;  4RUY A;  3DV7 A;  1ZSB A;  1CNH A;  5CJF A;  4L5V A;  1CNW A;  4QY3 A;  4FVO A;  3OY0 A;  5FNG A;  1BNT A;  3P44 A;  5SZ4 A;  1H9N A;  4ILX A;  5EIJ A;  1TG9 A;  2FOY A;  3B1B A;  3P55 A;  4K0S A;  4M2R A;  3D8W A;  4JSW A;  3N0N A;  4QJX A;  4YXU A;  4G0C A;  1Z9Y A;  4RIV A;  2X7S A;  3HFP A;  4JSZ A;  3P4V A;  3IBI A;  3M2Y A;  1CIL A;  1I9Q A;  4HEY A;  4Q8Y A;  3L14 A;  3U45 X;  4KNM A;  3RZ0 B;  3P5L A;  5G01 A;  1CVD A;  3QYK A;  4WR7 A;  4QJM A;  1CVH A;  2WEJ A;  3KLD B;  3CZV A;  4M2V A;  2NWP A;  4MTY A;  3DD8 A;  3DA2 A;  5FNH A;  1I90 A;  5CAC A;  5E2K A;  2NNS A;  5LMD A;  3M5S A;  4RUZ A;  2NXT A;  1XEG A;  3RLD A;  1ZSC A;  3R17 B;  4K0Z A;  3N2P A;  3RZ1 B;  1CAK A;  3MNH A;  3M1Q A;  3SAX A;  4MDG A;  2ILI A;  1UGE A;  4KNI A;  3MNK A;  5E5R A;  12CA A;  2POW A;  5EH8 A;  3KOI A;  1BNU A;  2X7T A;  3N3J A;  1TB0 X;  5IPZ A;  4Q6D A;  3DVD A;  3MHI A;  3RZ8 A;  5EHW A;  3M1K A;  3HKN A;  1Z97 A;  5FL6 A;  2POU A;  5A25 A;  4QSB A;  5JEH B;  5SZ1 A;  1CNB A;  1CNX A;  4PZH A;  4K13 A;  1KEQ A;  5FNM A;  3GZ0 A;  3T84 A;  1IF7 A;  4JSS A;  3M2Z A;  2FMZ A;  3D93 A;  4N16 A;  5EH5 A;  2FOS A;  2GEH A;  4KUW A;  2NN1 A;  1BNQ A;  4QSI A;  4WUQ A;  5DSQ A;  2FNK A;  2O4Z A;  2NN7 A;  5DSL A;  3RYY A;  4MLX A;  5J8Z A;  4HBA A;  4YGN A;  1BCD A;  4Z1K A;  3NI5 A;  3F4X A;  3OKU A;  5EKJ A;  3S75 B;  4QSJ A;  1CAN A;  4KNN A;  1ZGE A;  5DSR A;  4K1Q A;  2POV A;  3TMJ A;  1HVA A;  4XFW A;  3KNE A;  5JDV B;  1RAZ A;  1ZSA A;  4E9O X;  3W6H A;  1JV0 A;  3V3F A;  1LG6 A;  3ZP9 A;  3MNU A;  3C7P A;  3P3H A;  4QK3 A;  5BRW A;  5BNL A;  2GD8 A;  4ZAO A;  3RYJ B;  5FLP A;  5L6K A;  3HKU A;  4XE1 A;  4R59 A;  4Q90 A;  4Q81 A;  5FNI A;  5BRV A;  5EKH A;  3RGE A;  4ZX0 A;  1LUG A;  1CA2 A;  4QJP A;  5DSO A;  5FL5 A;  1CAJ A;  1HCA A;  1IF8 A;  5DSM A;  4WUP A;  4CNW A;  3MHL A;  2Q38 A;  1OQ5 A;  3SBI A;  1ZFQ A;  3U47 A;  3HKT A;  3W6I A;  3M96 A;  5FLO A;  2H4N A;  4Q6E A;  1J9W A;  1MOO A;  2CBA A;  2CBB A;  3DVB A;  4KP5 A;  4ZWY A;  5JG3 B;  5AMD A;  4YGL A;  3JXG A;  1BNN A;  1RJ5 A;  2FNM A;  3HKQ A;  3SBH A;  2QO8 A;  3HLJ A;  1KWQ A;  1G4O A;  4XZ5 A;  