4KJDA

Ratintestinal ap expressed in e. coli
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
Knots found
sequence length
478
structure length
407
Chain Sequence
VEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVTLRHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intestinal-type alkaline phosphatase 1
publication title Crystal structure of rat intestinal alkaline phosphatase - Role of crown domain in mammalian alkaline phosphatases.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 148
structure length 407
sequence length 478
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.1.3.1: Alkaline phosphatase.
pdb deposition date 2013-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00245 Alk_phosphatase Alkaline phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4kjdA00
3M8ZA 4KJGA 1E33P 1E1ZP 2G9YA 2ANHA 3IGZB 2W8SA 2W5WA 4CYRA 1Y7AA 3BDFA 4KAVA 3A52A 3CMRA 4FDIA 5DLVA 2GSOA 2RH6A 3M8YA 4GTZA 4UOOA 3E2DA 4LR8A 3T02A 5L0EA 3DPCA 4CXKA 2W8DA 5HRTA 1ANIA 1AJDA 3MK2A 1ALKA 5EGEA 1EI6A 2IUCA 2XR9A 2W5SA 4NWXA 3WAYA 1KHKA 3UN2A 1HJKA 4LRDA 3Q3QA 3OT9A 1EQJA 2W5RA 1ALJA 1AJBA 5DLTA 5K4PA 5IJQA 1URAA 1E2SP 4UPIA 1ALHA 3NKRA 3KD8A 1KHNA 2W5VA 2W5XA 2X98A 4KJDA 3WBHA 4LQYA 3UN3A 2QZUA 3NVLA 5TJ3A 2GSUA 2VQRA 4ZGAA 1HQAA 3SZZA 4LR9A 1SHQA 4LRBA 1ZEBA 1KHJA 1KH5A 4KM4A 4N7TA 1ELZA 2W5TA 3WAVA 1ELYA 3NKMA 4UPLA 4QAXA 1AJAA 5DLWA 4MHXA 4UPHA 3NKQA 5INHA 2D1GA 2GSNA 5IJSA 1URBA 4UOPA 5AJ9A 1ED9A 4FDJA 3B5QA 5LQQA 1KH4A 2IFYA 3IDDA 1ALIA 2W5QA 1K7HA 1ZEFA 4CXSA 1Y6VA 4KAYA 5GOVA 2IUCB 4LR2A 3ED4A 3NKOA 3IGYB 5LRNA 5LIAA 1ZEDA 5KXAA 5GRRA 2GLQA 4GTYA 4UORA 4LREA 4LR7A 2GA3A 3BDHA 3UO0A 1EW8A 1N2LA 3DYCA 4MY4A 1ELXA 4ZG6A 3UN5A 3MK0A 4ZG7A 5LRMA 3MK1A 4GTWA 3UNYA 1N2KA 4MIVA 1AUKA 4LRAA 4TN0A 1O99A 1E3CP 4NWJA 3BDGB 3NKNA 5L0BA 3T00A 1ED8A 3WAWA 3WAXA 5C66A 3TWZA 4CXUA 4CYSA 4LRFA 1EW9A 3SZYA 1HDHA 3M8WA 3M7VA 1KH9A 3NKPA 1P49A 4B56A 4YR1A 4LRCA 3T01A 4ZG9A 1B8JA 3BDGA 3LXQA 1KH7A 3TG0A 4UPKA 1FSUA 1O98A 1EW2A 1SHNA 5EGHA 1KHLA 1AJCA 5L0KA 4GTXA 2XRGA 1ANJA 1EJJA 3TX0A 2ZKTA
