4KNNA

Crystal structure of human carbonic anhydrase isozyme xiii with 2-chloro-4-[(pyrimidin-2-ylsulfanyl)acetyl]benzenesulfonamide
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
Knots found
sequence length
258
structure length
258
Chain Sequence
SWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonic anhydrase 13
publication title Benzenesulfonamides with pyrimidine moiety as inhibitors of human carbonic anhydrases I, II, VI, VII, XII, and XIII
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase/lyase inhibitor
total genus 78
structure length 258
sequence length 258
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 4knnA00
3RZ5A 4ZX0A 4DZ9A 2POWA 1JV0A 4E5QA 5FNKA 2GEHA 1DMYA 3D8WA 1URTA 3M2NA 4ITPA 1FR7A 3RZ7A 3MHLA 3S78B 2IT4A 3M2YA 3U3AX 3BL1A 1OQ5A 1OKLA 1RJ5A 4R5BA 3V3IB 1RZBA 4PQ7A 5C8IA 2NNVA 2CBDA 4Q09A 3PYKA 5FNIA 5E2MA 1BNWA 1MOOA 5JGSB 5FL5A 5DSJA 4E4AA 2ILIA 5L6KA 4DZ7A 4Z1KA 2FOVA 4Q08A 1F2WA 4ZWZA 5DSKA 4G7AA 3IBIA 3NJ9A 2WD3A 3MHCA 4QSIA 3DCSA 3S72B 1CINA 3M2ZA 4XFWA 2QOAA 5FLQA 3R17B 5JG5B 1CNGA 3K2FA 1YDAA 3NB5A 4JS6A 1FQNA 5A25A 5DSMA 5EKHA 4YGFA 4Q7PA 1EOUA 1YDDA 5EIJA 3DV7A 1JCZA 1HEDA 1IF4A 2VVAX 3V2JA 3M67A 3MHMA 1ZSAA 2AX2A 3RYVB 3M2XA 4CNVA 1CNCA 1TEQX 4C3TA 1OKMA 4IWZA 1UGGA 4Q0LA 4QIYA 5EOIA 1CVHA 4ZWXA 3D92A 1RZEA 3P3HA 3DVDA 1I9NA 4L5WA 3M1JA 3MHOA 3OY0A 1BNTA 1FSQA 1ZNCA 1CNYA 4X5SA 5E5RA 5SZ6A 4E3FA 4YGLA 5E2NA 1G52A 2CBAA 5J8ZA 9CA2A 3B1BA 3S73B 4YXIA 1ZGFA 3S9TA 1G53A 3HLJA 5AMGA 1DCAA 1KOPA 4IDRX 3BL0A 4QJOA 4JSSA 1CAYA 3HKQA 2GD8A 1UGCA 2CA2A 2H15A 1RAZA 4E3GA 4FRCA 1CAMA 1CCTA 4K1QA 1G0FA 2FMGA 1CRAA 2POUA 5IPZA 4QIZA 4RFCA 3ML5A 3DBUA 1Z97A 3DC9A 3EFIA 1UGAA 1I9MA 1H4NA 1YO1A 5BNLA 4Q78A 4MO8A 5DOGA 1UGBA 2AW1A 3DCWA 2Q1BA 3M5EA 3RYXB 4G0CA 2WEGA 3CZVA 1CAZA 3MNJA 3IBUA 3F7BA 1G0EA 1CCSA 4Q7SA 4LU3A 2NWOA 4KNIA 4QY3A 3HKNA 3MNKA 2ABEA 1BNNA 1CNWA 1CVBA 1I9LA 2WD2A 1CVAA 3SBIA 3M5TA 3T5UA 3ZP9A 4RIVA 2F14A 3OKVA 5FLSA 5SZ1A 4ZWIA 3RGEA 3RYJB 4Q83A 5DSOA 2H4NA 2HOCA 4M2UA 3SAXA 4QEFA 1HEBA 3V3GB 12CAA 3DAZA 4N0XB 4YGNA 2NXTA 4TWLA 1FQRA 3OIKA 1LUGA 5EZTX 3HKTA 2CBEA 2WEOA 4L5UA 3UYQA 3P58A 1V9IC 4HU1A 5BYIA 1I9PA 5JG3B 4CA2A 4YGJA 1HEAA 2EZ7A 4RUYA 4Q06A 4QSJA 4QJ0A 3FFPX 1TBTX 3FW3A 1TE3X 3IBNA 3S74B 4BCWA 1IF9A 2NWPA 4WUPA 1FQLA 5A6HA 1CANA 1HVAA 1THKA 3OKUA 4QK1A 4KUVA 4Q8XA 1YO2A 4MDMA 3RZ8A 1G3ZA 1RAYA 1LGDA 4KNNA 5FNGA 2QO8A 1CRMA 4HT0A 1TB0X 1HCBA 4QJPA 2EU2A 1TH9A 3VBDA 2NXRA 3HFPA 1AVNA 3SBHA 5CACA 3TMJA 1IF7A 3M14A 5FLRA 4E9OX 3F7UA 1CALA 4RUXA 3KWAA 3P5AA 1FLJA 1I9OA 4Z1EA 1CNKA 1KEQA 2FNMA 3GZ0A 1CAJA 4QJMA 5G03A 1XEGA 5EKJA 1XQ0A 1I8ZA 2WEHA 3SAPA 2W2JA 5JEGB 5SZ5A 2X7UA 2Q38A 3DCCA 3S97A 2Q1QA 3JXHC 4QSAA 3MWOA 4CNRA 2HFWA 4WL4A 2NNOA 1BNQA 2HL4A 3F4XA 1RJ6A 3MNUA 1KWRA 2NNGA 2FNNA 5E2RA 1HCAA 1CA3A 5G0CA 4QTLA 5JESB 1T9NA 3M40A 5EHVA 3KLDB 3V2MA 2NMXA 2FW4A 3D9ZA 3DD8A 4Q99A 1MUAA 4Q9YA 5E28A 3JXFA 3S77B 5SZ0A 3OILA 4L5VA 4HF3A 5FLOA 1CAIA 3P3JA 1ZFQA 1Z93A 1BN1A 4MLXA 2HKKA 3DVCA 5BRVA 3UYNA 3T85A 3W6HA 4E3DA 4XIXA 1CNXA 1RZAA 3L14A 1BCDA 2HD6A 2NN1A 3DVBA 1KWQA 1BICA 1TTMA 1Y7WA 3HS4A 4Q81A 3OYSA 1HUGA 1BZMA 3K34A 1BNVA 5E5UA 3S76A 4XE1A 4PXXA 5FNMA 4YX4A 3C7PA 3R16A 1CA2A 1CCUA 2NXSA 4Q6DA 3ML2A 5EH8A 3MNIA 4YXUA 3DC3A 4YXOA 1I90A 5FLTA 4Q7VA 3LXEA 2X7SA 4FL7A 5DSQA 4MDGA 3S75B 1DMXA 1G46A 3MNAA 3N0NA 4CQ0A 5DRSA 4K0SA 1IF5A 3DA2A 1G54A 1AZMA 4K0TA 4XIWA 5SZ3A 4Q90A 1J9WA 1I91A 3P4VA 3B4FA 4FPTA 3OYQA 3M5SA 1G6VA 1ZH9A 4M2RA 3Q31A 4QSBA 3PJJA 1FQMA 1ZGEA 2POVA 3CAJA 3W6IA 5DOHA 3U7CA 1HECA 1CNJA 3KS3A 5EHWA 4KP5A 4PYYA 3RYYA 6CA2A 1OKNA 1BN4A 4Z1NA 5FL6A 5AMLA 4CNXA 4HBAA 3MMFA 4LP6A 5EHEA 3RYZA 1V9EA 5JEPB 4M2VA 1Z9YA 4M2WA 4FVOA 4MLTA 1G4JA 2OSFA 1TG9A 1YDCA 3RZ0B 1IF6A 5FDIA 1LG6A 4CNWA 5E2SA 2ZNCA 4COQA 3P44A 1TEUX 3RJ7A 1HUHA 1CVDA 3KOKA 3MZCA 4KAPA 4R5AA 1CVFA 3BETA 4Q07A 3T82A 1FSNA 2NWZA 4ZX1A 5BRWA 4K0ZA 3T5ZA 4UOVA 5JGTB 4WW6A 2CABA 3HKUA 4KNMA 4XZ5A 3CA2A 1CAOA 3M1KA 3FE4A 5L3OA 2FMZA 1H9NA 4Q87A 5DSRA 5SZ2A 4GL1X 4YHAA 1AM6A 3V3HB 4LHIA 3EFTA 4QJWA 4RUZA 1LZVA 3ZNCA 4E3HA 5FLPA 5G01A 4KNJA 1KOQA 4ITOA 5EKMA 3TVOX 3P55A 2FOSA 3T83A 3MDZA 5G0BA 4YVYA 4ZWYA 4FIKA 3V3FA 3OIMA 1CAHA 3TVNX 1H9QA 5JQ0A 5JDVB 5FDCA 4QK3A 4K13A 3KNEA 1CVCA 3JXGA 5DVXA 2FOUA 3N3JA 1CZMA 3P5LA 4JSZA 3V5GA 4CACA 3QYKA 3RG4A 1BNUA 4HEZA 1G48A 2FOYA 4TWMA 5CJFA 5DSPA 3KONA 4QJXA 4BF1A 5SZ7A 3S8XA 4PZHA 4Q7WA 1ZSCA 2QP6A 3RLDA 3IBLA 4WW8A 5DSLA 4Z1JA 1YDBA 4HEYA 1CNHA 