1FLJ A;  4YHA A;  3V3J A;  1FQN A;  4Q7W A;  1I9O A;  4TWM A;  4UOV A;  4TWL A;  3OYS A;  2NNG A;  2W2J A;  1BIC A;  4FVN A;  5SZ6 A;  3N4B A;  3MHM A;  3RG3 A;  1YDA A;  3DCC A;  1AZM A;  1V9E A;  4DZ9 A;  1CNJ A;  4KP8 A;  5FLS A;  4M2U A;  4QK2 A;  4MLT A;  5EOI A;  4RUX A;  1THK A;  3DCW A;  2WEG A;  1CRA A;  3K7K A;  5SZ2 A;  1JCZ A;  1BN1 A;  2ZNC A;  1G45 A;  3MMF A;  1UGF A;  5G0C A;  4HT2 A;  2FOQ A;  1FSN A;  4QSA A;  3IBL A;  2HD6 A;  4HF3 A;  1HCB A;  4PXX A;  2AW1 A;  3T82 A;  3BL0 A;  3U3A X;  5AMG A;  2CBC A;  4CA2 A;  2HNC A;  2CBE A;  4YWP A;  2VVB X;  4LU3 A;  3S73 B;  3DVC A;  1IF9 A;  4QIZ A;  4CNX A;  2HOC A;  4YYT A;  5JQ0 A;  1YO0 A;  1G54 A;  5DRS A;  5EZT X;  3B4F A;  1EOU A;  3M2X A;  4YGK A;  5JEG B;  3CA2 A;  1BNW A;  3DBU A;  1H9Q A;  1UGA A;  1ZE8 A;  2QOA A;  4Q0L A;  1G53 A;  2WD3 A;  1CAY A;  4N0X B;  4PQ7 A;  3IGP A;  5DSN A;  2HFW A;  2X7U A;  1CVC A;  2QP6 A;  4Q07 A;  3UYQ A;  4XIX A;  3KS3 A;  5SZ3 A;  4WW8 A;  5FNL A;  4BF6 A;  3MYQ A;  3D92 A;  3V5G A;  1CZM A;  3S74 B;  4Z1N A;  5DSK A;  3F7U A;  4MO8 A;  2FOV A;  4YXI A;  3T85 A;  1HED A;  4CAC A;  1YDD A;  1RZA A;  4FRC A;  2FNN A;  5FLQ A;  4Q83 A;  4KUY A;  4WW6 A;  3HS4 A;  5E5U A;  2AX2 A;  1YDC A;  4K0T A;  5JG5 B;  3S8X A;  1G1D A;  3M14 A;  1HUH A;  1CAM A;  1RJ6 A;  1YO1 A;  1UGB A;  4G7A A;  4R5A A;  5JGS B;  4Q78 A;  2Q1B A;  3K34 A;  2CA2 A;  3DD0 A;  1TE3 X;  4CQ0 A;  1FQM A;  1CCS A;  3EFT A;  5JGT B;  3F8E A;  4PYY A;  5E2R A;  1UGG A;  5FDI A;  4ZWI A;  4Q06 A;  5BRU A;  5CA2 A;  1AVN A;  4Q49 A;  4R5B A;  3F7B A;  5AML A;  3RYV B;  1G48 A;  5DVX A;  1CRM A;  3M04 A;  2WD2 A; 
#chains in the Genus database with same CATH homology
 1G4J A;  4IDR X;  3M1W A;  3M1J A;  3TVN X;  4E49 A;  1CVA A;  2WEH A;  1FR4 A;  4RN4 A;  5BYI A;  1FQR A;  4Q99 A;  4ZWZ A;  3FFP X;  4Q8Z A;  1LGD A;  1ZH9 A;  4YXO A;  4Q7P A;  5A6H A;  6CA2 A;  1KOQ A;  3MHO A;  2NXS A;  1TBT X;  3CYU A;  3VBD A;  3PO6 A;  3RJ7 A;  3IBU A;  4Q09 A;  4ZX1 A;  1CNG A;  1IF4 A;  1FR7 A;  1HEA A;  5SZ7 A;  3Q31 A;  3BET A;  1XPZ A;  4KAP A;  1YDB A;  5FLT A;  1FSR A;  3M3X A;  1IF5 A;  1URT A;  2EU3 