chains in the Genus database with same CATH superfamily
3M8ZA 4KJGA 1E33P 1E1ZP 2G9YA 2ANHA 3IGZB 2W8SA 2W5WA 4CYRA 1Y7AA 3BDFA 4KAVA 3A52A 3CMRA 4FDIA 5DLVA 2GSOA 2RH6A 3M8YA 4GTZA 4UOOA 3E2DA 4LR8A 3T02A 5L0EA 3DPCA 4CXKA 2W8DA 5HRTA 1ANIA 1AJDA 3MK2A 1ALKA 5EGEA 1EI6A 2IUCA 2XR9A 2W5SA 4NWXA 3WAYA 1KHKA 3UN2A 1HJKA 4LRDA 3Q3QA 3OT9A 1EQJA 2W5RA 1ALJA 1AJBA 5DLTA 5K4PA 5IJQA 1URAA 1E2SP 4UPIA 1ALHA 3NKRA 3KD8A 1KHNA 2W5VA 2W5XA 2X98A 4KJDA 3WBHA 4LQYA 3UN3A 2QZUA 3NVLA 5TJ3A 2GSUA 2VQRA 4ZGAA 1HQAA 3SZZA 4LR9A 1SHQA 4LRBA 1ZEBA 1KHJA 1KH5A 4KM4A 4N7TA 1ELZA 2W5TA 3WAVA 1ELYA 3NKMA 4UPLA 4QAXA 1AJAA 5DLWA 4MHXA 4UPHA 3NKQA 5INHA 2D1GA 2GSNA 5IJSA 1URBA 4UOPA 5AJ9A 1ED9A 4FDJA 3B5QA 5LQQA 1KH4A 2IFYA 3IDDA 1ALIA 2W5QA 1K7HA 1ZEFA 4CXSA 1Y6VA 4KAYA 5GOVA 2IUCB 4LR2A 3ED4A 3NKOA 3IGYB 5LRNA 5LIAA 1ZEDA 5KXAA 5GRRA 2GLQA 4GTYA 4UORA 4LREA 4LR7A 2GA3A 3BDHA 3UO0A 1EW8A 1N2LA 3DYCA 4MY4A 1ELXA 4ZG6A 3UN5A 3MK0A 4ZG7A 5LRMA 3MK1A 4GTWA 3UNYA 1N2KA 4MIVA 1AUKA 4LRAA 4TN0A 1O99A 1E3CP 4NWJA 3BDGB 3NKNA 5L0BA 3T00A 1ED8A 3WAWA 3WAXA 5C66A 3TWZA 4CXUA 4CYSA 4LRFA 1EW9A 3SZYA 1HDHA 3M8WA 3M7VA 1KH9A 3NKPA 1P49A 4B56A 4YR1A 4LRCA 3T01A 4ZG9A 1B8JA 3BDGA 3LXQA 1KH7A 3TG0A 4UPKA 1FSUA 1O98A 1EW2A 1SHNA 5EGHA 1KHLA 1AJCA 5L0KA 4GTXA 2XRGA 1ANJA 1EJJA 3TX0A 2ZKTA
chains in the Genus database with same CATH topology
3M8ZA 4KJGA 1E33P 1E1ZP 2G9YA 2ANHA 3IGZB 2W8SA 2W5WA 4CYRA 1Y7AA 3BDFA 4KAVA 3A52A 3CMRA 4FDIA 5DLVA 2GSOA 2RH6A 3M8YA 4GTZA 4UOOA 3E2DA 4LR8A 3T02A 5L0EA 3DPCA 4CXKA 2W8DA 5HRTA 1ANIA 1AJDA 3MK2A 1ALKA 5EGEA 1EI6A 2IUCA 2XR9A 2W5SA 4NWXA 3WAYA 1KHKA 3UN2A 1HJKA 4LRDA 3Q3QA 3OT9A 1EQJA 2W5RA 1ALJA 1AJBA 5DLTA 5K4PA 5IJQA 1URAA 1E2SP 4UPIA 1ALHA 3NKRA 3KD8A 1KHNA 2W5VA 2W5XA 2X98A 4KJDA 3WBHA 4LQYA 3UN3A 2QZUA 3NVLA 5TJ3A 2GSUA 2VQRA 4ZGAA 1HQAA 3SZZA 4LR9A 1SHQA 4LRBA 1ZEBA 1KHJA 1KH5A 4KM4A 4N7TA 1ELZA 2W5TA 3WAVA 1ELYA 3NKMA 4UPLA 4QAXA 1AJAA 5DLWA 4MHXA 4UPHA 3NKQA 5INHA 2D1GA 2GSNA 5IJSA 1URBA 4UOPA 5AJ9A 1ED9A 4FDJA 3B5QA 5LQQA 1KH4A 2IFYA 3IDDA 1ALIA 2W5QA 1K7HA 1ZEFA 4CXSA 1Y6VA 4KAYA 5GOVA 2IUCB 4LR2A 3ED4A 3NKOA 3IGYB 5LRNA 