1DCBA 1I9QA 2O4ZA 1A42A 3KKXA 1RZDA 3IAIA 1IF8A 3F8EA 5FL4A 3IGPA 1FSRA 1ZSBA 4RIUA 4YYTA 5BRUA 3K7KA 1TG3A 1ZE8A 3RZ1B 2CBBA 7CA2A 3N4BA 1XEVA 2VVBX 4YGKA 4KUYA 3V3JA 4JSAA 4RFDA 5HPJA 1YO0A 4Q8YA 3M98A 1BV3A 5FNJA 4Q6EA 3CYUA 1G1DA 2NN7A 3N2PA 5EH7A 3KOIA 4BF6A 3KIGA 3D0NA 1RZCA 5E2KA 4N16A 1BNMA 2WEJA 3M96A 5AMDA 4YWPA 2FOQA 3RG3A 4FVNA 5DSIA 3M1QA 5CLUA 4ZAOA 3MNHA 4JSWA 3U47A 2NWYA 1BN3A 2EU3A 5CA2A 5JEHB 1FR4A 5DSNA 1CIMA 5FNLA 2X7TA 2CBCA 4Q49A 1UGEA 1CVEA 2HNCA 1JD0A 3M3XA 1CAKA 4QK2A 3U45X 3PO6A 4PYXA 4ILXA 1LG5A 5JQTA 3MYQA 5SZ4A 1CILA 4MTYA 2FNKA 4KP8A 2NNSA 3MHIA 1G4OA 3V7XA 4Z0QA 3M1WA 1UGFA 3DD0A 4R59A 4RN4A 4WUQA 4Q8ZA 4KV0A 1ZFKA 3S71B 5LMDA 3IEOA 4HT2A 2OSMA 4E49A 4ETQC 4KUWA 4WR7A 4Y0JA 1UGDA 1CNBA 3M04A 4MDLA 5FNHA 5EH5A 4RH2A 1CNIA 4FU5A 8CA2A 4HEWA 3T84A 3NI5A 1XPZA 1G45A 3D93A
chains in the Genus database with same CATH superfamily
3RZ5A 4ZX0A 4DZ9A 2POWA 1JV0A 4E5QA 5FNKA 2GEHA 1DMYA 3D8WA 1URTA 3M2NA 4ITPA 1FR7A 3RZ7A 3MHLA 3S78B 2IT4A 3M2YA 3U3AX 3BL1A 1OQ5A 1OKLA 1RJ5A 4R5BA 3V3IB 1RZBA 4PQ7A 5C8IA 2NNVA 2CBDA 4Q09A 3PYKA 5FNIA 5E2MA 1BNWA 1MOOA 5JGSB 5FL5A 5DSJA 4E4AA 2ILIA 5L6KA 4DZ7A 4Z1KA 2FOVA 4Q08A 1F2WA 4ZWZA 5DSKA 4G7AA 3IBIA 3NJ9A 2WD3A 3MHCA 4QSIA 3DCSA 3S72B 1CINA 3M2ZA 4XFWA 2QOAA 5FLQA 3R17B 5JG5B 1CNGA 3K2FA 1YDAA 3NB5A 4JS6A 1FQNA 5A25A 5DSMA 5EKHA 4YGFA 4Q7PA 1EOUA 1YDDA 5EIJA 3DV7A 1JCZA 1HEDA 1IF4A 2VVAX 3V2JA 3M67A 3MHMA 1ZSAA 2AX2A 3RYVB 3M2XA 4CNVA 1CNCA 1TEQX 4C3TA 1OKMA 4IWZA 1UGGA 4Q0LA 4QIYA 5EOIA 1CVHA 4ZWXA 3D92A 1RZEA 3P3HA 3DVDA 1I9NA 4L5WA 3M1JA 3MHOA 3OY0A 1BNTA 1FSQA 1ZNCA 1CNYA 4X5SA 5E5RA 5SZ6A 4E3FA 4YGLA 5E2NA 1G52A 2CBAA 5J8ZA 9CA2A 3B1BA 3S73B 4YXIA 1ZGFA 3S9TA 1G53A 3HLJA 5AMGA 1DCAA 1KOPA 4IDRX 3BL0A 4QJOA 4JSSA 1CAYA 3HKQA 2GD8A 1UGCA 2CA2A 2H15A 1RAZA 4E3GA 4FRCA 1CAMA 1CCTA 4K1QA 1G0FA 2FMGA 1CRAA 2POUA 5IPZA 4QIZA 4RFCA 3ML5A 3DBUA 1Z97A 3DC9A 3EFIA 1UGAA 1I9MA 1H4NA 1YO1A 5BNLA 4Q78A 4MO8A 5DOGA 1UGBA 2AW1A 3DCWA 2Q1BA 3M5EA 3RYXB 4G0CA 2WEGA 3CZVA 1CAZA 3MNJA 3IBUA 3F7BA 1G0EA 1CCSA 4Q7SA 4LU3A 2NWOA 4KNIA 4QY3A 3HKNA 3MNKA 2ABEA 1BNNA 1CNWA 1CVBA 1I9LA 2WD2A 1CVAA 3SBIA 3M5TA 3T5UA 3ZP9A 4RIVA 2F14A 3OKVA 5FLSA 5SZ1A 4ZWIA 3RGEA 3RYJB 4Q83A 5DSOA 2H4NA 2HOCA 4M2UA 3SAXA 4QEFA 1HEBA 3V3GB 12CAA 3DAZA 4N0XB 4YGNA 2NXTA 4TWLA 1FQRA 3OIKA 1LUGA 5EZTX 3HKTA 2CBEA 2WEOA 4L5UA 3UYQA 3P58A 1V9IC 4HU1A 5BYIA 1I9PA 5JG3B 4CA2A 4YGJA 1HEAA 2EZ7A 4RUYA 4Q06A 4QSJA 4QJ0A 3FFPX 1TBTX 3FW3A 1TE3X 3IBNA 3S74B 4BCWA 1IF9A 2NWPA 4WUPA 1FQLA 5A6HA 1CANA 1HVAA 1THKA 3OKUA 4QK1A 4KUVA 4Q8XA 1YO2A 4MDMA 3RZ8A 1G3ZA 1RAYA 1LGDA 4KNNA 5FNGA 2QO8A 1CRMA 4HT0A 1TB0X 1HCBA 4QJPA 2EU2A 1TH9A 3VBDA 2NXRA 3HFPA 1AVNA 3SBHA 5CACA 3TMJA 1IF7A 3M14A 5FLRA 4E9OX 3F7UA 1CALA 4RUXA 3KWAA 3P5AA 1FLJA 1I9OA 4Z1EA 1CNKA 1KEQA 2FNMA 3GZ0A 1CAJA 4QJMA 5G03A 1XEGA 5EKJA 1XQ0A 1I8ZA 2WEHA 3SAPA 2W2JA 5JEGB 5SZ5A 2X7UA 2Q38A 3DCCA 3S97A 2Q1QA 3JXHC 4QSAA 3MWOA 4CNRA 2HFWA 4WL4A 2NNOA 1BNQA 2HL4A 3F4XA 1RJ6A 3MNUA 1KWRA 2NNGA 2FNNA 5E2RA 1HCAA 1CA3A 5G0CA 4QTLA 5JESB 1T9NA 3M40A 5EHVA 3KLDB 3V2MA 2NMXA 2FW4A 3D9ZA 3DD8A 4Q99A 1MUAA 4Q9YA 5E28A 3JXFA 3S77B 5SZ0A 3OILA 4L5VA 4HF3A 5FLOA 1CAIA 3P3JA 1ZFQA 1Z93A 1BN1A 4MLXA 2HKKA 3DVCA 5BRVA 3UYNA 3T85A 3W6HA 4E3DA 4XIXA 1CNXA 1RZAA 3L14A 1BCDA 2HD6A 2NN1A 3DVBA 1KWQA 1BICA 1TTMA 1Y7WA 3HS4A 4Q81A 3OYSA 1HUGA 1BZMA 3K34A 1BNVA 5E5UA 3S76A 4XE1A 4PXXA 5FNMA 4YX4A 3C7PA 3R16A 1CA2A 1CCUA 2NXSA 4Q6DA 3ML2A 5EH8A 3MNIA 4YXUA 3DC3A 4YXOA 1I90A 5FLTA 4Q7VA 3LXEA 2X7SA 4FL7A 5DSQA 4MDGA 3S75B 1DMXA 1G46A 3MNAA 3N0NA 4CQ0A 5DRSA 4K0SA 1IF5A 3DA2A 1G54A 1AZMA 4K0TA 4XIWA 5SZ3A 4Q90A 1J9WA 1I91A 3P4VA 3B4FA 4FPTA 3OYQA 3M5SA 1G6VA 1ZH9A 4M2RA 3Q31A 4QSBA 3PJJA 1FQMA 1ZGEA 2POVA 3CAJA 3W6IA 5DOHA 3U7CA 1HECA 1CNJA 3KS3A 5EHWA 4KP5A 4PYYA 3RYYA 6CA2A 1OKNA 1BN4A 4Z1NA 5FL6A 5AMLA 4CNXA 4HBAA 3MMFA 4LP6A 5EHEA 3RYZA 1V9EA 5JEPB 4M2VA 1Z9YA 4M2WA 4FVOA 4MLTA 1G4JA 2OSFA 1TG9A 1YDCA 3RZ0B 1IF6A 5FDIA 1LG6A 4CNWA 5E2SA 2ZNCA 4COQA 3P44A 1TEUX 3RJ7A 1HUHA 1CVDA 3KOKA 3MZCA 4KAPA 4R5AA 1CVFA 3BETA 4Q07A 3T82A 1FSNA 2NWZA 4ZX1A 5BRWA 4K0ZA 3T5ZA 4UOVA 5JGTB 4WW6A 2CABA 3HKUA 4KNMA 4XZ5A 3CA2A 1CAOA 3M1KA 3FE4A 5L3OA 2FMZA 1H9NA 4Q87A 5DSRA 5SZ2A 4GL1X 4YHAA 1AM6A 3V3HB 4LHIA 3EFTA 4QJWA 4RUZA 1LZVA 3ZNCA 4E3HA 5FLPA 5G01A 4KNJA 1KOQA 4ITOA 5EKMA 3TVOX 3P55A 2FOSA 3T83A 3MDZA 5G0BA 4YVYA 4ZWYA 4FIKA 3V3FA 3OIMA 1CAHA 3TVNX 1H9QA 5JQ0A 5JDVB 5FDCA 4QK3A 4K13A 3KNEA 