4QIZA

Crystal structure of human carbonic anhydrase isozyme xiii with inhibitor
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
Knots found
sequence length
258
structure length
258
Chain Sequence
SWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonic anhydrase 13
publication title Functionalization of Fluorinated Benzenesulfonamides and Their Inhibitory Properties toward Carbonic Anhydrases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase/lyase inhibitor
total genus 82
structure length 258
sequence length 258
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 4qizA00
4KP8A 4HT0A 1HVAA 5E5UA 2H15A 5FL5A 2O4ZA 1ZSAA 5E28A 3MMFA 3KLDB 1F2WA 4JSZA 4KUYA 4HF3A 4M2RA 5BYIA 1ZFQA 1H9QA 3M40A 5SZ6A 4MDGA 5DRSA 3OYQA 4XE1A 1CCSA 1RAZA 3N0NA 3P44A 4QY3A 5FLPA 2CABA 3BL1A 1ZFKA 1LUGA 5FDIA 4RN4A 5DSIA 1MUAA 1CVBA 4MLTA 1CAOA 3M2YA 3S77B 4XFWA 5EH8A 3RYZA 1IF7A 3JXGA 3V3FA 3FFPX 4MO8A 4Q83A 1CNCA 2OSFA 3RZ1B 2NXRA 1YO2A 1ZSCA 4RUYA 5FNKA 3PO6A 4K0ZA 1TG3A 2NXTA 1CCUA 5SZ1A 5DSRA 4BF6A 3U3AX 3BETA 3LXEA 4Y0JA 2NMXA 3RYYA 7CA2A 4Q8XA 1I90A 1LG6A 3CZVA 3PJJA 3RZ0B 2NNSA 5CACA 4FPTA 4YX4A 4PYYA 4ITOA 4Q7PA 4YYTA 4KNNA 3OKUA 3S72B 4WW6A 5SZ2A 3MWOA 1BCDA 3P5AA 3W6IA 2X7TA 4IWZA 2Q1QA 4CNRA 4R5BA 3T82A 4CQ0A 4ZX1A 3MNHA 5FLOA 2ABEA 2X7UA 4E9OX 5SZ7A 3S74B 1IF5A 1I9LA 3RYVB 4JSSA 5EHVA 4ZWYA 5SZ3A 4ZWIA 4E3DA 3MYQA 5E2KA 2QP6A 1DCBA 1KWQA 4HU1A 3V3IB 3DCSA 4MTYA 4KV0A 3DD0A 3CYUA 3MHIA 6CA2A 3P58A 3RYXB 4COQA 2POVA 5EKHA 5DSOA 5CLUA 5G0CA 2W2JA 5FLSA 4KUVA 3T85A 1Z97A 4WW8A 2HFWA 4BCWA 3DA2A 1CNBA 1FQRA 3MNIA 4Q9YA 4Z0QA 3RJ7A 1TBTX 1IF8A 5DSQA 3DBUA 4Q90A 3HLJA 1TEQX 5AMGA 1YO1A 3V5GA 3DV7A 1G45A 3KKXA 1BNWA 1UGFA 3K34A 1CAHA 1KWRA 1RJ5A 4LHIA 2GD8A 4YWPA 3Q31A 1G3ZA 1XQ0A 3M04A 1CA2A 1YDBA 4E3HA 4YGLA 1BNNA 4WUQA 1LGDA 3DVBA 1I9NA 3IBIA 4TWMA 3HKQA 4Q8ZA 3TVOX 1BN1A 4E49A 3C7PA 4XZ5A 2EZ7A 4CA2A 3ZP9A 2FOUA 3ZNCA 4DZ9A 1HEDA 1MOOA 2OSMA 1G1DA 4K1QA 1URTA 3F4XA 4JSWA 3QYKA 3DAZA 3S75B 3HFPA 4K13A 1CRAA 1FQMA 1OKNA 4HBAA 5DVXA 1CVAA 2HNCA 5AMLA 5JQTA 1RZBA 4C3TA 3B4FA 3IBUA 3UYNA 4Q0LA 1J9WA 4Q6EA 3RG3A 5FDCA 3S76A 1Z93A 1CALA 1HEBA 1KOQA 4MDLA 2QOAA 4HT2A 4YGNA 5DOHA 2ZNCA 5JEPB 1CNIA 4XIXA 5AMDA 1IF4A 4Q87A 4QIZA 3RLDA 5E2NA 1XEVA 4Z1EA 1G4OA 1RAYA 5JDVB 1DMYA 3HS4A 3VBDA 4QSJA 2IT4A 1CNWA 4Q06A 4LU3A 4JS6A 3IGPA 4ETQC 3CAJA 1CANA 1I91A 2AX2A 1BV3A 4Q7SA 1ZGEA 1TTMA 1CNGA 1V9IC 1CNHA 1HUGA 1LZVA 2FOSA 2FNKA 3IBNA 5DSJA 3RZ7A 3EFIA 2FNNA 1G0FA 1ZSBA 4K0TA 1DCAA 1TE3X 4QJOA 4YGFA 4QK3A 3P5LA 1BN3A 4QJ0A 1CRMA 4HEZA 5CJFA 3P3JA 2HKKA 1CNXA 3PYKA 1CCTA 1I8ZA 5FNGA 4E5QA 4MDMA 3GZ0A 4QK1A 3M5EA 2WD3A 1CZMA 4KUWA 5A25A 1YDCA 9CA2A 3FE4A 4QSAA 2NNGA 1JCZA 1UGDA 1EOUA 1ZE8A 4K0SA 3DVCA 4X5SA 1TG9A 2CBDA 4HEWA 5EH7A 5E2SA 3DVDA 4QJWA 