4I6NA

Crystal structure of trichinella spiralis uch37 catalytic domain bound to ubiquitin vinyl methyl ester
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
Knots found
sequence length
229
structure length
219
Chain Sequence
PLGSMAEGNWCLIESDPGIFTEMIHGFGCTGLQVEELVVLDESIEHLKPIHGFIFLFRWLKKEMRKEVDDSPQTCTDVYFSQQVIQNACASQALINLLLNCDHPDVDLGPTLKEFKDFTYDLDSASRGLCLTNSEKIRAVHNSFGQKLDEEDVFHFVTYVPVNDGVYELDGLRAAPLRLGTVASDGDWTEVAIKAIKEKIKNYGESEVRFNLMAVISDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-hydrolase
publication title Stabilization of an Unusual Salt Bridge in Ubiquitin by the Extra C-Terminal Domain of the Proteasome-Associated Deubiquitinase UCH37 as a Mechanism of Its Exo Specificity.
pubmed doi rcsb
source organism Trichinella spiralis
molecule tags Hydrolase/signaling protein
total genus 64
structure length 219
sequence length 229
chains with identical sequence C
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature
pdb deposition date 2012-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.532.10 Alpha Beta 3-Layer(aba) Sandwich Ubiquitin C-terminal Hydrolase UCH-l3 Peptidase C12, ubiquitin carboxyl-terminal hydrolase 4i6nA00
2LENA 3KW5A 4JKJA 3A7SA 4UELA 3KVFA 4IG7A 3RIIA 4UEMA 3IRTA 3IHRA 3RISA 2ETLA 4DM9A 4I6NA 3IFWA 1UCHA 1CMXA 1XD3A 3TB3A
chains in the Genus database with same CATH superfamily
2LENA 3KW5A 4JKJA 3A7SA 4UELA 3KVFA 4IG7A 3RIIA 4UEMA 3IRTA 3IHRA 3RISA 2ETLA 4DM9A 4I6NA 3IFWA 1UCHA 1CMXA 1XD3A 3TB3A
chains in the Genus database with same CATH topology
2LENA 3KW5A 4JKJA 3A7SA 4UELA 3KVFA 4IG7A 3RIIA 4UEMA 3IRTA 3IHRA 3RISA 2ETLA 4DM9A 4I6NA 3IFWA 1UCHA 1CMXA 1XD3A 3TB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LEN A;  3KW5 A;  4JKJ A;  3A7S A;  4UEL A;  3KVF A;  4IG7 A;  3RII A;  4UEM A;  3IRT A;  3IHR A;  3RIS A;  2ETL A;  4DM9 A;  4I6N A;  3IFW A;  1UCH A;  1CMX A;  1XD3 A;  3TB3 A; 
#chains in the Genus database with same CATH topology
 2LEN A;  3KW5 A;  4JKJ A;  3A7S A;  4UEL A;  3KVF A;  4IG7 A;  3RII A;  4UEM A;  3IRT A;  3IHR A;  3RIS A;  2ETL A;  4DM9 A;  4I6N A;  3IFW A;  1UCH A;  1CMX A;  1XD3 A;  3TB3 A; 
#chains in the Genus database with same CATH homology
 2LEN A;  3KW5 A;  4JKJ A;  3A7S A;  4UEL A;  3KVF A;  4IG7 A;  3RII A;  4UEM A;  3IRT A;  3IHR A;  3RIS A;  2ETL A;  4DM9 A;  4I6N A;  3IFW A;  1UCH A;  1CMX A;  1XD3 A;  3TB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...