A;  1CAL A;  1RZB A;  1RZD A;  3ML2 A;  1BNV A;  3TVO X;  5DSJ A;  4COQ A;  4RFC A;  1IF6 A;  3RYX B;  4HEZ A;  1BNM A;  1YO2 A;  1CCT A;  5EHV A;  2HKK A;  3S77 B;  5DOG A;  4C3T A;  1HEB A;  1DMX A;  1I8Z A;  1BN4 A;  1OKN A;  4M2W A;  5E2S A;  4QTL A;  1TH9 A;  4IWZ A;  3MZC A;  4MDM A;  3V7X A;  3P58 A;  3OIM A;  5FLR A;  1V9I C;  1CNI A;  1Y7W A;  1MUA A;  3DAZ A;  4QJW A;  1ZFK A;  5FL4 A;  4XIW A;  3S72 B;  2OSF A;  3NB5 A;  1CVF A;  4QEF A;  3U7C A;  1CNY A;  3JXH C;  5DSI A;  3OKV A;  4CNV A;  4RIU A;  3P5A A;  3KWA A;  3T5U A;  5JEP B;  1G52 A;  1UGC A;  5C8I A;  3FW3 A;  3M98 A;  5DSP A;  3FE4 A;  2EZ7 A;  4X5S A;  4E5Q A;  3D0N A;  4RFD A;  5E2N A;  3OIL A;  3IBN A;  1CA3 A;  3M5E A;  4E3G A;  4YGJ A;  4LHI A;  4Q87 A;  1TEU X;  3V3H B;  3LXE A;  4RH2 A;  4FIK A;  3KIG A;  4YVY A;  1AM6 A;  1TTM A;  1DMY A;  1CNK A;  5FNK A;  4YX4 A;  3JXF A;  3RYZ A;  1TEQ X;  4FU5 A;  3S71 B;  3RZ7 A;  5EHE A;  2FW4 A;  3DC9 A;  1BZM A;  1CAI A;  1LZV A;  4QK1 A;  2WEO A;  3DCS A;  1CVE A;  4BF1 A;  2NWO A;  3DC3 A;  2NNV A;  1CCU A;  4ETQ C;  4Q7S A;  3S76 A;  3T83 A;  1DCB A;  8CA2 A;  5L3O A;  1I9L A;  3V3G B;  1RZE A;  3MNJ A;  4Q8X A;  1T9N A;  1BN3 A;  2FOU A;  5JQT A;  2Q1Q A;  1A42 A;  3MNI A;  3EFI A;  3R16 A;  4ITP A;  3BL1 A;  3MDZ A;  2ABE A;  2CBD A;  5DOH A;  4Z1J A;  4L5U A;  2VVA X;  5JES B;  1G46 A;  3S9T A;  1TG3 A;  7CA2 A;  9CA2 A;  1ZGF A;  5SZ0 A;  5E28 A;  4ZWX A;  4GL1 X;  4FL7 A;  4HU1 A;  1I9P A;  1UGD A;  1JD0 A;  4QJ0 A;  1HUG A;  3K2F A;  2EU2 A;  1XEV A;  3M67 A;  4LP6 A;  1I9M A;  1FQL A;  3PJJ A;  3SAP A;  3MNA A;  4QIY A;  2NWZ A;  4JS6 A;  1CIN A;  3S78 B;  1XQ0 A;  4Q08 A;  3UYN A;  3D9Z A;  4MDL A;  3RZ5 A;  4E4A A;  4HEW A;  4BCW A;  1HEC A;  3M2N A;  4PYX A;  4Q9Y A;  3MWO A;  1OKL A;  4QJO A;  4Z0Q A;  2NMX A;  1G3Z A;  3MHC A;  4JSA A;  3RG4 A;  3IEO A;  4ITO A;  3IAI A;  1G0F A;  4HT0 A;  1FSQ A;  3OIK A;  4DZ7 A;  2IT4 A;  3ZNC A;  4L5W A;  1G6V A;  1F2W A;  2NWY A;  1DCA A;  2CAB A;  1Z93 A;  5CLU A;  2H15 A;  5EKM A;  1H4N A;  1CAO A;  2OSM A;  5EH7 A;  1CAH A;  1BV3 A;  3CAJ A;  3T5Z A;  3V3I B;  1G0E A;  1RAY A;  1I91 