3B1BA 2NNOA 5FNLA 4KNMA 4QJXA 5DSPA 1G0EA 2H4NA 2HL4A 3M1WA 1TH9A 3U7CA 3N4BA 3MNAA 4R5AA 3S97A 3N3JA 3OIKA 4YXIA 3T83A 4PZHA 3R17B 2NN1A 2NWPA 4RUXA 3M2NA 3MNKA 3TVNX 3DD8A 5EHWA 4DZ7A 3SBIA 2CA2A 3EFTA 3RZ8A 1ZGFA 3T5ZA 5C8IA 1Y7WA 3OYSA 1UGBA 3OILA 5FNHA 2HOCA 5EOIA 5FLTA 3P55A 4M2UA 1UGAA 2POUA 2X7SA 4G7AA 3W6HA 1CAJA 1CAYA 4FL7A 1AM6A 1CVEA 2FMZA 3D0NA 1CVCA 4L5UA 1RZEA 4CNXA 3IBLA 4Q08A 3S78B 1BICA 1BZMA 5EIJA 1XEGA 3JXFA 1OKMA 4Z1JA 2HD6A 5EKJA 1ZNCA 1CVFA 3F8EA 2NWYA 1RZCA 3MHLA 1G46A 1OKLA 5BRVA 2FOVA 4CNWA 1RZDA 1IF9A 3OIMA 3OKVA 3UYQA 3D93A 2CBBA 5BRWA 1FSRA 2QO8A 1Z9YA 1V9EA 1UGGA 4G0CA 4LP6A 5LMDA 4YXUA 4MLXA 1I9MA 3F7UA 5CA2A 3S71B 3V2JA 3V7XA 3T84A 3M2ZA 4KNJA 1FQLA 4M2WA 2AW1A 3D8WA 1H4NA 4Q7WA 3V3HB 4Q6DA 4PYXA 5JEGB 2NWOA 5FLQA 5EH5A 4RUZA 1HEAA 3OY0A 5EZTX 3KOKA 3JXHC 3F7BA 1I9OA 3MHOA 3P4VA 2EU3A 12CAA 1FLJA 4M2VA 4Z1NA 1CAIA 4RFCA 2VVAX 1CNJA 1FR7A 4Q07A 5FL6A 4HEYA 4QSIA 1CILA 1I9PA 3S8XA 1G48A 1CIMA 4N16A 1CVHA 5JGTB 3KOIA 3MHCA 5E2RA 4RFDA 5BRUA 1BNQA 1ZH9A 3BL0A 2Q1BA 3V2MA 4ZX0A 3M96A 2WEGA 5L3OA 1FR4A 5DOGA 1YDDA 3M3XA 4UOVA 5JESB 5EHEA 1UGEA 3NJ9A 5DSKA 5BNLA 3V3JA 3DC3A 4QEFA 2WEOA 3U45X 2ILIA 4Q49A 1G4JA 3P3HA 2CBEA 4Q7VA 1CA3A 3RGEA 3TMJA 4L5WA 4Q81A 2CBCA 5EKMA 3RYJB 1BNVA 1A42A 3KNEA 4IDRX 4CNVA 4RIVA 3V3GB 3HKUA 5IPZA 4QIYA 4GL1X 4KNIA 1BN4A 1DMXA 2WEHA 5G01A 2CBAA 1CAKA 4FU5A 3MNUA 3D92A 4WUPA 4ZWXA 1YO0A 3M98A 1HCBA 4Q99A 4Z1KA 4QK2A 5FNJA 3ML5A 3L14A 4E3GA 2FMGA 4FVOA 8CA2A 3M14A 5FL4A 3MDZA 5L6KA 3RZ5A 1CVDA 5G03A 4FRCA 3D9ZA 3HKTA 1FQNA 4Q78A 4QTLA 3KIGA 3ML2A 1XPZA 3M1KA 5E2MA 3SBHA 1RJ6A 1KEQA 4YVYA 2NN7A 2WD2A 5SZ4A 1UGCA 1THKA 3NI5A 4WL4A 3SAPA 1AVNA 4QJPA 4TWLA 3U47A 3DC9A 4PQ7A 5JEHB 2VVBX 3M5SA 4FIKA 1CAZA 4FVNA 1FSQA 4Q09A 5DSNA 1CAMA 1CINA 3RG4A 3R16A 5J8ZA 1BNMA 1G53A 3N2PA 2NNVA 1CNYA 5FLRA 1BNTA 3M5TA 2FOYA 3DCWA 4KP5A 3KWAA 4E4AA 3T5UA 1FSNA 5JQ0A 3CA2A 3MNJA 4RIUA 4ILXA 1KOPA 1T9NA 5JG5B 3HKNA 2WEJA 5A6HA 1HUHA 1BNUA 2FOQA 3K7KA 3M1QA 2F14A 1TB0X 1TEUX 1I9QA 5G0BA 3KS3A 3NB5A 4ZWZA 3M1JA 4YHAA 4YGKA 4CACA 1JV0A 1RZAA 3MHMA 5DSMA 3IEOA 5FNIA 4Q8YA 3MZCA 1YDAA 1LG5A 1G54A 2GEHA 4E3FA 2NXSA 2FNMA 5HPJA 5JG3B 1G52A 1G6VA 5E5RA 2FW4A 4YXOA 3IAIA 3K2FA 1JD0A 4ITPA 4WR7A 2EU2A 4QSBA 3FW3A 2POWA 5FNMA 4N0XB 5JGSB 3M2XA 1HECA 4JSAA 4RH2A 4ZAOA 3SAXA 1H9NA 1IF6A 3S9TA 1OQ5A 5DSLA 4KAPA 3S73B 4QJMA 4BF1A 2NWZA 4L5VA 5SZ5A 5SZ0A 4YGJA 1HCAA 3M67A 3KONA 4XIWA 1AZMA 3DCCA 1CNKA 4R59A 4PXXA 2Q38A
chains in the Genus database with same CATH superfamily