1CVCA 3JXGA 5DVXA 2FOUA 3N3JA 1CZMA 3P5LA 4JSZA 3V5GA 4CACA 3QYKA 3RG4A 1BNUA 4HEZA 1G48A 2FOYA 4TWMA 5CJFA 5DSPA 3KONA 4QJXA 4BF1A 5SZ7A 3S8XA 4PZHA 4Q7WA 1ZSCA 2QP6A 3RLDA 3IBLA 4WW8A 5DSLA 4Z1JA 1YDBA 4HEYA 1CNHA 1DCBA 1I9QA 2O4ZA 1A42A 3KKXA 1RZDA 3IAIA 1IF8A 3F8EA 5FL4A 3IGPA 1FSRA 1ZSBA 4RIUA 4YYTA 5BRUA 3K7KA 1TG3A 1ZE8A 3RZ1B 2CBBA 7CA2A 3N4BA 1XEVA 2VVBX 4YGKA 4KUYA 3V3JA 4JSAA 4RFDA 5HPJA 1YO0A 4Q8YA 3M98A 1BV3A 5FNJA 4Q6EA 3CYUA 1G1DA 2NN7A 3N2PA 5EH7A 3KOIA 4BF6A 3KIGA 3D0NA 1RZCA 5E2KA 4N16A 1BNMA 2WEJA 3M96A 5AMDA 4YWPA 2FOQA 3RG3A 4FVNA 5DSIA 3M1QA 5CLUA 4ZAOA 3MNHA 4JSWA 3U47A 2NWYA 1BN3A 2EU3A 5CA2A 5JEHB 1FR4A 5DSNA 1CIMA 5FNLA 2X7TA 2CBCA 4Q49A 1UGEA 1CVEA 2HNCA 1JD0A 3M3XA 1CAKA 4QK2A 3U45X 3PO6A 4PYXA 4ILXA 1LG5A 5JQTA 3MYQA 5SZ4A 1CILA 4MTYA 2FNKA 4KP8A 2NNSA 3MHIA 1G4OA 3V7XA 4Z0QA 3M1WA 1UGFA 3DD0A 4R59A 4RN4A 4WUQA 4Q8ZA 4KV0A 1ZFKA 3S71B 5LMDA 3IEOA 4HT2A 2OSMA 4E49A 4ETQC 4KUWA 4WR7A 4Y0JA 1UGDA 1CNBA 3M04A 4MDLA 5FNHA 5EH5A 4RH2A 1CNIA 4FU5A 8CA2A 4HEWA 3T84A 3NI5A 1XPZA 1G45A 3D93A
chains in the Genus database with same CATH topology
3RZ5A 4ZX0A 4DZ9A 2POWA 1JV0A 4E5QA 5FNKA 2GEHA 1DMYA 3D8WA 1URTA 3M2NA 4ITPA 1FR7A 3RZ7A 3MHLA 3S78B 2IT4A 3M2YA 3U3AX 3BL1A 1OQ5A 1OKLA 1RJ5A 4R5BA 3V3IB 1RZBA 4PQ7A 5C8IA 2NNVA 2CBDA 4Q09A 3PYKA 5FNIA 5E2MA 1BNWA 1MOOA 5JGSB 5FL5A 5DSJA 4E4AA 2ILIA 5L6KA 4DZ7A 4Z1KA 2FOVA 4Q08A 1F2WA 4ZWZA 5DSKA 4G7AA 3IBIA 3NJ9A 2WD3A 3MHCA 4QSIA 3DCSA 3S72B 1CINA 3M2ZA 4XFWA 2QOAA 5FLQA 3R17B 5JG5B 1CNGA 3K2FA 1YDAA 3NB5A 4JS6A 1FQNA 5A25A 5DSMA 5EKHA 4YGFA 4Q7PA 1EOUA 1YDDA 5EIJA 3DV7A 1JCZA 1HEDA 1IF4A 2VVAX 3V2JA 3M67A 3MHMA 1ZSAA 2AX2A 3RYVB 3M2XA 4CNVA 1CNCA 1TEQX 4C3TA 1OKMA 4IWZA 1UGGA 4Q0LA 4QIYA 5EOIA 1CVHA 4ZWXA 3D92A 1RZEA 3P3HA 3DVDA 1I9NA 4L5WA 3M1JA 3MHOA 3OY0A 1BNTA 1FSQA 1ZNCA 1CNYA 4X5SA 5E5RA 5SZ6A 4E3FA 4YGLA 5E2NA 1G52A 2CBAA 5J8ZA 9CA2A 3B1BA 3S73B 4YXIA 1ZGFA 3S9TA 1G53A 3HLJA 5AMGA 1DCAA 1KOPA 4IDRX 3BL0A 4QJOA 4JSSA 1CAYA 3HKQA 2GD8A 1UGCA 2CA2A 2H15A 1RAZA 4E3GA 4FRCA 1CAMA 1CCTA 4K1QA 1G0FA 2FMGA 1CRAA 2POUA 5IPZA 4QIZA 4RFCA 3ML5A 3DBUA 1Z97A 3DC9A 3EFIA 1UGAA 1I9MA 1H4NA 1YO1A 5BNLA 4Q78A 4MO8A 5DOGA 1UGBA 2AW1A 3DCWA 2Q1BA 3M5EA 3RYXB 4G0CA 2WEGA 3CZVA 1CAZA 3MNJA 3IBUA 3F7BA 1G0EA 1CCSA 4Q7SA 4LU3A 2NWOA 4KNIA 4QY3A 3HKNA 3MNKA 2ABEA 1BNNA 1CNWA 1CVBA 1I9LA 2WD2A 1CVAA 3SBIA 3M5TA 3T5UA 3ZP9A 4RIVA 2F14A 3OKVA 5FLSA 5SZ1A 4ZWIA 3RGEA 3RYJB 4Q83A 5DSOA 2H4NA 2HOCA 4M2UA 3SAXA 4QEFA 1HEBA 3V3GB 12CAA 3DAZA 4N0XB 4YGNA 2NXTA 4TWLA 1FQRA 3OIKA 1LUGA 5EZTX 3HKTA 2CBEA 2WEOA 4L5UA 3UYQA 3P58A 1V9IC 4HU1A 5BYIA 1I9PA 5JG3B 4CA2A 4YGJA 1HEAA 2EZ7A 4RUYA 4Q06A 4QSJA 4QJ0A 3FFPX 1TBTX 3FW3A 1TE3X 3IBNA 3S74B 4BCWA 1IF9A 2NWPA 4WUPA 1FQLA 5A6HA 1CANA 1HVAA 1THKA 3OKUA 4QK1A 4KUVA 4Q8XA 1YO2A 4MDMA 3RZ8A 1G3ZA 1RAYA 1LGDA 4KNNA 5FNGA 2QO8A 1CRMA 4HT0A 1TB0X 1HCBA 4QJPA 2EU2A 1TH9A 3VBDA 2NXRA 3HFPA 1AVNA 3SBHA 5CACA 3TMJA 1IF7A 3M14A 5FLRA 4E9OX 3F7UA 1CALA 4RUXA 3KWAA 3P5AA 1FLJA 1I9OA 4Z1EA 1CNKA 1KEQA 2FNMA 3GZ0A 1CAJA 4QJMA 5G03A 1XEGA 5EKJA 1XQ0A 1I8ZA 2WEHA 3SAPA 2W2JA 5JEGB 5SZ5A 2X7UA 2Q38A 3DCCA 3S97A 2Q1QA 3JXHC 4QSAA 3MWOA 4CNRA 2HFWA 4WL4A 2NNOA 1BNQA 2HL4A 3F4XA 1RJ6A 3MNUA 1KWRA 2NNGA 2FNNA 5E2RA 1HCAA 1CA3A 5G0CA 4QTLA 5JESB 1T9NA 3M40A 5EHVA 3KLDB 3V2MA 2NMXA 2FW4A 3D9ZA 3DD8A 4Q99A 1MUAA 4Q9YA 5E28A 3JXFA 3S77B 5SZ0A 3OILA 4L5VA 4HF3A 5FLOA 1CAIA 3P3JA 1ZFQA 1Z93A 1BN1A 4MLXA 2HKKA 3DVCA 5BRVA 3UYNA 3T85A 3W6HA 4E3DA 4XIXA 1CNXA 1RZAA 3L14A 1BCDA 2HD6A 2NN1A 3DVBA 1KWQA 1BICA 1TTMA 1Y7WA 3HS4A 4Q81A 3OYSA 1HUGA 1BZMA 3K34A 1BNVA 5E5UA 3S76A 4XE1A 4PXXA 5FNMA 4YX4A 3C7PA 3R16A 1CA2A 1CCUA 2NXSA 4Q6DA 3ML2A 5EH8A 3MNIA 4YXUA 3DC3A 4YXOA 1I90A 5FLTA 4Q7VA 3LXEA 2X7SA 4FL7A 5DSQA 4MDGA 3S75B 1DMXA 1G46A 3MNAA 3N0NA 4CQ0A 5DRSA 4K0SA 1IF5A 3DA2A 1G54A 1AZMA 4K0TA 4XIWA 5SZ3A 4Q90A 1J9WA 1I91A 3P4VA 3B4FA 4FPTA 3OYQA 3M5SA 1G6VA 1ZH9A 4M2RA 3Q31A 4QSBA 3PJJA 1FQMA 1ZGEA 2POVA 3CAJA 3W6IA 5DOHA 3U7CA 1HECA 1CNJA 3KS3A 5EHWA 4KP5A 4PYYA 3RYYA 6CA2A 1OKNA 1BN4A 4Z1NA 5FL6A 5AMLA 4CNXA 4HBAA 3MMFA 4LP6A 5EHEA 3RYZA 1V9EA 5JEPB 4M2VA 1Z9YA 4M2WA 4FVOA 4MLTA 1G4JA 2OSFA 1TG9A 1YDCA 3RZ0B 1IF6A 5FDIA 1LG6A 4CNWA 5E2SA 2ZNCA 4COQA 3P44A 1TEUX 3RJ7A 1HUHA 1CVDA 3KOKA 3MZCA 4KAPA 4R5AA 1CVFA 3BETA 4Q07A 3T82A 1FSNA 2NWZA 4ZX1A 5BRWA 4K0ZA 3T5ZA 4UOVA 5JGTB 4WW6A 2CABA 3HKUA 4KNMA 4XZ5A 3CA2A 1CAOA 3M1KA 3FE4A 5L3OA 2FMZA 1H9NA 4Q87A 5DSRA 5SZ2A 4GL1X 4YHAA 