5LIAA 1ZEDA 5KXAA 5GRRA 2GLQA 4GTYA 4UORA 4LREA 4LR7A 2GA3A 3BDHA 3UO0A 1EW8A 1N2LA 3DYCA 4MY4A 1ELXA 4ZG6A 3UN5A 3MK0A 4ZG7A 5LRMA 3MK1A 4GTWA 3UNYA 1N2KA 4MIVA 1AUKA 4LRAA 4TN0A 1O99A 1E3CP 4NWJA 3BDGB 3NKNA 5L0BA 3T00A 1ED8A 3WAWA 3WAXA 5C66A 3TWZA 4CXUA 4CYSA 4LRFA 1EW9A 3SZYA 1HDHA 3M8WA 3M7VA 1KH9A 3NKPA 1P49A 4B56A 4YR1A 4LRCA 3T01A 4ZG9A 1B8JA 3BDGA 3LXQA 1KH7A 3TG0A 4UPKA 1FSUA 1O98A 1EW2A 1SHNA 5EGHA 1KHLA 1AJCA 5L0KA 4GTXA 2XRGA 1ANJA 1EJJA 3TX0A 2ZKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M8Z A;  4KJG A;  1E33 P;  1E1Z P;  2G9Y A;  2ANH A;  3IGZ B;  2W8S A;  2W5W A;  4CYR A;  1Y7A A;  3BDF A;  4KAV A;  3A52 A;  3CMR A;  4FDI A;  5DLV A;  2GSO A;  2RH6 A;  3M8Y A;  4GTZ A;  4UOO A;  3E2D A;  4LR8 A;  3T02 A;  5L0E A;  3DPC A;  4CXK A;  2W8D A;  5HRT A;  1ANI A;  1AJD A;  3MK2 A;  1ALK A;  5EGE A;  1EI6 A;  2IUC A;  2XR9 A;  2W5S A;  4NWX A;  3WAY A;  1KHK A;  3UN2 A;  1HJK A;  4LRD A;  3Q3Q A;  3OT9 A;  1EQJ A;  2W5R A;  1ALJ A;  1AJB A;  5DLT A;  5K4P A;  5IJQ A;  1URA A;  1E2S P;  4UPI A;  1ALH A;  3NKR A;  3KD8 A;  1KHN A;  2W5V A;  2W5X A;  2X98 A;  4KJD A;  3WBH A;  4LQY A;  3UN3 A;  2QZU A;  3NVL A;  5TJ3 A;  2GSU A;  2VQR A;  4ZGA A;  1HQA A;  3SZZ A;  4LR9 A;  1SHQ A;  4LRB A;  1ZEB A;  1KHJ A;  1KH5 A;  4KM4 A;  4N7T A;  1ELZ A;  2W5T A;  3WAV A;  1ELY A;  3NKM A;  4UPL A;  4QAX A;  1AJA A;  5DLW A;  4MHX A;  4UPH A;  3NKQ A;  5INH A;  2D1G A;  2GSN A;  5IJS A;  1URB A;  4UOP A;  5AJ9 A;  1ED9 A;  4FDJ A;  3B5Q A;  5LQQ A;  1KH4 A;  2IFY A;  3IDD A;  1ALI A;  2W5Q A;  1K7H A;  1ZEF A;  4CXS A;  1Y6V A;  4KAY A;  5GOV A;  2IUC B;  4LR2 A;  3ED4 A;  3NKO A;  3IGY B;  5LRN A;  5LIA A;  1ZED A;  5KXA A;  5GRR A;  2GLQ A;  4GTY A;  4UOR A;  4LRE A;  4LR7 A;  2GA3 A;  3BDH A;  3UO0 A;  1EW8 A;  1N2L A;  3DYC A;  4MY4 A;  1ELX A;  4ZG6 A;  3UN5 A;  3MK0 A;  4ZG7 A;  5LRM A;  3MK1 A;  4GTW A;  3UNY A;  1N2K A;  4MIV A;  1AUK A;  4LRA A;  4TN0 A;  1O99 A;  1E3C P;  4NWJ A;  3BDG B;  3NKN A;  5L0B A;  3T00 A;  1ED8 A;  3WAW A;  3WAX A;  5C66 A;  3TWZ A;  4CXU A;  4CYS A;  4LRF A;  1EW9 A;  3SZY A;  1HDH A;  3M8W A;  3M7V A;  1KH9 A;  3NKP A;  1P49 A;  4B56 A;  4YR1 A;  4LRC A;  3T01 A;  4ZG9 A;  1B8J A;  3BDG A;  3LXQ A;  1KH7 A;  3TG0 A;  4UPK A;  1FSU A;  1O98 A;  1EW2 A;  1SHN A;  5EGH A;  1KHL A;  1AJC A;  5L0K A;  4GTX A;  2XRG A;  1ANJ A;  1EJJ A;  3TX0 A;  2ZKT A; 