4KP8A 4HT0A 1HVAA 5E5UA 2H15A 5FL5A 2O4ZA 1ZSAA 5E28A 3MMFA 3KLDB 1F2WA 4JSZA 4KUYA 4HF3A 4M2RA 5BYIA 1ZFQA 1H9QA 3M40A 5SZ6A 4MDGA 5DRSA 3OYQA 4XE1A 1CCSA 1RAZA 3N0NA 3P44A 4QY3A 5FLPA 2CABA 3BL1A 1ZFKA 1LUGA 5FDIA 4RN4A 5DSIA 1MUAA 1CVBA 4MLTA 1CAOA 3M2YA 3S77B 4XFWA 5EH8A 3RYZA 1IF7A 3JXGA 3V3FA 3FFPX 4MO8A 4Q83A 1CNCA 2OSFA 3RZ1B 2NXRA 1YO2A 1ZSCA 4RUYA 5FNKA 3PO6A 4K0ZA 1TG3A 2NXTA 1CCUA 5SZ1A 5DSRA 4BF6A 3U3AX 3BETA 3LXEA 4Y0JA 2NMXA 3RYYA 7CA2A 4Q8XA 1I90A 1LG6A 3CZVA 3PJJA 3RZ0B 2NNSA 5CACA 4FPTA 4YX4A 4PYYA 4ITOA 4Q7PA 4YYTA 4KNNA 3OKUA 3S72B 4WW6A 5SZ2A 3MWOA 1BCDA 3P5AA 3W6IA 2X7TA 4IWZA 2Q1QA 4CNRA 4R5BA 3T82A 4CQ0A 4ZX1A 3MNHA 5FLOA 2ABEA 2X7UA 4E9OX 5SZ7A 3S74B 1IF5A 1I9LA 3RYVB 4JSSA 5EHVA 4ZWYA 5SZ3A 4ZWIA 4E3DA 3MYQA 5E2KA 2QP6A 1DCBA 1KWQA 4HU1A 3V3IB 3DCSA 4MTYA 4KV0A 3DD0A 3CYUA 3MHIA 6CA2A 3P58A 3RYXB 4COQA 2POVA 5EKHA 5DSOA 5CLUA 5G0CA 2W2JA 5FLSA 4KUVA 3T85A 1Z97A 4WW8A 2HFWA 4BCWA 3DA2A 1CNBA 1FQRA 3MNIA 4Q9YA 4Z0QA 3RJ7A 1TBTX 1IF8A 5DSQA 3DBUA 4Q90A 3HLJA 1TEQX 5AMGA 1YO1A 3V5GA 3DV7A 1G45A 3KKXA 1BNWA 1UGFA 3K34A 1CAHA 1KWRA 1RJ5A 4LHIA 2GD8A 4YWPA 3Q31A 1G3ZA 1XQ0A 3M04A 1CA2A 1YDBA 4E3HA 4YGLA 1BNNA 4WUQA 1LGDA 3DVBA 1I9NA 3IBIA 4TWMA 3HKQA 4Q8ZA 3TVOX 1BN1A 4E49A 3C7PA 4XZ5A 2EZ7A 4CA2A 3ZP9A 2FOUA 3ZNCA 4DZ9A 1HEDA 1MOOA 2OSMA 1G1DA 4K1QA 1URTA 3F4XA 4JSWA 3QYKA 3DAZA 3S75B 3HFPA 4K13A 1CRAA 1FQMA 1OKNA 4HBAA 5DVXA 1CVAA 2HNCA 5AMLA 5JQTA 1RZBA 4C3TA 3B4FA 3IBUA 3UYNA 4Q0LA 1J9WA 4Q6EA 3RG3A 5FDCA 3S76A 1Z93A 1CALA 1HEBA 1KOQA 4MDLA 2QOAA 4HT2A 4YGNA 5DOHA 2ZNCA 5JEPB 1CNIA 4XIXA 5AMDA 1IF4A 4Q87A 4QIZA 3RLDA 5E2NA 1XEVA 4Z1EA 1G4OA 1RAYA 5JDVB 1DMYA 3HS4A 3VBDA 4QSJA 2IT4A 1CNWA 4Q06A 4LU3A 4JS6A 3IGPA 4ETQC 3CAJA 1CANA 1I91A 2AX2A 1BV3A 4Q7SA 1ZGEA 1TTMA 1CNGA 1V9IC 1CNHA 1HUGA 1LZVA 2FOSA 2FNKA 3IBNA 5DSJA 3RZ7A 3EFIA 2FNNA 1G0FA 1ZSBA 4K0TA 1DCAA 1TE3X 4QJOA 4YGFA 4QK3A 3P5LA 1BN3A 4QJ0A 1CRMA 4HEZA 5CJFA 3P3JA 2HKKA 1CNXA 3PYKA 1CCTA 1I8ZA 5FNGA 4E5QA 4MDMA 3GZ0A 4QK1A 3M5EA 2WD3A 1CZMA 4KUWA 5A25A 1YDCA 9CA2A 3FE4A 4QSAA 2NNGA 1JCZA 1UGDA 1EOUA 1ZE8A 4K0SA 3DVCA 4X5SA 1TG9A 2CBDA 4HEWA 5EH7A 5E2SA 3DVDA 4QJWA 3B1BA 2NNOA 5FNLA 4KNMA 4QJXA 5DSPA 1G0EA 2H4NA 2HL4A 3M1WA 1TH9A 3U7CA 3N4BA 3MNAA 4R5AA 3S97A 3N3JA 3OIKA 4YXIA 3T83A 4PZHA 3R17B 2NN1A 2NWPA 4RUXA 3M2NA 3MNKA 3TVNX 3DD8A 5EHWA 4DZ7A 3SBIA 2CA2A 3EFTA 3RZ8A 1ZGFA 3T5ZA 5C8IA 1Y7WA 3OYSA 1UGBA 3OILA 5FNHA 2HOCA 5EOIA 5FLTA 3P55A 4M2UA 1UGAA 2POUA 2X7SA 4G7AA 3W6HA 1CAJA 1CAYA 4FL7A 1AM6A 1CVEA 2FMZA 3D0NA 1CVCA 4L5UA 1RZEA 4CNXA 3IBLA 4Q08A 3S78B 1BICA 1BZMA 5EIJA 1XEGA 3JXFA 1OKMA 4Z1JA 2HD6A 5EKJA 1ZNCA 1CVFA 3F8EA 2NWYA 1RZCA 3MHLA 1G46A 1OKLA 5BRVA 2FOVA 4CNWA 1RZDA 1IF9A 3OIMA 3OKVA 3UYQA 3D93A 2CBBA 5BRWA 1FSRA 2QO8A 1Z9YA 1V9EA 1UGGA 4G0CA 4LP6A 5LMDA 4YXUA 4MLXA 1I9MA 3F7UA 5CA2A 3S71B 3V2JA 3V7XA 3T84A 3M2ZA 4KNJA 1FQLA 4M2WA 2AW1A 3D8WA 1H4NA 4Q7WA 3V3HB 4Q6DA 4PYXA 5JEGB 2NWOA 5FLQA 5EH5A 4RUZA 1HEAA 3OY0A 5EZTX 3KOKA 3JXHC 3F7BA 1I9OA 3MHOA 3P4VA 2EU3A 12CAA 