1AM6A 3V3HB 4LHIA 3EFTA 4QJWA 4RUZA 1LZVA 3ZNCA 4E3HA 5FLPA 5G01A 4KNJA 1KOQA 4ITOA 5EKMA 3TVOX 3P55A 2FOSA 3T83A 3MDZA 5G0BA 4YVYA 4ZWYA 4FIKA 3V3FA 3OIMA 1CAHA 3TVNX 1H9QA 5JQ0A 5JDVB 5FDCA 4QK3A 4K13A 3KNEA 1CVCA 3JXGA 5DVXA 2FOUA 3N3JA 1CZMA 3P5LA 4JSZA 3V5GA 4CACA 3QYKA 3RG4A 1BNUA 4HEZA 1G48A 2FOYA 4TWMA 5CJFA 5DSPA 3KONA 4QJXA 4BF1A 5SZ7A 3S8XA 4PZHA 4Q7WA 1ZSCA 2QP6A 3RLDA 3IBLA 4WW8A 5DSLA 4Z1JA 1YDBA 4HEYA 1CNHA 1DCBA 1I9QA 2O4ZA 1A42A 3KKXA 1RZDA 3IAIA 1IF8A 3F8EA 5FL4A 3IGPA 1FSRA 1ZSBA 4RIUA 4YYTA 5BRUA 3K7KA 1TG3A 1ZE8A 3RZ1B 2CBBA 7CA2A 3N4BA 1XEVA 2VVBX 4YGKA 4KUYA 3V3JA 4JSAA 4RFDA 5HPJA 1YO0A 4Q8YA 3M98A 1BV3A 5FNJA 4Q6EA 3CYUA 1G1DA 2NN7A 3N2PA 5EH7A 3KOIA 4BF6A 3KIGA 3D0NA 1RZCA 5E2KA 4N16A 1BNMA 2WEJA 3M96A 5AMDA 4YWPA 2FOQA 3RG3A 4FVNA 5DSIA 3M1QA 5CLUA 4ZAOA 3MNHA 4JSWA 3U47A 2NWYA 1BN3A 2EU3A 5CA2A 5JEHB 1FR4A 5DSNA 1CIMA 5FNLA 2X7TA 2CBCA 4Q49A 1UGEA 1CVEA 2HNCA 1JD0A 3M3XA 1CAKA 4QK2A 3U45X 3PO6A 4PYXA 4ILXA 1LG5A 5JQTA 3MYQA 5SZ4A 1CILA 4MTYA 2FNKA 4KP8A 2NNSA 3MHIA 1G4OA 3V7XA 4Z0QA 3M1WA 1UGFA 3DD0A 4R59A 4RN4A 4WUQA 4Q8ZA 4KV0A 1ZFKA 3S71B 5LMDA 3IEOA 4HT2A 2OSMA 4E49A 4ETQC 4KUWA 4WR7A 4Y0JA 1UGDA 1CNBA 3M04A 4MDLA 5FNHA 5EH5A 4RH2A 1CNIA 4FU5A 8CA2A 4HEWA 3T84A 3NI5A 1XPZA 1G45A 3D93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZ5 A;  4ZX0 A;  4DZ9 A;  2POW A;  1JV0 A;  4E5Q A;  5FNK A;  2GEH A;  1DMY A;  3D8W A;  1URT A;  3M2N A;  4ITP A;  1FR7 A;  3RZ7 A;  3MHL A;  3S78 B;  2IT4 A;  3M2Y A;  3U3A X;  3BL1 A;  1OQ5 A;  1OKL A;  1RJ5 A;  4R5B A;  3V3I B;  1RZB A;  4PQ7 A;  5C8I A;  2NNV A;  2CBD A;  4Q09 A;  3PYK A;  5FNI A;  5E2M A;  1BNW A;  1MOO A;  5JGS B;  5FL5 A;  5DSJ A;  4E4A A;  2ILI A;  5L6K A;  4DZ7 A;  4Z1K A;  2FOV A;  4Q08 A;  1F2W A;  4ZWZ A;  5DSK A;  4G7A A;  3IBI A;  3NJ9 A;  2WD3 A;  3MHC A;  4QSI A;  3DCS A;  3S72 B;  1CIN A;  3M2Z A;  4XFW A;  2QOA A;  5FLQ A;  3R17 B;  5JG5 B;  1CNG A;  3K2F A;  1YDA A;  3NB5 A;  4JS6 A;  1FQN A;  5A25 A;  5DSM A;  5EKH A;  4YGF A;  4Q7P A;  1EOU A;  1YDD A;  5EIJ A;  3DV7 A;  1JCZ A;  1HED A;  1IF4 A;  2VVA X;  3V2J A;  3M67 A;  3MHM A;  1ZSA A;  2AX2 A;  3RYV B;  3M2X A;  4CNV A;  1CNC A;  1TEQ X;  4C3T A;  1OKM A;  4IWZ A;  1UGG A;  4Q0L A;  4QIY A;  5EOI A;  1CVH A;  4ZWX A;  3D92 A;  1RZE A;  3P3H A;  3DVD A;  1I9N A;  4L5W A;  3M1J A;  3MHO A;  3OY0 A;  1BNT A;  1FSQ A;  1ZNC A;  1CNY A;  4X5S A;  5E5R A;  5SZ6 A;  4E3F A;  4YGL A;  5E2N A;  1G52 A;  2CBA A;  5J8Z A;  9CA2 A;  3B1B A;  3S73 B;  4YXI A;  1ZGF A;  3S9T A;  1G53 A;  3HLJ A;  5AMG A;  1DCA A;  1KOP A;  4IDR X;  3BL0 A;  4QJO A;  4JSS A;  1CAY A;  3HKQ A;  2GD8 A;  1UGC A;  2CA2 A;  2H15 A;  1RAZ A;  4E3G A;  4FRC A;  1CAM A;  1CCT A;  4K1Q A;  1G0F A;  2FMG A;  1CRA A;  2POU A;  5IPZ A;  4QIZ A;  4RFC A;  3ML5 A;  3DBU A;  1Z97 A;  3DC9 A;  3EFI A;  1UGA A;  1I9M A;  1H4N A;  1YO1 A;  5BNL A;  4Q78 A;  4MO8 A;  5DOG A;  1UGB A;  2AW1 A;  3DCW A;  2Q1B A;  3M5E A;  3RYX B;  4G0C A;  2WEG A;  3CZV A;  1CAZ A;  3MNJ A;  3IBU A;  3F7B A;  1G0E A;  1CCS A;  4Q7S A;  4LU3 A;  2NWO A;  4KNI A;  4QY3 A;  3HKN A;  3MNK A;  2ABE A;  1BNN A;  1CNW A;  1CVB A;  1I9L A;  2WD2 A;  1CVA A;  3SBI A;  3M5T A;  3T5U A;  3ZP9 A;  4RIV A;  2F14 A;  3OKV A;  5FLS A;  5SZ1 A;  4ZWI A;  3RGE A;  3RYJ B;  4Q83 A;  5DSO A;  2H4N A;  2HOC A;  4M2U A;  3SAX A;  4QEF A;  1HEB A;  3V3G B;  12CA A;  3DAZ A;  4N0X B;  4YGN A;  2NXT A;  4TWL A;  1FQR A;  3OIK A;  1LUG A;  5EZT X;  3HKT A;  2CBE A;  2WEO A;  4L5U A;  3UYQ A;  3P58 A;  1V9I C;  4HU1 A;  5BYI A;  1I9P A;  5JG3 B;  4CA2 A;  4YGJ A;  1HEA A;  2EZ7 A;  4RUY A;  4Q06 A;  4QSJ A;  4QJ0 A;  3FFP X;  1TBT X;  3FW3 A;  1TE3 X;  3IBN A;  3S74 B;  4BCW A;  1IF9 A;  2NWP A;  4WUP A;  1FQL A;  5A6H A;  1CAN A;  1HVA A;  1THK A;  3OKU A;  4QK1 A;  4KUV A;  4Q8X A;  1YO2 A;  4MDM A;  3RZ8 A;  1G3Z A;  1RAY A;  1LGD A;  4KNN A;  5FNG A;  2QO8 A;  1CRM A;  4HT0 A;  1TB0 X;  1HCB A;  4QJP A;  2EU2 A;  1TH9 A;  3VBD A;  2NXR A;  3HFP A;  1AVN A;  3SBH A;  5CAC A;  3TMJ A;  1IF7 A;  3M14 A;  5FLR A;  4E9O X;  3F7U A;  1CAL A;  4RUX A;  3KWA A;  3P5A A;  1FLJ A;  1I9O A;  4Z1E A;  1CNK A;  1KEQ A;  2FNM A;  3GZ0 A;  1CAJ A;  4QJM A;  5G03 A;  1XEG A;  5EKJ A;  1XQ0 A;  1I8Z A;  2WEH A;  3SAP A;  2W2J A;  5JEG B;  5SZ5 A;  2X7U A;  2Q38 A;  3DCC A;  3S97 A;  2Q1Q A;  3JXH C;  4QSA A;  3MWO A;  4CNR A;  2HFW A;  4WL4 A;  2NNO A;  1BNQ A;  2HL4 A;  3F4X