#chains in the Genus database with same CATH topology
 3M8Z A;  4KJG A;  1E33 P;  1E1Z P;  2G9Y A;  2ANH A;  3IGZ B;  2W8S A;  2W5W A;  4CYR A;  1Y7A A;  3BDF A;  4KAV A;  3A52 A;  3CMR A;  4FDI A;  5DLV A;  2GSO A;  2RH6 A;  3M8Y A;  4GTZ A;  4UOO A;  3E2D A;  4LR8 A;  3T02 A;  5L0E A;  3DPC A;  4CXK A;  2W8D A;  5HRT A;  1ANI A;  1AJD A;  3MK2 A;  1ALK A;  5EGE A;  1EI6 A;  2IUC A;  2XR9 A;  2W5S A;  4NWX A;  3WAY A;  1KHK A;  3UN2 A;  1HJK A;  4LRD A;  3Q3Q A;  3OT9 A;  1EQJ A;  2W5R A;  1ALJ A;  1AJB A;  5DLT A;  5K4P A;  5IJQ A;  1URA A;  1E2S P;  4UPI A;  1ALH A;  3NKR A;  3KD8 A;  1KHN A;  2W5V A;  2W5X A;  2X98 A;  4KJD A;  3WBH A;  4LQY A;  3UN3 A;  2QZU A;  3NVL A;  5TJ3 A;  2GSU A;  2VQR A;  4ZGA A;  1HQA A;  3SZZ A;  4LR9 A;  1SHQ A;  4LRB A;  1ZEB A;  1KHJ A;  1KH5 A;  4KM4 A;  4N7T A;  1ELZ A;  2W5T A;  3WAV A;  1ELY A;  3NKM A;  4UPL A;  4QAX A;  1AJA A;  5DLW A;  4MHX A;  4UPH A;  3NKQ A;  5INH A;  2D1G A;  2GSN A;  5IJS A;  1URB A;  4UOP A;  5AJ9 A;  1ED9 A;  4FDJ A;  3B5Q A;  5LQQ A;  1KH4 A;  2IFY A;  3IDD A;  1ALI A;  2W5Q A;  1K7H A;  1ZEF A;  4CXS A;  1Y6V A;  4KAY A;  5GOV A;  2IUC B;  4LR2 A;  3ED4 A;  3NKO A;  3IGY B;  5LRN A;  5LIA A;  1ZED A;  5KXA A;  5GRR A;  2GLQ A;  4GTY A;  4UOR A;  4LRE A;  4LR7 A;  2GA3 A;  3BDH A;  3UO0 A;  1EW8 A;  1N2L A;  3DYC A;  4MY4 A;  1ELX A;  4ZG6 A;  3UN5 A;  3MK0 A;  4ZG7 A;  5LRM A;  3MK1 A;  4GTW A;  3UNY A;  1N2K A;  4MIV A;  1AUK A;  4LRA A;  4TN0 A;  1O99 A;  1E3C P;  4NWJ A;  3BDG B;  3NKN A;  5L0B A;  3T00 A;  1ED8 A;  3WAW A;  3WAX A;  5C66 A;  3TWZ A;  4CXU A;  4CYS A;  4LRF A;  1EW9 A;  3SZY A;  1HDH A;  3M8W A;  3M7V A;  1KH9 A;  3NKP A;  1P49 A;  4B56 A;  4YR1 A;  4LRC A;  3T01 A;  4ZG9 A;  1B8J A;  3BDG A;  3LXQ A;  1KH7 A;  3TG0 A;  4UPK A;  1FSU A;  1O98 A;  1EW2 A;  1SHN A;  5EGH A;  1KHL A;  1AJC A;  5L0K A;  4GTX A;  2XRG A;  1ANJ A;  1EJJ A;  3TX0 A;  2ZKT A; 