1FLJA 4M2VA 4Z1NA 1CAIA 4RFCA 2VVAX 1CNJA 1FR7A 4Q07A 5FL6A 4HEYA 4QSIA 1CILA 1I9PA 3S8XA 1G48A 1CIMA 4N16A 1CVHA 5JGTB 3KOIA 3MHCA 5E2RA 4RFDA 5BRUA 1BNQA 1ZH9A 3BL0A 2Q1BA 3V2MA 4ZX0A 3M96A 2WEGA 5L3OA 1FR4A 5DOGA 1YDDA 3M3XA 4UOVA 5JESB 5EHEA 1UGEA 3NJ9A 5DSKA 5BNLA 3V3JA 3DC3A 4QEFA 2WEOA 3U45X 2ILIA 4Q49A 1G4JA 3P3HA 2CBEA 4Q7VA 1CA3A 3RGEA 3TMJA 4L5WA 4Q81A 2CBCA 5EKMA 3RYJB 1BNVA 1A42A 3KNEA 4IDRX 4CNVA 4RIVA 3V3GB 3HKUA 5IPZA 4QIYA 4GL1X 4KNIA 1BN4A 1DMXA 2WEHA 5G01A 2CBAA 1CAKA 4FU5A 3MNUA 3D92A 4WUPA 4ZWXA 1YO0A 3M98A 1HCBA 4Q99A 4Z1KA 4QK2A 5FNJA 3ML5A 3L14A 4E3GA 2FMGA 4FVOA 8CA2A 3M14A 5FL4A 3MDZA 5L6KA 3RZ5A 1CVDA 5G03A 4FRCA 3D9ZA 3HKTA 1FQNA 4Q78A 4QTLA 3KIGA 3ML2A 1XPZA 3M1KA 5E2MA 3SBHA 1RJ6A 1KEQA 4YVYA 2NN7A 2WD2A 5SZ4A 1UGCA 1THKA 3NI5A 4WL4A 3SAPA 1AVNA 4QJPA 4TWLA 3U47A 3DC9A 4PQ7A 5JEHB 2VVBX 3M5SA 4FIKA 1CAZA 4FVNA 1FSQA 4Q09A 5DSNA 1CAMA 1CINA 3RG4A 3R16A 5J8ZA 1BNMA 1G53A 3N2PA 2NNVA 1CNYA 5FLRA 1BNTA 3M5TA 2FOYA 3DCWA 4KP5A 3KWAA 4E4AA 3T5UA 1FSNA 5JQ0A 3CA2A 3MNJA 4RIUA 4ILXA 1KOPA 1T9NA 5JG5B 3HKNA 2WEJA 5A6HA 1HUHA 1BNUA 2FOQA 3K7KA 3M1QA 2F14A 1TB0X 1TEUX 1I9QA 5G0BA 3KS3A 3NB5A 4ZWZA 3M1JA 4YHAA 4YGKA 4CACA 1JV0A 1RZAA 3MHMA 5DSMA 3IEOA 5FNIA 4Q8YA 3MZCA 1YDAA 1LG5A 1G54A 2GEHA 4E3FA 2NXSA 2FNMA 5HPJA 5JG3B 1G52A 1G6VA 5E5RA 2FW4A 4YXOA 3IAIA 3K2FA 1JD0A 4ITPA 4WR7A 2EU2A 4QSBA 3FW3A 2POWA 5FNMA 4N0XB 5JGSB 3M2XA 1HECA 4JSAA 4RH2A 4ZAOA 3SAXA 1H9NA 1IF6A 3S9TA 1OQ5A 5DSLA 4KAPA 3S73B 4QJMA 4BF1A 2NWZA 4L5VA 5SZ5A 5SZ0A 4YGJA 1HCAA 3M67A 3KONA 4XIWA 1AZMA 3DCCA 1CNKA 4R59A 4PXXA 2Q38A
chains in the Genus database with same CATH topology
4KP8A 4HT0A 1HVAA 5E5UA 2H15A 5FL5A 2O4ZA 1ZSAA 5E28A 3MMFA 3KLDB 1F2WA 4JSZA 4KUYA 4HF3A 4M2RA 5BYIA 1ZFQA 1H9QA 3M40A 5SZ6A 4MDGA 5DRSA 3OYQA 4XE1A 1CCSA 1RAZA 3N0NA 3P44A 4QY3A 5FLPA 2CABA 3BL1A 1ZFKA 1LUGA 5FDIA 4RN4A 5DSIA 1MUAA 1CVBA 4MLTA 1CAOA 3M2YA 3S77B 4XFWA 5EH8A 3RYZA 1IF7A 3JXGA 3V3FA 3FFPX 4MO8A 4Q83A 1CNCA 2OSFA 3RZ1B 2NXRA 1YO2A 1ZSCA 4RUYA 5FNKA 3PO6A 4K0ZA 1TG3A 2NXTA 1CCUA 5SZ1A 5DSRA 4BF6A 3U3AX 3BETA 3LXEA 4Y0JA 2NMXA 3RYYA 7CA2A 4Q8XA 1I90A 1LG6A 3CZVA 3PJJA 3RZ0B 2NNSA 5CACA 4FPTA 4YX4A 4PYYA 4ITOA 4Q7PA 4YYTA 4KNNA 3OKUA 3S72B 4WW6A 5SZ2A 3MWOA 1BCDA 3P5AA 3W6IA 2X7TA 4IWZA 2Q1QA 4CNRA 4R5BA 3T82A 4CQ0A 4ZX1A 3MNHA 5FLOA 2ABEA 2X7UA 4E9OX 5SZ7A 3S74B 1IF5A 1I9LA 3RYVB 4JSSA 5EHVA 4ZWYA 5SZ3A 4ZWIA 4E3DA 3MYQA 5E2KA 2QP6A 1DCBA 1KWQA 4HU1A 3V3IB 3DCSA 4MTYA 4KV0A 3DD0A 3CYUA 3MHIA 6CA2A 3P58A 3RYXB 4COQA 2POVA 5EKHA 5DSOA 5CLUA 5G0CA 2W2JA 5FLSA 4KUVA 3T85A 1Z97A 4WW8A 2HFWA 4BCWA 3DA2A 1CNBA 1FQRA 3MNIA 4Q9YA 4Z0QA 3RJ7A 1TBTX 1IF8A 5DSQA 3DBUA 4Q90A 3HLJA 1TEQX 5AMGA 1YO1A 3V5GA 3DV7A 1G45A 3KKXA 1BNWA 1UGFA 3K34A 1CAHA 1KWRA 1RJ5A 4LHIA 2GD8A 