A;  1RJ6 A;  3MNU A;  1KWR A;  2NNG A;  2FNN A;  5E2R A;  1HCA A;  1CA3 A;  5G0C A;  4QTL A;  5JES B;  1T9N A;  3M40 A;  5EHV A;  3KLD B;  3V2M A;  2NMX A;  2FW4 A;  3D9Z A;  3DD8 A;  4Q99 A;  1MUA A;  4Q9Y A;  5E28 A;  3JXF A;  3S77 B;  5SZ0 A;  3OIL A;  4L5V A;  4HF3 A;  5FLO A;  1CAI A;  3P3J A;  1ZFQ A;  1Z93 A;  1BN1 A;  4MLX A;  2HKK A;  3DVC A;  5BRV A;  3UYN A;  3T85 A;  3W6H A;  4E3D A;  4XIX A;  1CNX A;  1RZA A;  3L14 A;  1BCD A;  2HD6 A;  2NN1 A;  3DVB A;  1KWQ A;  1BIC A;  1TTM A;  1Y7W A;  3HS4 A;  4Q81 A;  3OYS A;  1HUG A;  1BZM A;  3K34 A;  1BNV A;  5E5U A;  3S76 A;  4XE1 A;  4PXX A;  5FNM A;  4YX4 A;  3C7P A;  3R16 A;  1CA2 A;  1CCU A;  2NXS A;  4Q6D A;  3ML2 A;  5EH8 A;  3MNI A;  4YXU A;  3DC3 A;  4YXO A;  1I90 A;  5FLT A;  4Q7V A;  3LXE A;  2X7S A;  4FL7 A;  5DSQ A;  4MDG A;  3S75 B;  1DMX A;  1G46 A;  3MNA A;  3N0N A;  4CQ0 A;  5DRS A;  4K0S A;  1IF5 A;  3DA2 A;  1G54 A;  1AZM A;  4K0T A;  4XIW A;  5SZ3 A;  4Q90 A;  1J9W A;  1I91 A;  3P4V A;  3B4F A;  4FPT A;  3OYQ A;  3M5S A;  1G6V A;  1ZH9 A;  4M2R A;  3Q31 A;  4QSB A;  3PJJ A;  1FQM A;  1ZGE A;  2POV A;  3CAJ A;  3W6I A;  5DOH A;  3U7C A;  1HEC A;  1CNJ A;  3KS3 A;  5EHW A;  4KP5 A;  4PYY A;  3RYY A;  6CA2 A;  1OKN A;  1BN4 A;  4Z1N A;  5FL6 A;  5AML A;  4CNX A;  4HBA A;  3MMF A;  4LP6 A;  5EHE A;  3RYZ A;  1V9E A;  5JEP B;  4M2V A;  1Z9Y A;  4M2W A;  4FVO A;  4MLT A;  1G4J A;  2OSF A;  1TG9 A;  1YDC A;  3RZ0 B;  1IF6 A;  5FDI A;  1LG6 A;  4CNW A;  5E2S A;  2ZNC A;  4COQ A;  3P44 A;  1TEU X;  3RJ7 A;  1HUH A;  1CVD A;  3KOK A;  3MZC A;  4KAP A;  4R5A A;  1CVF A;  3BET A;  4Q07 A;  3T82 A;  1FSN A;  2NWZ A;  4ZX1 A;  5BRW A;  4K0Z A;  3T5Z A;  4UOV A;  5JGT B;  4WW6 A;  2CAB A;  3HKU A;  4KNM A;  4XZ5 A;  3CA2 A;  1CAO A;  3M1K A;  3FE4 A;  5L3O A;  2FMZ A;  1H9N A;  4Q87 A;  5DSR A;  5SZ2 A;  4GL1 X;  4YHA A;  1AM6 A;  3V3H B;  4LHI A;  3EFT A;  4QJW A;  4RUZ A;  1LZV A;  3ZNC A;  4E3H A;  5FLP A;  5G01 A;  4KNJ A;  1KOQ A;  4ITO A;  5EKM A;  3TVO X;  3P55 A;  2FOS A;  3T83 A;  3MDZ A;  5G0B A;  4YVY A;  4ZWY A;  4FIK A;  3V3F A;  3OIM A;  1CAH A;  3TVN X;  1H9Q A;  5JQ0 A;  5JDV B;  5FDC A;  4QK3 A;  4K13 A;  3KNE A;  1CVC A;  3JXG A;  5DVX A;  2FOU A;  3N3J A;  1CZM A;  3P5L A;  4JSZ A;  3V5G A;  4CAC A;  3QYK A;  3RG4 A;  1BNU A;  4HEZ A;  1G48 A;  2FOY A;  4TWM A;  5CJF A;  5DSP A;  3KON A;  4QJX A;  4BF1 A;  5SZ7 A;  3S8X A;  4PZH A;  4Q7W A;  1ZSC A;  2QP6 A;  3RLD A;  3IBL A;  4WW8 A;  5DSL A;  4Z1J A;  1YDB A;  4HEY A;  1CNH A;  1DCB A;  1I9Q A;  2O4Z A;  1A42 A;  3KKX A;  1RZD A;  3IAI A;  1IF8 A;  3F8E A;  5FL4 A;  3IGP A;  1FSR A;  1ZSB A;  4RIU A;  4YYT A;  5BRU A;  3K7K A;  1TG3 A;  1ZE8 A;  3RZ1 B;  2CBB A;  7CA2 A;  3N4B A;  1XEV A;  2VVB X;  4YGK A;  4KUY A;  3V3J A;  4JSA A;  4RFD A;  5HPJ A;  1YO0 A;  4Q8Y A;  3M98 A;  1BV3 A;  5FNJ A;  4Q6E A;  3CYU A;  1G1D A;  2NN7 A;  3N2P A;  5EH7 A;  3KOI A;  4BF6 A;  3KIG A;  3D0N A;  1RZC A;  5E2K A;  4N16 A;  1BNM A;  2WEJ A;  3M96 A;  5AMD A;  4YWP A;  2FOQ A;  3RG3 A;  4FVN A;  5DSI A;  3M1Q A;  5CLU A;  4ZAO A;  3MNH A;  4JSW A;  3U47 A;  2NWY A;  1BN3 A;  2EU3 A;  5CA2 A;  5JEH B;  1FR4 A;  5DSN A;  1CIM A;  5FNL A;  2X7T A;  2CBC A;  4Q49 A;  1UGE A;  1CVE A;  2HNC A;  1JD0 A;  3M3X A;  1CAK A;  4QK2 A;  3U45 X;  3PO6 A;  4PYX A;  4ILX A;  1LG5 A;  5JQT A;  3MYQ A;  5SZ4 A;  1CIL A;  4MTY A;  2FNK A;  4KP8 A;  2NNS A;  3MHI A;  1G4O A;  3V7X A;  4Z0Q A;  3M1W A;  1UGF A;  3DD0 A;  4R59 A;  4RN4 A;  4WUQ A;  4Q8Z A;  4KV0 A;  1ZFK A;  3S71 B;  5LMD A;  3IEO A;  4HT2 A;  2OSM A;  4E49 A;  4ETQ C;  4KUW A;  4WR7 A;  4Y0J A;  1UGD A;  1CNB A;  3M04 A;  4MDL A;  5FNH A;  5EH5 A;  4RH2 A;  1CNI A;  4FU5 A;  8CA2 A;  4HEW A;  3T84 A;  3NI5 A;  1XPZ A;  1G45 A;  3D93 A; 
#chains in the Genus database with same CATH topology