#chains in the Genus database with same CATH homology
 3M8Z A;  4KJG A;  1E33 P;  1E1Z P;  2G9Y A;  2ANH A;  3IGZ B;  2W8S A;  2W5W A;  4CYR A;  1Y7A A;  3BDF A;  4KAV A;  3A52 A;  3CMR A;  4FDI A;  5DLV A;  2GSO A;  2RH6 A;  3M8Y A;  4GTZ A;  4UOO A;  3E2D A;  4LR8 A;  3T02 A;  5L0E A;  3DPC A;  4CXK A;  2W8D A;  5HRT A;  1ANI A;  1AJD A;  3MK2 A;  1ALK A;  5EGE A;  1EI6 A;  2IUC A;  2XR9 A;  2W5S A;  4NWX A;  3WAY A;  1KHK A;  3UN2 A;  1HJK A;  4LRD A;  3Q3Q A;  3OT9 A;  1EQJ A;  2W5R A;  1ALJ A;  1AJB A;  5DLT A;  5K4P A;  5IJQ A;  1URA A;  1E2S P;  4UPI A;  1ALH A;  3NKR A;  3KD8 A;  1KHN A;  2W5V A;  2W5X A;  2X98 A;  4KJD A;  3WBH A;  4LQY A;  3UN3 A;  2QZU A;  3NVL A;  5TJ3 A;  2GSU A;  2VQR A;  4ZGA A;  1HQA A;  3SZZ A;  4LR9 A;  1SHQ A;  4LRB A;  1ZEB A;  1KHJ A;  1KH5 A;  4KM4 A;  4N7T A;  1ELZ A;  2W5T A;  3WAV A;  1ELY A;  3NKM A;  4UPL A;  4QAX A;  1AJA A;  5DLW A;  4MHX A;  4UPH A;  3NKQ A;  5INH A;  2D1G A;  2GSN A;  5IJS A;  1URB A;  4UOP A;  5AJ9 A;  1ED9 A;  4FDJ A;  3B5Q A;  5LQQ A;  1KH4 A;  2IFY A;  3IDD A;  1ALI A;  2W5Q A;  1K7H A;  1ZEF A;  4CXS A;  1Y6V A;  4KAY A;  5GOV A;  2IUC B;  4LR2 A;  3ED4 A;  3NKO A;  3IGY B;  5LRN A;  5LIA A;  1ZED A;  5KXA A;  5GRR A;  2GLQ A;  4GTY A;  4UOR A;  4LRE A;  4LR7 A;  2GA3 A;  3BDH A;  3UO0 A;  1EW8 A;  1N2L A;  3DYC A;  4MY4 A;  1ELX A;  4ZG6 A;  3UN5 A;  3MK0 A;  4ZG7 A;  5LRM A;  3MK1 A;  4GTW A;  3UNY A;  1N2K A;  4MIV A;  1AUK A;  4LRA A;  4TN0 A;  1O99 A;  1E3C P;  4NWJ A;  3BDG B;  3NKN A;  5L0B A;  3T00 A;  1ED8 A;  3WAW A;  3WAX A;  5C66 A;  3TWZ A;  4CXU A;  4CYS A;  4LRF A;  1EW9 A;  3SZY A;  1HDH A;  3M8W A;  3M7V A;  1KH9 A;  3NKP A;  1P49 A;  4B56 A;  4YR1 A;  4LRC A;  3T01 A;  4ZG9 A;  1B8J A;  3BDG A;  3LXQ A;  1KH7 A;  3TG0 A;  4UPK A;  1FSU A;  1O98 A;  1EW2 A;  1SHN A;  5EGH A;  1KHL A;  1AJC A;  5L0K A;  4GTX A;  2XRG A;  1ANJ A;  1EJJ A;  3TX0 A;  2ZKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...