4YWPA 3Q31A 1G3ZA 1XQ0A 3M04A 1CA2A 1YDBA 4E3HA 4YGLA 1BNNA 4WUQA 1LGDA 3DVBA 1I9NA 3IBIA 4TWMA 3HKQA 4Q8ZA 3TVOX 1BN1A 4E49A 3C7PA 4XZ5A 2EZ7A 4CA2A 3ZP9A 2FOUA 3ZNCA 4DZ9A 1HEDA 1MOOA 2OSMA 1G1DA 4K1QA 1URTA 3F4XA 4JSWA 3QYKA 3DAZA 3S75B 3HFPA 4K13A 1CRAA 1FQMA 1OKNA 4HBAA 5DVXA 1CVAA 2HNCA 5AMLA 5JQTA 1RZBA 4C3TA 3B4FA 3IBUA 3UYNA 4Q0LA 1J9WA 4Q6EA 3RG3A 5FDCA 3S76A 1Z93A 1CALA 1HEBA 1KOQA 4MDLA 2QOAA 4HT2A 4YGNA 5DOHA 2ZNCA 5JEPB 1CNIA 4XIXA 5AMDA 1IF4A 4Q87A 4QIZA 3RLDA 5E2NA 1XEVA 4Z1EA 1G4OA 1RAYA 5JDVB 1DMYA 3HS4A 3VBDA 4QSJA 2IT4A 1CNWA 4Q06A 4LU3A 4JS6A 3IGPA 4ETQC 3CAJA 1CANA 1I91A 2AX2A 1BV3A 4Q7SA 1ZGEA 1TTMA 1CNGA 1V9IC 1CNHA 1HUGA 1LZVA 2FOSA 2FNKA 3IBNA 5DSJA 3RZ7A 3EFIA 2FNNA 1G0FA 1ZSBA 4K0TA 1DCAA 1TE3X 4QJOA 4YGFA 4QK3A 3P5LA 1BN3A 4QJ0A 1CRMA 4HEZA 5CJFA 3P3JA 2HKKA 1CNXA 3PYKA 1CCTA 1I8ZA 5FNGA 4E5QA 4MDMA 3GZ0A 4QK1A 3M5EA 2WD3A 1CZMA 4KUWA 5A25A 1YDCA 9CA2A 3FE4A 4QSAA 2NNGA 1JCZA 1UGDA 1EOUA 1ZE8A 4K0SA 3DVCA 4X5SA 1TG9A 2CBDA 4HEWA 5EH7A 5E2SA 3DVDA 4QJWA 3B1BA 2NNOA 5FNLA 4KNMA 4QJXA 5DSPA 1G0EA 2H4NA 2HL4A 3M1WA 1TH9A 3U7CA 3N4BA 3MNAA 4R5AA 3S97A 3N3JA 3OIKA 4YXIA 3T83A 4PZHA 3R17B 2NN1A 2NWPA 4RUXA 3M2NA 3MNKA 3TVNX 3DD8A 5EHWA 4DZ7A 3SBIA 2CA2A 3EFTA 3RZ8A 1ZGFA 3T5ZA 5C8IA 1Y7WA 3OYSA 1UGBA 3OILA 5FNHA 2HOCA 5EOIA 5FLTA 3P55A 4M2UA 1UGAA 2POUA 2X7SA 4G7AA 3W6HA 1CAJA 1CAYA 4FL7A 1AM6A 1CVEA 2FMZA 3D0NA 1CVCA 4L5UA 1RZEA 4CNXA 3IBLA 4Q08A 3S78B 1BICA 1BZMA 5EIJA 1XEGA 3JXFA 1OKMA 4Z1JA 2HD6A 5EKJA 1ZNCA 1CVFA 3F8EA 2NWYA 1RZCA 3MHLA 1G46A 1OKLA 5BRVA 2FOVA 4CNWA 1RZDA 1IF9A 3OIMA 3OKVA 3UYQA 3D93A 2CBBA 5BRWA 1FSRA 2QO8A 1Z9YA 1V9EA 1UGGA 4G0CA 4LP6A 5LMDA 4YXUA 4MLXA 1I9MA 3F7UA 5CA2A 3S71B 3V2JA 3V7XA 3T84A 3M2ZA 4KNJA 1FQLA 4M2WA 2AW1A 3D8WA 1H4NA 4Q7WA 3V3HB 4Q6DA 4PYXA 5JEGB 2NWOA 5FLQA 5EH5A 4RUZA 1HEAA 3OY0A 5EZTX 3KOKA 3JXHC 3F7BA 1I9OA 3MHOA 3P4VA 2EU3A 12CAA 1FLJA 4M2VA 4Z1NA 1CAIA 4RFCA 2VVAX 1CNJA 1FR7A 4Q07A 5FL6A 4HEYA 4QSIA 1CILA 1I9PA 3S8XA 1G48A 1CIMA 4N16A 1CVHA 5JGTB 3KOIA 3MHCA 5E2RA 4RFDA 5BRUA 1BNQA 1ZH9A 3BL0A 2Q1BA 3V2MA 4ZX0A 3M96A 2WEGA 5L3OA 1FR4A 5DOGA 1YDDA 3M3XA 4UOVA 5JESB 5EHEA 1UGEA 3NJ9A 5DSKA 5BNLA 3V3JA 3DC3A 4QEFA 2WEOA 3U45X 2ILIA 4Q49A 1G4JA 3P3HA 2CBEA 4Q7VA 1CA3A 3RGEA 3TMJA 4L5WA 4Q81A 2CBCA 5EKMA 3RYJB 1BNVA 1A42A 3KNEA 4IDRX 4CNVA 4RIVA 3V3GB 3HKUA 5IPZA 4QIYA 4GL1X 4KNIA 1BN4A 1DMXA 2WEHA 5G01A 2CBAA 1CAKA 4FU5A 3MNUA 3D92A 4WUPA 4ZWXA 1YO0A 3M98A 1HCBA 4Q99A 4Z1KA 4QK2A 5FNJA 3ML5A 3L14A 4E3GA 2FMGA 4FVOA 8CA2A 3M14A 5FL4A 3MDZA 5L6KA 3RZ5A 1CVDA 5G03A 4FRCA 3D9ZA 3HKTA 1FQNA 4Q78A 4QTLA 3KIGA 3ML2A 1XPZA 3M1KA 5E2MA 3SBHA 1RJ6A 1KEQA 4YVYA 2NN7A 2WD2A 5SZ4A 1UGCA 1THKA 3NI5A 4WL4A 3SAPA 1AVNA 4QJPA 4TWLA 3U47A 3DC9A 4PQ7A 5JEHB 2VVBX 3M5SA 4FIKA 1CAZA 