4L3GC

Crystal structure of the e113q-maug/pre-methylamine dehydrogenase complex aged 120 days
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Carboxyl Group of Glu113 Is Required for Stabilization of the Diferrous and Bis-Fe(IV) States of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 31
structure length 124
sequence length 125
chains with identical sequence E
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4l3gC00
2Q7QD 2IAAB 2OJYD 2IUQD 2GC4B 1MAFL 3SXTC 2AH0D 2AGYD 2J56L 2MADL 4FAVC 4FA9C 1MAEL 1MG2B 3SWSC 3PXTC 1MDAL 4O1QC 2AGZD 4L3HC 4L1QC 2AGWD 2I0TD 2J55L 2BBKL 3PXWC 3RMZC 2AH1D 4FA4C 4K3IC 3PXSC 4Y5RC 2H47B 3RN1C 2I0SD 2HXCD 2OIZD 2AGXD 3RLMC 2HJ4D 3ORVC 2AGLD 3SJLC 3SVWC 2I0RD 2IUPD 2HJBD 1MG3B 3C75L 2MTAL 2OK4D 4FANC 4FA5C 2IUVD 4FB1C 2OK6D 2HKMD 2HKRD 3RN0C 2H3XB 2J57K 3L4MC 4FA1C 2GC7B 3L4OC 3SLEC 4L3GC 2IURD
chains in the Genus database with same CATH superfamily
2Q7QD 2IAAB 2OJYD 2IUQD 2GC4B 1MAFL 3SXTC 2AH0D 2AGYD 2J56L 2MADL 4FAVC 4FA9C 1MAEL 1MG2B 3SWSC 3PXTC 1MDAL 4O1QC 2AGZD 4L3HC 4L1QC 2AGWD 2I0TD 2J55L 2BBKL 3PXWC 3RMZC 2AH1D 4FA4C 4K3IC 3PXSC 4Y5RC 2H47B 3RN1C 2I0SD 2HXCD 2OIZD 2AGXD 3RLMC 2HJ4D 3ORVC 2AGLD 3SJLC 3SVWC 2I0RD 2IUPD 2HJBD 1MG3B 3C75L 2MTAL 2OK4D 4FANC 4FA5C 2IUVD 4FB1C 2OK6D 2HKMD 2HKRD 3RN0C 2H3XB 2J57K 3L4MC 4FA1C 2GC7B 3L4OC 3SLEC 4L3GC 2IURD
chains in the Genus database with same CATH topology
2Q7QD 2IAAB 2OJYD 2IUQD 2GC4B 1MAFL 3SXTC 2AH0D 2AGYD 2J56L 2MADL 4FAVC 4FA9C 1MAEL 1MG2B 3SWSC 3PXTC 1MDAL 4O1QC 2AGZD 4L3HC 4L1QC 2AGWD 2I0TD 2J55L 2BBKL 3PXWC 3RMZC 2AH1D 4FA4C 4K3IC 3PXSC 4Y5RC 2H47B 3RN1C 2I0SD 2HXCD 2OIZD 2AGXD 3RLMC 2HJ4D 3ORVC 2AGLD 3SJLC 3SVWC 2I0RD 2IUPD 2HJBD 1MG3B 3C75L 2MTAL 2OK4D 4FANC 4FA5C 2IUVD 4FB1C 2OK6D 2HKMD 2HKRD 3RN0C 2H3XB 2J57K 3L4MC 4FA1C 2GC7B 3L4OC 3SLEC 4L3GC 2IURD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7Q D;  2IAA B;  2OJY D;  2IUQ D;  2GC4 B;  1MAF L;  3SXT C;  2AH0 D;  2AGY D;  2J56 L;  2MAD L;  4FAV C;  4FA9 C;  1MAE L;  1MG2 B;  3SWS C;  3PXT C;  1MDA L;  4O1Q C;  2AGZ D;  4L3H C;  4L1Q C;  2AGW D;  2I0T D;  2J55 L;  2BBK L;  3PXW C;  3RMZ C;  2AH1 D;  4FA4 C;  4K3I C;  3PXS C;  4Y5R C;  2H47 B;  3RN1 C;  2I0S D;  2HXC D;  2OIZ D;  2AGX D;  3RLM C;  2HJ4 D;  3ORV C;  2AGL D;  3SJL C;  3SVW C;  2I0R D;  2IUP D;  2HJB D;  1MG3 B;  3C75 L;  2MTA L;  2OK4 D;  4FAN C;  4FA5 C;  2IUV D;  4FB1 C;  2OK6 D;  2HKM D;  2HKR D;  3RN0 C;  2H3X B;  2J57 K;  3L4M C;  4FA1 C;  2GC7 B;  3L4O C;  3SLE C;  4L3G C;  2IUR D; 
#chains in the Genus database with same CATH topology
 2Q7Q D;  2IAA B;  2OJY D;  2IUQ D;  2GC4 B;  1MAF L;  3SXT C;  2AH0 D;  2AGY D;  2J56 L;  2MAD L;  4FAV C;  4FA9 C;  1MAE L;  1MG2 B;  3SWS C;  3PXT C;  1MDA L;  4O1Q C;  2AGZ D;  4L3H C;  4L1Q C;  2AGW D;  2I0T D;  2J55 L;  2BBK L;  3PXW C;  3RMZ C;  2AH1 D;  4FA4 C;  4K3I C;  3PXS C;  4Y5R C;  2H47 B;  3RN1 C;  2I0S D;  2HXC D;  2OIZ D;  2AGX D;  3RLM C;  2HJ4 D;  3ORV C;  2AGL D;  3SJL C;  3SVW C;  2I0R D;  2IUP D;  2HJB D;  1MG3 B;  3C75 L;  2MTA L;  2OK4 D;  4FAN C;  4FA5 C;  2IUV D;  4FB1 C;  2OK6 D;  2HKM D;  2HKR D;  3RN0 C;  2H3X B;  2J57 K;  3L4M C;  4FA1 C;  2GC7 B;  3L4O C;  3SLE C;  4L3G C;  2IUR D; 
#chains in the Genus database with same CATH homology
 2Q7Q D;  2IAA B;  2OJY D;  2IUQ D;  2GC4 B;  1MAF L;  3SXT C;  2AH0 D;  2AGY D;  2J56 L;  2MAD L;  4FAV C;  4FA9 C;  1MAE L;  1MG2 B;  3SWS C;  3PXT C;  1MDA L;  4O1Q C;  2AGZ D;  4L3H C;  4L1Q C;  2AGW D;  2I0T D;  2J55 L;  2BBK L;  3PXW C;  3RMZ C;  2AH1 D;  4FA4 C;  4K3I C;  3PXS C;  4Y5R C;  2H47 B;  3RN1 C;  2I0S D;  2HXC D;  2OIZ D;  2AGX D;  3RLM C;  2HJ4 D;  3ORV C;  2AGL D;  3SJL C;  3SVW C;  2I0R D;  2IUP D;  2HJB D;  1MG3 B;  3C75 L;  2MTA L;  2OK4 D;  4FAN C;  4FA5 C;  2IUV D;  4FB1 C;  2OK6 D;  2HKM D;  2HKR D;  3RN0 C;  2H3X B;  2J57 K;  3L4M C;  4FA1 C;  2GC7 B;  3L4O C;  3SLE C;  4L3G C;  2IUR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...