The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
63
|
sequence length |
208
|
structure length |
208
|
Chain Sequence |
STGMVMVHEVPFPPQIITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLDNWKGKTGKELAGDDDFFDALASAEMEKVIRVVVIKEIKGAQYGVQLENTVRDRLAEEDKYEEEEETELEKVVGFFQSKYFKANSVITYHFSAKDGICEIGFETEGKEEEKLKVENANVVGMMQRWYLSGSRGVSPSTIVSIADSISAVLT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Isomerase
|
molecule keywords |
Similarity to chalcone-flavonone isomerase
|
publication title |
Evolution of the chalcone-isomerase fold from fatty-acid binding to stereospecific catalysis.
pubmed doi rcsb |
source organism |
Arabidopsis thaliana
|
total genus |
63
|
structure length |
208
|
sequence length |
208
|
chains with identical sequence |
B
|
ec nomenclature |
ec
5.5.1.6: Chalcone isomerase. |
pdb deposition date | 2012-02-09 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02431 | Chalcone | Chalcone-flavanone isomerase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | 10k-s Protein, Hypothetical Protein A; Chain A | 10k-s Protein, Hypothetical Protein A; Chain A | ||
Alpha Beta | 3-Layer(bba) Sandwich | Chalcone isomerase | Chalcone isomerase |
#chains in the Genus database with same CATH superfamily 1JX1 A; 4DOO A; 1JX0 A; 1EYP A; 4DOI A; 4DOK A; 1EYQ A; 1JEP A; 4DOL A; 1FM8 A; 1FM7 A; #chains in the Genus database with same CATH topology 1DJ8 A; 2JE3 A; 2JE2 A; 1FM7 A; 4DOO A; 2LRV A; 1JX0 A; 4BI8 A; 1JEP A; 1FM8 A; 1BG8 A; 1JX1 A; 4DOI A; 4DOK A; 4XVV A; 3ZFI A; 4DOL A; 2MYJ A; 1EYP A; 2XUV A; 1EYQ A; 2LRM A; #chains in the Genus database with same CATH homology 1JX1 A; 4DOO A; 2LRV A; 1JX0 A; 1EYP A; 4DOI A; 4DOK A; 4BI8 A; 1EYQ A; 3ZFI A; 1JEP A; 4DOL A; 2JE3 A; 1FM8 A; 2LRM A; 2JE2 A; 1FM7 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...