4FVNA 1FSQA 4Q09A 5DSNA 1CAMA 1CINA 3RG4A 3R16A 5J8ZA 1BNMA 1G53A 3N2PA 2NNVA 1CNYA 5FLRA 1BNTA 3M5TA 2FOYA 3DCWA 4KP5A 3KWAA 4E4AA 3T5UA 1FSNA 5JQ0A 3CA2A 3MNJA 4RIUA 4ILXA 1KOPA 1T9NA 5JG5B 3HKNA 2WEJA 5A6HA 1HUHA 1BNUA 2FOQA 3K7KA 3M1QA 2F14A 1TB0X 1TEUX 1I9QA 5G0BA 3KS3A 3NB5A 4ZWZA 3M1JA 4YHAA 4YGKA 4CACA 1JV0A 1RZAA 3MHMA 5DSMA 3IEOA 5FNIA 4Q8YA 3MZCA 1YDAA 1LG5A 1G54A 2GEHA 4E3FA 2NXSA 2FNMA 5HPJA 5JG3B 1G52A 1G6VA 5E5RA 2FW4A 4YXOA 3IAIA 3K2FA 1JD0A 4ITPA 4WR7A 2EU2A 4QSBA 3FW3A 2POWA 5FNMA 4N0XB 5JGSB 3M2XA 1HECA 4JSAA 4RH2A 4ZAOA 3SAXA 1H9NA 1IF6A 3S9TA 1OQ5A 5DSLA 4KAPA 3S73B 4QJMA 4BF1A 2NWZA 4L5VA 5SZ5A 5SZ0A 4YGJA 1HCAA 3M67A 3KONA 4XIWA 1AZMA 3DCCA 1CNKA 4R59A 4PXXA 2Q38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KP8 A;  4HT0 A;  1HVA A;  5E5U A;  2H15 A;  5FL5 A;  2O4Z A;  1ZSA A;  5E28 A;  3MMF A;  3KLD B;  1F2W A;  4JSZ A;  4KUY A;  4HF3 A;  4M2R A;  5BYI A;  1ZFQ A;  1H9Q A;  3M40 A;  5SZ6 A;  4MDG A;  5DRS A;  3OYQ A;  4XE1 A;  1CCS A;  1RAZ A;  3N0N A;  3P44 A;  4QY3 A;  5FLP A;  2CAB A;  3BL1 A;  1ZFK A;  1LUG A;  5FDI A;  4RN4 A;  5DSI A;  1MUA A;  1CVB A;  4MLT A;  1CAO A;  3M2Y A;  3S77 B;  4XFW A;  5EH8 A;  3RYZ A;  1IF7 A;  3JXG A;  3V3F A;  3FFP X;  4MO8 A;  4Q83 A;  1CNC A;  2OSF A;  3RZ1 B;  2NXR A;  1YO2 A;  1ZSC A;  4RUY A;  5FNK A;  3PO6 A;  4K0Z A;  1TG3 A;  2NXT A;  1CCU A;  5SZ1 A;  5DSR A;  4BF6 A;  3U3A X;  3BET A;  3LXE A;  4Y0J A;  2NMX A;  3RYY A;  7CA2 A;  4Q8X A;  1I90 A;  1LG6 A;  3CZV A;  3PJJ A;  3RZ0 B;  2NNS A;  5CAC A;  4FPT A;  4YX4 A;  4PYY A;  4ITO A;  4Q7P A;  4YYT A;  4KNN A;  3OKU A;  3S72 B;  4WW6 A;  5SZ2 A;  3MWO A;  1BCD A;  3P5A A;  3W6I A;  2X7T A;  4IWZ A;  2Q1Q A;  4CNR A;  4R5B A;  3T82 A;  4CQ0 A;  4ZX1 A;  3MNH A;  5FLO A;  2ABE A;  2X7U A;  4E9O X;  5SZ7 A;  3S74 B;  1IF5 A;  1I9L A;  3RYV B;  4JSS A;  5EHV A;  4ZWY A;  5SZ3 A;  4ZWI A;  4E3D A;  3MYQ A;  5E2K A;  2QP6 A;  1DCB A;  1KWQ A;  4HU1 A;  3V3I B;  3DCS A;  4MTY A;  4KV0 A;  3DD0 A;  3CYU A;  3MHI A;  6CA2 A;  3P58 A;  3RYX B;  4COQ A;  2POV A;  5EKH A;  5DSO A;  5CLU A;  5G0C A;  2W2J A;  5FLS A;  4KUV A;  3T85 A;  1Z97 A;  4WW8 A;  2HFW A;  4BCW A;  3DA2 A;  1CNB A;  1FQR A;  3MNI A;  4Q9Y A;  4Z0Q A;  3RJ7 A;  1TBT X;  1IF8 A;  5DSQ A;  3DBU A;  4Q90 A;  3HLJ A;  1TEQ X;  5AMG A;  1YO1 A;  3V5G A;  3DV7 A;  1G45 A;  3KKX A;  1BNW A;  1UGF A;  3K34 A;  1CAH A;  1KWR A;  1RJ5 A;  4LHI A;  2GD8 A;  4YWP A;  3Q31 A;  1G3Z A;  1XQ0 A;  3M04 A;  1CA2 A;  1YDB A;  4E3H A;  4YGL A;  1BNN A;  4WUQ A;  1LGD A;  3DVB A;  1I9N A;  3IBI A;  4TWM A;  3HKQ A;  4Q8Z A;  3TVO X;  1BN1 A;  4E49 A;  3C7P A;  4XZ5 A;  2EZ7 A;  4CA2 A;  3ZP9 A;  2FOU A;  3ZNC A;  4DZ9 A;  1HED A;  1MOO A;  2OSM A;  1G1D A;  