The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
63
|
sequence length |
254
|
structure length |
254
|
Chain Sequence |
ASSLAPRQVIRDGQFITSPNGKYKLVMQADGNLVLYEDGTKPIWNTTPVGPGAKAVMEFNLNLYNKAGQVAWSSNVYTAYLFEEFKDEAYLNLQDDGDFGIFSDEAKWGSIVLSRPEVGVKNKIIPTGTVMVPGTEYINGNYRLAFQGDGNLVIYQINPQVVIWATYTMGADRAVVQEDGNFVIYKGTTALWHTHTATGMPAYLKFTNTGKLFLSQPTLLWTLKRGSLSKPPKVIPGQHGPLDTTPIWSWPHDY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Sugar binding protein
|
molecule keywords |
Pyocin L1
|
publication title |
Lectin-Like Bacteriocins from Pseudomonas spp. Utilise D-Rhamnose Containing Lipopolysaccharide as a Cellular Receptor.
pubmed doi rcsb |
source organism |
Pseudomonas aeruginosa
|
total genus |
63
|
structure length |
254
|
sequence length |
254
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2013-06-25 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Orthogonal Prism | Agglutinin, subunit A | Agglutinin, subunit A | ||
Mainly Beta | Orthogonal Prism | Agglutinin, subunit A | Agglutinin, subunit A |
#chains in the Genus database with same CATH superfamily 4GC1 A; 4OIZ A; 4GC2 A; 4OIT A; 4LEA A; 4LED A; 3M7H A; 3M7J A; 4OKC A; 4LE7 A; #chains in the Genus database with same CATH topology 4TKC A; 2DPF A; 1BWU P; 1XD5 A; 5J76 A; 2D04 A; 4LED A; 3R0E A; 1KJ1 D; 5T20 B; 5D9Z A; 4LE7 A; 5T1X A; 4PDT A; 1DLP A; 4GC2 A; 4OIT A; 3DZW A; 5D5G A; 1JPC A; 5J76 B; 2D04 B; 1BWU Q; 1XD6 A; 3R0E B; 1BWU D; 3M7J A; 3A0D A; 4OKC A; 1KJ1 A; 5T1X B; 3MEZ A; 4OIZ A; 1B2P A; 1NPL A; 5D9Z B; 3A0C A; 3A0E A; 5D5G B; 1MSA A; 4GC1 A; 3MEZ B; 1BWU A; 4LEA A; 5T20 A; 3M7H A; 1NIV A; 4H3O A; #chains in the Genus database with same CATH homology 4GC1 A; 4OIZ A; 4GC2 A; 4OIT A; 4LEA A; 4LED A; 3M7H A; 3M7J A; 4OKC A; 4LE7 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...