A;  5HPJ A;  1CVB A;  2NNO A;  3OYQ A;  4KV0 A;  5FNJ A;  3V2J A;  4WL4 A;  5FDC A;  4CNR A;  3P3J A;  5G03 A;  5SZ5 A;  1CIM A;  5E2M A;  4E3D A;  2HL4 A;  1ZNC A;  3KOK A;  4E3F A;  3PYK A;  3M5T A;  1LG5 A;  1CAZ A;  4Y0J A;  1KWR A;  3M40 A;  4YGF A;  3V2M A;  4KUV A;  1OKM A;  4FPT A;  4Z1E A;  3NJ9 A;  4Q7V A;  2F14 A;  1CNC A;  3KKX A;  1RZC A;  3KON A;  1I9N A;  5G0B A;  3ML5 A;  2FMG A;  4KNJ A;  4E3H A;  3S97 A;  2NXR A;  1KOP A;  4RUY A;  3DV7 A;  1ZSB A;  1CNH A;  5CJF A;  4L5V A;  1CNW A;  4QY3 A;  4FVO A;  3OY0 A;  5FNG A;  1BNT A;  3P44 A;  5SZ4 A;  1H9N A;  4ILX A;  5EIJ A;  1TG9 A;  2FOY A;  3B1B A;  3P55 A;  4K0S A;  4M2R A;  3D8W A;  4JSW A;  3N0N A;  4QJX A;  4YXU A;  4G0C A;  1Z9Y A;  4RIV A;  2X7S A;  3HFP A;  4JSZ A;  3P4V A;  3IBI A;  3M2Y A;  1CIL A;  1I9Q A;  4HEY A;  4Q8Y A;  3L14 A;  3U45 X;  4KNM A;  3RZ0 B;  3P5L A;  5G01 A;  1CVD A;  3QYK A;  4WR7 A;  4QJM A;  1CVH A;  2WEJ A;  3KLD B;  3CZV A;  4M2V A;  2NWP A;  4MTY A;  3DD8 A;  3DA2 A;  5FNH A;  1I90 A;  5CAC A;  5E2K A;  2NNS A;  5LMD A;  3M5S A;  4RUZ A;  2NXT A;  1XEG A;  3RLD A;  1ZSC A;  3R17 B;  4K0Z A;  3N2P A;  3RZ1 B;  1CAK A;  3MNH A;  3M1Q A;  3SAX A;  4MDG A;  2ILI A;  1UGE A;  4KNI A;  3MNK A;  5E5R A;  12CA A;  2POW A;  5EH8 A;  3KOI A;  1BNU A;  2X7T A;  3N3J A;  1TB0 X;  5IPZ A;  4Q6D A;  3DVD A;  3MHI A;  3RZ8 A;  5EHW A;  3M1K A;  3HKN A;  1Z97 A;  5FL6 A;  2POU A;  5A25 A;  4QSB A;  5JEH B;  5SZ1 A;  1CNB A;  1CNX A;  4PZH A;  4K13 A;  1KEQ A;  5FNM A;  3GZ0 A;  3T84 A;  1IF7 A;  4JSS A;  3M2Z A;  2FMZ A;  3D93 A;  4N16 A;  5EH5 A;  2FOS A;  2GEH A;  4KUW A;  2NN1 A;  1BNQ A;  4QSI A;  4WUQ A;  5DSQ A;  2FNK A;  2O4Z A;  2NN7 A;  5DSL A;  3RYY A;  4MLX A;  5J8Z A;  4HBA A;  4YGN A;  1BCD A;  4Z1K A;  3NI5 A;  3F4X A;  3OKU A;  5EKJ A;  3S75 B;  4QSJ A;  1CAN A;  4KNN A;  1ZGE A;  5DSR A;  4K1Q A;  2POV A;  3TMJ A;  1HVA A;  4XFW A;  3KNE A;  5JDV B;  1RAZ A;  1ZSA A;  4E9O X;  3W6H A;  1JV0 A;  3V3F A;  1LG6 A;  3ZP9 A;  3MNU A;  3C7P A;  3P3H A;  4QK3 A;  5BRW A;  5BNL A;  2GD8 A;  4ZAO A;  3RYJ B;  5FLP A;  5L6K A;  3HKU A;  4XE1 A;  4R59 A;  4Q90 A;  4Q81 A;  