 3RZ5 A;  4ZX0 A;  4DZ9 A;  2POW A;  1JV0 A;  4E5Q A;  5FNK A;  2GEH A;  1DMY A;  3D8W A;  1URT A;  3M2N A;  4ITP A;  1FR7 A;  3RZ7 A;  3MHL A;  3S78 B;  2IT4 A;  3M2Y A;  3U3A X;  3BL1 A;  1OQ5 A;  1OKL A;  1RJ5 A;  4R5B A;  3V3I B;  1RZB A;  4PQ7 A;  5C8I A;  2NNV A;  2CBD A;  4Q09 A;  3PYK A;  5FNI A;  5E2M A;  1BNW A;  1MOO A;  5JGS B;  5FL5 A;  5DSJ A;  4E4A A;  2ILI A;  5L6K A;  4DZ7 A;  4Z1K A;  2FOV A;  4Q08 A;  1F2W A;  4ZWZ A;  5DSK A;  4G7A A;  3IBI A;  3NJ9 A;  2WD3 A;  3MHC A;  4QSI A;  3DCS A;  3S72 B;  1CIN A;  3M2Z A;  4XFW A;  2QOA A;  5FLQ A;  3R17 B;  5JG5 B;  1CNG A;  3K2F A;  1YDA A;  3NB5 A;  4JS6 A;  1FQN A;  5A25 A;  5DSM A;  5EKH A;  4YGF A;  4Q7P A;  1EOU A;  1YDD A;  5EIJ A;  3DV7 A;  1JCZ A;  1HED A;  1IF4 A;  2VVA X;  3V2J A;  3M67 A;  3MHM A;  1ZSA A;  2AX2 A;  3RYV B;  3M2X A;  4CNV A;  1CNC A;  1TEQ X;  4C3T A;  1OKM A;  4IWZ A;  1UGG A;  4Q0L A;  4QIY A;  5EOI A;  1CVH A;  4ZWX A;  3D92 A;  1RZE A;  3P3H A;  3DVD A;  1I9N A;  4L5W A;  3M1J A;  3MHO A;  3OY0 A;  1BNT A;  1FSQ A;  1ZNC A;  1CNY A;  4X5S A;  5E5R A;  5SZ6 A;  4E3F A;  4YGL A;  5E2N A;  1G52 A;  2CBA A;  5J8Z A;  9CA2 A;  3B1B A;  3S73 B;  4YXI A;  1ZGF A;  3S9T A;  1G53 A;  3HLJ A;  5AMG A;  1DCA A;  1KOP A;  4IDR X;  3BL0 A;  4QJO A;  4JSS A;  1CAY A;  3HKQ A;  2GD8 A;  1UGC A;  2CA2 A;  2H15 A;  1RAZ A;  4E3G A;  4FRC A;  1CAM A;  1CCT A;  4K1Q A;  1G0F A;  2FMG A;  1CRA A;  2POU A;  5IPZ A;  4QIZ A;  4RFC A;  3ML5 A;  3DBU A;  1Z97 A;  3DC9 A;  3EFI A;  1UGA A;  1I9M A;  1H4N A;  1YO1 A;  5BNL A;  4Q78 A;  4MO8 A;  5DOG A;  1UGB A;  2AW1 A;  3DCW A;  2Q1B A;  3M5E A;  3RYX B;  4G0C A;  2WEG A;  3CZV A;  1CAZ A;  3MNJ A;  3IBU A;  3F7B A;  1G0E A;  1CCS A;  4Q7S A;  4LU3 A;  2NWO A;  4KNI A;  4QY3 A;  3HKN A;  3MNK A;  2ABE A;  1BNN A;  1CNW A;  1CVB A;  1I9L A;  2WD2 A;  1CVA A;  3SBI A;  3M5T A;  3T5U A;  3ZP9 A;  4RIV A;  2F14 A;  3OKV A;  5FLS A;  5SZ1 A;  4ZWI A;  3RGE A;  3RYJ B;  4Q83 A;  5DSO A;  2H4N A;  2HOC A;  4M2U A;  3SAX A;  4QEF A;  1HEB A;  3V3G B;  12CA A;  3DAZ A;  4N0X B;  4YGN A;  2NXT A;  4TWL A;  1FQR A;  3OIK A;  1LUG A;  5EZT X;  3HKT A;  2CBE A;  2WEO A;  4L5U A;  3UYQ A;  3P58 A;  1V9I C;  4HU1 A;  5BYI A;  1I9P A;  5JG3 B;  4CA2 A;  4YGJ A;  1HEA A;  2EZ7 A;  4RUY A;  4Q06 A;  4QSJ A;  4QJ0 A;  3FFP X;  1TBT X;  3FW3 A;  1TE3 X;  3IBN A;  3S74 B;  4BCW A;  1IF9 A;  2NWP A;  4WUP A;  1FQL A;  5A6H A;  1CAN A;  1HVA A;  1THK A;  3OKU A;  4QK1 A;  4KUV A;  4Q8X A;  1YO2 A;  4MDM A;  3RZ8 A;  1G3Z A;  1RAY A;  1LGD A;  4KNN A;  5FNG A;  2QO8 A;  1CRM A;  4HT0 A;  1TB0 X;  1HCB A;  4QJP A;  2EU2 A;  1TH9 A;  3VBD A;  2NXR A;  3HFP A;  1AVN A;  3SBH A;  5CAC A;  3TMJ A;  1IF7 A;  3M14 A;  5FLR A;  4E9O X;  3F7U A;  1CAL A;  4RUX A;  3KWA A;  3P5A A;  1FLJ A;  1I9O A;  4Z1E A;  1CNK A;  1KEQ A;  2FNM A;  3GZ0 A;  1CAJ A;  4QJM A;  5G03 A;  1XEG A;  5EKJ A;  1XQ0 A;  1I8Z A;  2WEH A;  3SAP A;  2W2J A;  5JEG B;  5SZ5 A;  2X7U A;  2Q38 A;  3DCC A;  3S97 A;  2Q1Q A;  3JXH C;  4QSA A;  3MWO A;  4CNR A;  2HFW A;  4WL4 A;  2NNO A;  1BNQ A;  2HL4 A;  3F4X A;  1RJ6 A;  3MNU A;  1KWR A;  2NNG A;  2FNN A;  5E2R A;  1HCA A;  1CA3 A;  5G0C A;  4QTL A;  5JES B;  1T9N A;  3M40 A;  5EHV A;  3KLD B;  3V2M A;  2NMX A;  2FW4 A;  3D9Z A;  3DD8 A;  4Q99 A;  1MUA A;  4Q9Y A;  5E28 A;  3JXF A;  3S77 B;  5SZ0 A;  3OIL A;  4L5V A;  4HF3 A;  5FLO A;  1CAI A;  3P3J A;  1ZFQ A;  1Z93 A;  1BN1 A;  4MLX A;  2HKK A;  3DVC A;  5BRV A;  3UYN A;  3T85 A;  3W6H A;  4E3D A;  4XIX A;  1CNX A;  1RZA A;  3L14 A;  1BCD A;  2HD6 A;  2NN1 A;  3DVB A;  1KWQ A;  1BIC A;  1TTM A;  1Y7W A;  3HS4 A;  4Q81 A;  3OYS A;  1HUG A;  1BZM A;  3K34 A;  1BNV A;  5E5U A;  3S76 A;  4XE1 A;  4PXX A;  5FNM A;  4YX4 A;  3C7P A;  3R16 A;  1CA2 A;  1CCU A;  2NXS A;  4Q6D A;  3ML2 A;  5EH8 A;  3MNI A;  4YXU A;  3DC3 A;  4YXO A;  1I90 A;  5FLT A;  4Q7V A;  3LXE A;  2X7S A;  4FL7 A;  5DSQ A;  4MDG A;  3S75 B;  1DMX A;  1G46 A;  3MNA A;  3N0N A;  4CQ0 A;  5DRS A;  4K0S A;  1IF5 A;  3DA2 A;  1G54 A;  1AZM A;  4K0T A;  4XIW A;  5SZ3 A;  4Q90 A;  1J9W A;  1I91 A;  3P4V A;  3B4F A;  4FPT A;  3OYQ A;  3M5S A;  1G6V A;  1ZH9 A;  4M2R A;  3Q31 A;  4QSB A;  3PJJ A;  1FQM A;  1ZGE A;  2POV A;  3CAJ A;  3W6I A;  5DOH A;  3U7C A;  1HEC A;  1CNJ A;  3KS3 A;  5EHW A;  4KP5 A;  4PYY A;  3RYY A;  6CA2 A;  1OKN A;  1BN4 A;  4Z1N A;  5FL6 A;  5AML A;  4CNX A;  4HBA A;  3MMF A;  4LP6 A;  5EHE A;  3RYZ A;  1V9E A;  5JEP B;  4M2V A;  1Z9Y A;  4M2W A;  4FVO A;  4MLT A;  1G4J A;  2OSF A;  1TG9 A;  1YDC A;  3RZ0 B;  1IF6 A;  5FDI A;  1LG6 A;  4CNW A;  5E2S A;  2ZNC A;  4COQ A;  3P44 A;  1TEU X;  3RJ7 A;  1HUH A;  1CVD A;  3KOK A;  3MZC A;  4KAP A;  4R5A A;  1CVF A;  3BET A;  4Q07 A;  3T82 A;  1FSN A;  2NWZ A;  4ZX1 A;  5BRW A;  4K0Z A;  3T5Z A;  4UOV A;  5JGT B;  4WW6 A;  2CAB A;  3HKU A;  4KNM A;  4XZ5 A;  3CA2 A;  1CAO A;  3M1K A;  3FE4 A;  5L3O A;  2FMZ A;  1H9N A;  4Q87 A;  5DSR A;  5SZ2 A;  4GL1 X;  4YHA A;  1AM6 A;  3V3H B;  4LHI A;  3EFT A;  4QJW A;  4RUZ A;  1LZV A;  3ZNC A;  4E3H A;  5FLP A;  5G01 A;  4KNJ A;  1KOQ A;  4ITO A;  5EKM A;  3TVO X;  3P55 A;  2FOS A;  3T83 A;  3MDZ A;  5G0B A;  4YVY A;  4ZWY A;  4FIK A;  3V3F A;  3OIM A;  1CAH A;  3TVN X;  1H9Q A;  5JQ0 A;  5JDV B;  5FDC A;  4QK3 A;  4K13 A;  3KNE A;  1CVC A;  3JXG A;  5DVX A;  2FOU A;  3N3J A;  1CZM A;  3P5L A;  4JSZ A;  3V5G A;  4CAC A;  3QYK A;  3RG4 A;  1BNU A;  4HEZ A;  1G48 A;  2FOY A;  4TWM A;  5CJF A;  5DSP A;  3KON A;  4QJX A;  4BF1 A;  5SZ7 A;  3S8X A;  4PZH A;  4Q7W A;  1ZSC A;  2QP6 A;  3RLD A;  3IBL A;  4WW8 A;  5DSL A;  4Z1J A;  1YDB A;  4HEY A;  1CNH A;  1DCB A;  1I9Q A;  2O4Z A;  1A42 A;  3KKX A;  1RZD A;  3IAI A;  1IF8 A;  3F8E A;  5FL4 A;  3IGP A;  1FSR A;  1ZSB A;  4RIU A;  4YYT A;  5BRU A;  3K7K A;  1TG3 A;  1ZE8 A;  3RZ1 B;  2CBB A;  7CA2 A;  3N4B A;  1XEV A;  2VVB X;  4YGK A;  4KUY A;  3V3J A;  4JSA A;  4RFD A;  5HPJ A;  1YO0 A;  4Q8Y A;  3M98 A;  1BV3 A;  5FNJ A;  4Q6E A;  3CYU A;  1G1D A;  2NN7 A;  3N2P A;  5EH7 A;  3KOI A;  4BF6 A;  3KIG A;  3D0N A;  1RZC A;  5E2K A;  4N16 A;  1BNM A;  2WEJ A;  3M96 A;  5AMD A;  4YWP A;  2FOQ A;  3RG3 A;  4FVN A;  5DSI A;  3M1Q A;  5CLU A;  4ZAO A;  3MNH A;  4JSW A;  3U47 A;  2NWY A;  1BN3 A;  2EU3 A;  5CA2 A;  5JEH B;  1FR4 A;  5DSN A;  1CIM A;  5FNL A;  2X7T A;  2CBC A;  4Q49 A;  1UGE A;  1CVE A;  2HNC A;  1JD0 A;  3M3X A;  1CAK A;  4QK2 A;  3U45 X;  3PO6 A;  4PYX A;  4ILX A;  1LG5 A;  5JQT A;  3MYQ A;  5SZ4 A;  1CIL A;  4MTY A;  2FNK A;  4KP8 A;  2NNS A;  3MHI A;  1G4O A;  3V7X A;  4Z0Q A;  3M1W A;  1UGF A;  3DD0 A;  4R59 A;  4RN4 A;  4WUQ A;  4Q8Z A;  4KV0 A;  1ZFK A;  3S71 B;  5LMD A;  3IEO A;  4HT2 A;  2OSM A;  4E49 A;  4ETQ C;  4KUW A;  4WR7 A;  4Y0J A;  1UGD A;  1CNB A;  3M04 A;  4MDL A;  5FNH A;  5EH5 A;  4RH2 A;  1CNI A;  4FU5 A;  8CA2 A;  4HEW A;  3T84 A;  3NI5 A;  1XPZ A;  1G45 A;  3D93 A; 
#chains in the Genus database with same CATH homology
 3RZ5 A;  4ZX0 A;  4DZ9 A;  2POW A;  1JV0 A;  4E5Q A;  5FNK A;  2GEH A;  1DMY A;  3D8W A;  1URT A;  3M2N A;  4ITP A;  1FR7 A;  3RZ7 A;  3MHL A;  3S78 B;  2IT4 A;  3M2Y A;  3U3A X;  3BL1 A;  1OQ5 A;  1OKL A;  1RJ5 A;  4R5B A;  3V3I B;  1RZB A;  4PQ7 A;  5C8I A;  2NNV A;  2CBD A;  4Q09 A;  3PYK A;  5FNI A;  5E2M A;  1BNW A;  1MOO A;  5JGS B;  5FL5 A;  5DSJ A;  4E4A A;  2ILI A;  5L6K A;  4DZ7 A;  4Z1K A;  2FOV A;  4Q08 A;  1F2W A;  4ZWZ A;  5DSK A;  4G7A A;  3IBI A;  3NJ9 A;  2WD3 A;  3MHC A;  4QSI A;  3DCS A;  3S72 B;  1CIN A;  3M2Z A;  4XFW A;  2QOA A;  5FLQ A;  3R17 B;  5JG5 B;  1CNG A;  3K2F A;  1YDA A;  3NB5 A;  4JS6 A;  1FQN A;  5A25 A;  5DSM A;  5EKH A;  4YGF A;  4Q7P A;  1EOU A;  1YDD A;  5EIJ A;  3DV7 A;  1JCZ A;  1HED A;  1IF4 A;  2VVA X;  3V2J A;  3M67 A;  3MHM A;  1ZSA A;  2AX2 A;  3RYV B;  3M2X A;  4CNV A;  1CNC A;  1TEQ X;  4C3T A;  1OKM A;  4IWZ A;  1UGG A;  4Q0L A;  4QIY A;  5EOI A;  1CVH A;  4ZWX A;  3D92 A;  1RZE A;  3P3H A;  3DVD A;  1I9N A;  4L5W A;  3M1J A;  3MHO A;  3OY0 A;  1BNT A;  1FSQ A;  1ZNC A;  1CNY A;  4X5S A;  5E5R A;  5SZ6 A;  4E3F A;  4YGL A;  5E2N A;  1G52 A;  2CBA A;  5J8Z A;  9CA2 A;  3B1B A;  3S73 B;  4YXI A;  1ZGF A;  3S9T A;  1G53 A;  3HLJ A;  5AMG A;  1DCA A;  1KOP A;  4IDR X;  3BL0 A;  4QJO A;  4JSS A;  1CAY A;  3HKQ A;  2GD8 A;  1UGC A;  2CA2 A;  2H15 A;  1RAZ A;  4E3G A;  4FRC A;  1CAM A;  1CCT A;  4K1Q A;  1G0F A;  2FMG A;  1CRA A;  2POU A;  5IPZ A;  4QIZ A;  4RFC A;  3ML5 A;  3DBU A;  1Z97 A;  3DC9 A;  3EFI A;  1UGA A;  1I9M A;  1H4N A;  1YO1 A;  5BNL A;  4Q78 A;  4MO8 A;  5DOG A;  1UGB A;  2AW1 A;  3DCW A;  2Q1B A;  3M5E A;  3RYX B;  4G0C A;  2WEG A;  3CZV A;  1CAZ A;  3MNJ A;  3IBU A;  3F7B A;  1G0E A;  1CCS A;  4Q7S A;  4LU3 A;  2NWO A;  4KNI A;  4QY3 A;  3HKN A;  3MNK A;  2ABE A;  1BNN A;  1CNW A;  1CVB A;  1I9L A;  2WD2 A;  1CVA A;  3SBI A;  3M5T A;  3T5U A;  3ZP9 A;  4RIV A;  2F14 A;  3OKV A;  5FLS A;  5SZ1 A;  4ZWI A;  3RGE A;  3RYJ B;  4Q83 A;  5DSO A;  2H4N A;  2HOC A;  4M2U A;  3SAX A;  4QEF A;  1HEB A;  3V3G B;  12CA A;  3DAZ A;  4N0X B;  4YGN A;  2NXT A;  4TWL A;  1FQR A;  3OIK A;  1LUG A;  5EZT X;  3HKT A;  2CBE A;  2WEO A;  4L5U A;  3UYQ A;  3P58 A;  1V9I C;  4HU1 A;  5BYI A;  1I9P A;  5JG3 B;  4CA2 A;  4YGJ A;  1HEA A;  2EZ7 A;  4RUY A;  4Q06 A;  4QSJ A;  4QJ0 A;  3FFP X;  1TBT X;  3FW3 A;  1TE3 X;  3IBN A;  3S74 B;  4BCW A;  1IF9 A;  2NWP A;  4WUP A;  1FQL A;  5A6H A;  1CAN A;  1HVA A;  1THK A;  3OKU A;  4QK1 A;  4KUV A;  4Q8X A;  1YO2 A;  4MDM A;  3RZ8 A;  1G3Z A;  1RAY A;  1LGD A;  4KNN A;  5FNG A;  2QO8 A;  1CRM A;  4HT0 A;  1TB0 X;  1HCB A;  4QJP A;  2EU2 A;  1TH9 A;  3VBD A;  2NXR A;  3HFP A;  1AVN A;  3SBH A;  5CAC A;  3TMJ A;  1IF7 A;  3M14 A;  5FLR A;  4E9O X;  3F7U A;  1CAL A;  4RUX A;  3KWA A;  3P5A A;  1FLJ A;  1I9O A;  4Z1E A;  1CNK A;  1KEQ A;  2FNM A;  3GZ0 A;  1CAJ A;  4QJM A;  5G03 A;  1XEG A;  5EKJ A;  1XQ0 A;  1I8Z A;  2WEH A;  3SAP A;  2W2J A;  5JEG B;  5SZ5 A;  2X7U A;  2Q38 A;  3DCC A;  3S97 A;  2Q1Q A;  3JXH C;  4QSA A;  3MWO A;  4CNR A;  2HFW A;  4WL4 A;  2NNO A;  1BNQ A;  2HL4 A;  3F4X A;  1RJ6 A;  3MNU A;  1KWR A;  2NNG A;  2FNN A;  5E2R A;  1HCA A;  1CA3 A;  5G0C A;  4QTL A;  5JES B;  1T9N A;  3M40 A;  5EHV A;  3KLD B;  3V2M A;  2NMX A;  2FW4 A;  3D9Z A;  3DD8 A;  4Q99 A;  1MUA A;  4Q9Y A;  5E28 A;  3JXF A;  3S77 B;  5SZ0 A;  3OIL A;  4L5V A;  4HF3 A;  5FLO A;  1CAI A;  3P3J A;  1ZFQ A;  1Z93 A;  1BN1 A;  4MLX A;  2HKK A;  3DVC A;  5BRV A;  3UYN A;  3T85 A;  3W6H A;  4E3D A;  4XIX A;  1CNX A;  1RZA A;  3L14 A;  1BCD A;  2HD6 A;  2NN1 A;  3DVB A;  1KWQ A;  1BIC A;  1TTM A;  1Y7W A;  3HS4 A;  4Q81 A;  3OYS A;  1HUG A;  1BZM A;  3K34 A;  1BNV A;  5E5U A;  3S76 A;  4XE1 A;  4PXX A;  5FNM A;  4YX4 A;  3C7P A;  3R16 A;  1CA2 A;  1CCU A;  2NXS A;  4Q6D A;  3ML2 A;  5EH8 A;  3MNI A;  4YXU A;  3DC3 A;  4YXO A;  1I90 A;  5FLT A;  4Q7V A;  3LXE A;  2X7S A;  4FL7 A;  5DSQ A;  4MDG A;  3S75 B;  1DMX A;  1G46 A;  3MNA A;  3N0N A;  4CQ0 A;  5DRS A;  4K0S A;  1IF5 A;  3DA2 A;  1G54 A;  1AZM A;  4K0T A;  4XIW A;  5SZ3 A;  4Q90 A;  1J9W A;  1I91 A;  3P4V A;  3B4F A;  4FPT A;  3OYQ A;  3M5S A;  1G6V A;  1ZH9 A;  4M2R A;  3Q31 A;  4QSB A;  3PJJ A;  1FQM A;  1ZGE A;  2POV A;  3CAJ A;  3W6I A;  5DOH A;  3U7C A;  1HEC A;  1CNJ A;  3KS3 A;  5EHW A;  4KP5 A;  4PYY A;  3RYY A;  6CA2 A;  1OKN A;  1BN4 A;  4Z1N A;  5FL6 A;  5AML A;  4CNX A;  4HBA A;  3MMF A;  4LP6 A;  5EHE A;  3RYZ A;  1V9E A;  5JEP B;  4M2V A;  1Z9Y A;  4M2W A;  4FVO A;  4MLT A;  1G4J A;  2OSF A;  1TG9 A;  1YDC A;  3RZ0 B;  1IF6 A;  5FDI A;  1LG6 A;  4CNW A;  5E2S A;  2ZNC A;  4COQ A;  3P44 A;  1TEU X;  3RJ7 A;  1HUH A;  1CVD A;  3KOK A;  3MZC A;  4KAP A;  4R5A A;  1CVF A;  3BET A;  4Q07 A;  3T82 A;  1FSN A;  2NWZ A;  4ZX1 A;  5BRW A;  4K0Z A;  3T5Z A;  4UOV A;  5JGT B;  4WW6 A;  2CAB A;  3HKU A;  4KNM A;  4XZ5 A;  3CA2 A;  1CAO A;  3M1K A;  3FE4 A;  5L3O A;  2FMZ A;  1H9N A;  4Q87 A;  5DSR A;  5SZ2 A;  4GL1 X;  4YHA A;  1AM6 A;  3V3H B;  4LHI A;  3EFT A;  4QJW A;  4RUZ A;  1LZV A;  3ZNC A;  4E3H A;  5FLP A;  5G01 A;  4KNJ A;  1KOQ A;  4ITO A;  5EKM A;  3TVO X;  3P55 A;  2FOS A;  3T83 A;  3MDZ A;  5G0B A;  4YVY A;  4ZWY A;  4FIK A;  3V3F A;  3OIM A;  1CAH A;  3TVN X;  1H9Q A;  5JQ0 A;  5JDV B;  5FDC A;  4QK3 A;  4K13 A;  3KNE A;  1CVC A;  3JXG A;  5DVX A;  2FOU A;  3N3J A;  1CZM A;  3P5L A;  4JSZ A;  3V5G A;  4CAC A;  3QYK A;  3RG4 A;  1BNU A;  4HEZ A;  1G48 A;  2FOY A;  4TWM A;  5CJF A;  5DSP A;  3KON A;  4QJX A;  4BF1 A;  5SZ7 A;  3S8X A;  4PZH A;  4Q7W A;  1ZSC A;  2QP6 A;  3RLD A;  3IBL A;  4WW8 A;  5DSL A;  4Z1J A;  1YDB A;  4HEY A;  1CNH A;  1DCB A;  1I9Q A;  2O4Z A;  1A42 A;  3KKX A;  1RZD A;  3IAI A;  1IF8 A;  3F8E A;  5FL4 A;  3IGP A;  1FSR A;  1ZSB A;  4RIU A;  4YYT A;  5BRU A;  3K7K A;  1TG3 A;  1ZE8 A;  3RZ1 B;  2CBB A;  7CA2 A;  3N4B A;  1XEV A;  2VVB X;  4YGK A;  4KUY A;  3V3J A;  4JSA A;  4RFD A;  5HPJ A;  1YO0 A;  4Q8Y A;  3M98 A;  1BV3 A;  5FNJ A;  4Q6E A;  3CYU A;  1G1D A;  2NN7 A;  3N2P A;  5EH7 A;  3KOI A;  4BF6 A;  3KIG A;  3D0N A;  1RZC A;  5E2K A;  4N16 A;  1BNM A;  2WEJ A;  3M96 A;  5AMD A;  4YWP A;  2FOQ A;  3RG3 A;  4FVN A;  5DSI A;  3M1Q A;  5CLU A;  4ZAO A;  3MNH A;  4JSW A;  3U47 A;  2NWY A;  1BN3 A;  2EU3 A;  5CA2 A;  5JEH B;  1FR4 A;  5DSN A;  1CIM A;  5FNL A;  2X7T A;  2CBC A;  4Q49 A;  1UGE A;  1CVE A;  2HNC A;  1JD0 A;  3M3X A;  1CAK A;  4QK2 A;  3U45 X;  3PO6 A;  4PYX A;  4ILX A;  1LG5 A;  5JQT A;  3MYQ A;  5SZ4 A;  1CIL A;  4MTY A;  2FNK A;  4KP8 A;  2NNS A;  3MHI A;  1G4O A;  3V7X A;  4Z0Q A;  3M1W A;  1UGF A;  3DD0 A;  4R59 A;  4RN4 A;  4WUQ A;  4Q8Z A;  4KV0 A;  1ZFK A;  3S71 B;  5LMD A;  3IEO A;  4HT2 A;  2OSM A;  4E49 A;  4ETQ C;  4KUW A;  4WR7 A;  4Y0J A;  1UGD A;  1CNB A;  3M04 A;  4MDL A;  5FNH A;  5EH5 A;  4RH2 A;  1CNI A;  4FU5 A;  8CA2 A;  4HEW A;  3T84 A;  3NI5 A;  1XPZ A;  1G45 A;  3D93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...