5FNI A;  5BRV A;  5EKH A;  3RGE A;  4ZX0 A;  1LUG A;  1CA2 A;  4QJP A;  5DSO A;  5FL5 A;  1CAJ A;  1HCA A;  1IF8 A;  5DSM A;  4WUP A;  4CNW A;  3MHL A;  2Q38 A;  1OQ5 A;  3SBI A;  1ZFQ A;  3U47 A;  3HKT A;  3W6I A;  3M96 A;  5FLO A;  2H4N A;  4Q6E A;  1J9W A;  1MOO A;  2CBA A;  2CBB A;  3DVB A;  4KP5 A;  4ZWY A;  5JG3 B;  5AMD A;  4YGL A;  3JXG A;  1BNN A;  1RJ5 A;  2FNM A;  3HKQ A;  3SBH A;  2QO8 A;  3HLJ A;  1KWQ A;  1G4O A;  4XZ5 A;  1FLJ A;  4YHA A;  3V3J A;  1FQN A;  4Q7W A;  1I9O A;  4TWM A;  4UOV A;  4TWL A;  3OYS A;  2NNG A;  2W2J A;  1BIC A;  4FVN A;  5SZ6 A;  3N4B A;  3MHM A;  3RG3 A;  1YDA A;  3DCC A;  1AZM A;  1V9E A;  4DZ9 A;  1CNJ A;  4KP8 A;  5FLS A;  4M2U A;  4QK2 A;  4MLT A;  5EOI A;  4RUX A;  1THK A;  3DCW A;  2WEG A;  1CRA A;  3K7K A;  5SZ2 A;  1JCZ A;  1BN1 A;  2ZNC A;  1G45 A;  3MMF A;  1UGF A;  5G0C A;  4HT2 A;  2FOQ A;  1FSN A;  4QSA A;  3IBL A;  2HD6 A;  4HF3 A;  1HCB A;  4PXX A;  2AW1 A;  3T82 A;  3BL0 A;  3U3A X;  5AMG A;  2CBC A;  4CA2 A;  2HNC A;  2CBE A;  4YWP A;  2VVB X;  4LU3 A;  3S73 B;  3DVC A;  1IF9 A;  4QIZ A;  4CNX A;  2HOC A;  4YYT A;  5JQ0 A;  1YO0 A;  1G54 A;  5DRS A;  5EZT X;  3B4F A;  1EOU A;  3M2X A;  4YGK A;  5JEG B;  3CA2 A;  1BNW A;  3DBU A;  1H9Q A;  1UGA A;  1ZE8 A;  2QOA A;  4Q0L A;  1G53 A;  2WD3 A;  1CAY A;  4N0X B;  4PQ7 A;  3IGP A;  5DSN A;  2HFW A;  2X7U A;  1CVC A;  2QP6 A;  4Q07 A;  3UYQ A;  4XIX A;  3KS3 A;  5SZ3 A;  4WW8 A;  5FNL A;  4BF6 A;  3MYQ A;  3D92 A;  3V5G A;  1CZM A;  3S74 B;  4Z1N A;  5DSK A;  3F7U A;  4MO8 A;  2FOV A;  4YXI A;  3T85 A;  1HED A;  4CAC A;  1YDD A;  1RZA A;  4FRC A;  2FNN A;  5FLQ A;  4Q83 A;  4KUY A;  4WW6 A;  3HS4 A;  5E5U A;  2AX2 A;  1YDC A;  4K0T A;  5JG5 B;  3S8X A;  1G1D A;  3M14 A;  1HUH A;  1CAM A;  1RJ6 A;  1YO1 A;  1UGB A;  4G7A A;  4R5A A;  5JGS B;  4Q78 A;  2Q1B A;  3K34 A;  2CA2 A;  3DD0 A;  1TE3 X;  4CQ0 A;  1FQM A;  1CCS A;  3EFT A;  5JGT B;  3F8E A;  4PYY A;  5E2R A;  1UGG A;  5FDI A;  4ZWI A;  4Q06 A;  5BRU A;  5CA2 A;  1AVN A;  4Q49 A;  4R5B A;  3F7B A;  5AML A;  3RYV B;  1G48 A;  5DVX A;  1CRM A;  3M04 A;  2WD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...