4K1Q A;  1URT A;  3F4X A;  4JSW A;  3QYK A;  3DAZ A;  3S75 B;  3HFP A;  4K13 A;  1CRA A;  1FQM A;  1OKN A;  4HBA A;  5DVX A;  1CVA A;  2HNC A;  5AML A;  5JQT A;  1RZB A;  4C3T A;  3B4F A;  3IBU A;  3UYN A;  4Q0L A;  1J9W A;  4Q6E A;  3RG3 A;  5FDC A;  3S76 A;  1Z93 A;  1CAL A;  1HEB A;  1KOQ A;  4MDL A;  2QOA A;  4HT2 A;  4YGN A;  5DOH A;  2ZNC A;  5JEP B;  1CNI A;  4XIX A;  5AMD A;  1IF4 A;  4Q87 A;  4QIZ A;  3RLD A;  5E2N A;  1XEV A;  4Z1E A;  1G4O A;  1RAY A;  5JDV B;  1DMY A;  3HS4 A;  3VBD A;  4QSJ A;  2IT4 A;  1CNW A;  4Q06 A;  4LU3 A;  4JS6 A;  3IGP A;  4ETQ C;  3CAJ A;  1CAN A;  1I91 A;  2AX2 A;  1BV3 A;  4Q7S A;  1ZGE A;  1TTM A;  1CNG A;  1V9I C;  1CNH A;  1HUG A;  1LZV A;  2FOS A;  2FNK A;  3IBN A;  5DSJ A;  3RZ7 A;  3EFI A;  2FNN A;  1G0F A;  1ZSB A;  4K0T A;  1DCA A;  1TE3 X;  4QJO A;  4YGF A;  4QK3 A;  3P5L A;  1BN3 A;  4QJ0 A;  1CRM A;  4HEZ A;  5CJF A;  3P3J A;  2HKK A;  1CNX A;  3PYK A;  1CCT A;  1I8Z A;  5FNG A;  4E5Q A;  4MDM A;  3GZ0 A;  4QK1 A;  3M5E A;  2WD3 A;  1CZM A;  4KUW A;  5A25 A;  1YDC A;  9CA2 A;  3FE4 A;  4QSA A;  2NNG A;  1JCZ A;  1UGD A;  1EOU A;  1ZE8 A;  4K0S A;  3DVC A;  4X5S A;  1TG9 A;  2CBD A;  4HEW A;  5EH7 A;  5E2S A;  3DVD A;  4QJW A;  3B1B A;  2NNO A;  5FNL A;  4KNM A;  4QJX A;  5DSP A;  1G0E A;  2H4N A;  2HL4 A;  3M1W A;  1TH9 A;  3U7C A;  3N4B A;  3MNA A;  4R5A A;  3S97 A;  3N3J A;  3OIK A;  4YXI A;  3T83 A;  4PZH A;  3R17 B;  2NN1 A;  2NWP A;  4RUX A;  3M2N A;  3MNK A;  3TVN X;  3DD8 A;  5EHW A;  4DZ7 A;  3SBI A;  2CA2 A;  3EFT A;  3RZ8 A;  1ZGF A;  3T5Z A;  5C8I A;  1Y7W A;  3OYS A;  1UGB A;  3OIL A;  5FNH A;  2HOC A;  5EOI A;  5FLT A;  3P55 A;  4M2U A;  1UGA A;  2POU A;  2X7S A;  4G7A A;  3W6H A;  1CAJ A;  1CAY A;  4FL7 A;  1AM6 A;  1CVE A;  2FMZ A;  3D0N A;  1CVC A;  4L5U A;  1RZE A;  4CNX A;  3IBL A;  4Q08 A;  3S78 B;  1BIC A;  1BZM A;  5EIJ A;  1XEG A;  3JXF A;  1OKM A;  4Z1J A;  2HD6 A;  5EKJ A;  1ZNC A;  1CVF A;  3F8E A;  2NWY A;  1RZC A;  3MHL A;  1G46 A;  1OKL A;  5BRV A;  2FOV A;  4CNW A;  1RZD A;  1IF9 A;  3OIM A;  3OKV A;  3UYQ A;  3D93 A;  2CBB A;  5BRW A;  1FSR A;  2QO8 A;  1Z9Y A;  1V9E A;  1UGG A;  4G0C A;  4LP6 A;  5LMD A;  4YXU A;  4MLX A;  1I9M A;  3F7U A;  5CA2 A;  3S71 B;  3V2J A;  3V7X A;  3T84 A;  3M2Z A;  4KNJ A;  1FQL A;  4M2W A;  2AW1 A;  3D8W A;  1H4N A;  4Q7W A;  3V3H B;  4Q6D A;  4PYX A;  5JEG B;  2NWO A;  5FLQ A;  5EH5 A;  4RUZ A;  1HEA A;  3OY0 A;  5EZT X;  3KOK A;  3JXH C;  3F7B A;  1I9O A;  3MHO A;  3P4V A;  2EU3 A;  12CA A;  1FLJ A;  4M2V A;  4Z1N A;  1CAI A;  4RFC A;  2VVA X;  1CNJ A;  1FR7 A;  4Q07 A;  5FL6 A;  4HEY A;  4QSI A;  1CIL A;  1I9P A;  3S8X A;  1G48 A;  1CIM A;  4N16 A;  1CVH A;  5JGT B;  3KOI A;  3MHC A;  5E2R A;  4RFD A;  5BRU A;  1BNQ A;  1ZH9 A;  3BL0 A;  2Q1B A;  3V2M A;  4ZX0 A;  3M96 A;  2WEG A;  5L3O A;  1FR4 A;  5DOG A;  1YDD A;  3M3X A;  4UOV A;  5JES B;  5EHE A;  1UGE A;  3NJ9 A;  5DSK A;  5BNL A;  3V3J A;  3DC3 A;  4QEF A;  2WEO A;  3U45 X;  2ILI A;  4Q49 A;  1G4J A;  3P3H A;  2CBE A;  4Q7V A;  1CA3 A;  3RGE A;  3TMJ A;  4L5W A;  4Q81 A;  2CBC A;  5EKM A;  3RYJ B;  1BNV A;  1A42 A;  3KNE A;  4IDR X;  4CNV A;  4RIV A;  3V3G B;  3HKU A;  5IPZ A;  4QIY A;  4GL1 X;  4KNI A;  1BN4 A;  1DMX A;  2WEH A;  5G01 A;  2CBA A;  1CAK A;  4FU5 A;  3MNU A;  3D92 A;  4WUP A;  4ZWX A;  1YO0 A;  3M98 A;  1HCB A;  4Q99 A;  4Z1K A;  4QK2 A;  5FNJ A;  3ML5 A;  3L14 A;  4E3G A;  2FMG A;  4FVO A;  8CA2 A;  3M14 A;  5FL4 A;  3MDZ A;  5L6K A;  3RZ5 A;  1CVD A;  5G03 A;  4FRC A;  3D9Z A;  3HKT A;  1FQN A;  4Q78 A;  4QTL A;  3KIG A;  3ML2 A;  1XPZ A;  3M1K A;  5E2M A;  3SBH A;  1RJ6 A;  1KEQ A;  4YVY A;  2NN7 A;  2WD2 A;  5SZ4 A;  1UGC A;  1THK A;  3NI5 A;  4WL4 A;  3SAP A;  1AVN A;  4QJP A;  4TWL A;  3U47 A;  3DC9 A;  4PQ7 A;  5JEH B;  2VVB X;  3M5S A;  4FIK A;  1CAZ A;  4FVN A;  1FSQ A;  4Q09 A;  5DSN A;  1CAM A;  1CIN A;  3RG4 A;  3R16 A;  5J8Z A;  1BNM A;  1G53 A;  3N2P A;  2NNV A;  1CNY A;  5FLR A;  1BNT A;  3M5T A;  2FOY A;  3DCW A;  4KP5 A;  3KWA A;  4E4A A;  3T5U A;  1FSN A;  5JQ0 A;  3CA2 A;  3MNJ A;  4RIU A;  4ILX A;  1KOP A;  1T9N A;  5JG5 B;  3HKN A;  2WEJ A;  5A6H A;  1HUH A;  1BNU A;  2FOQ A;  3K7K A;  3M1Q A;  2F14 A;  1TB0 X;  1TEU X;  1I9Q A;  5G0B A;  3KS3 A;  3NB5 A;  4ZWZ A;  3M1J A;  4YHA A;  4YGK A;  4CAC A;  1JV0 A;  1RZA A;  3MHM A;  5DSM A;  3IEO A;  5FNI A;  4Q8Y A;  3MZC A;  1YDA A;  1LG5 A;  1G54 A;  2GEH A;  4E3F A;  2NXS A;  2FNM A;  5HPJ A;  5JG3 B;  1G52 A;  1G6V A;  5E5R A;  2FW4 A;  4YXO A;  3IAI A;  3K2F A;  1JD0 A;  4ITP A;  4WR7 A;  2EU2 A;  4QSB A;  3FW3 A;  2POW A;  5FNM A;  4N0X B;  5JGS B;  3M2X A;  1HEC A;  4JSA A;  4RH2 A;  4ZAO A;  3SAX A;  1H9N A;  1IF6 A;  3S9T A;  1OQ5 A;  5DSL A;  4KAP A;  3S73 B;  4QJM A;  4BF1 A;  2NWZ A;  4L5V A;  5SZ5 A;  5SZ0 A;  4YGJ A;  1HCA A;  3M67 A;  3KON A;  4XIW A;  1AZM A;  3DCC A;  1CNK A;  4R59 A;  4PXX A;  2Q38 A; 
#chains in the Genus database with same CATH topology
 4KP8 A;  4HT0 A;  1HVA A;  5E5U A;  2H15 A;  5FL5 A;  2O4Z A;  1ZSA A;  5E28 A;  3MMF A;  3KLD B;  1F2W A;  4JSZ A;  4KUY A;  4HF3 A;  4M2R A;  5BYI A;  1ZFQ A;  1H9Q A;  3M40 A;  5SZ6 A;  4MDG A;  5DRS A;  3OYQ A;  4XE1 A;  1CCS A;  1RAZ A;  3N0N A;  3P44 A;  4QY3 A;  5FLP A;  2CAB A;  3BL1 A;  1ZFK A;  1LUG A;  5FDI A;  4RN4 A;  5DSI A;  1MUA A;  1CVB A;  4MLT A;  1CAO A;  3M2Y A;  3S77 B;  4XFW A;  5EH8 A;  3RYZ A;  1IF7 A;  3JXG A;  3V3F A;  3FFP X;  4MO8 A;  4Q83 A;  1CNC A;  2OSF A;  3RZ1 B;  2NXR A;  1YO2 A;  1ZSC A;  4RUY A;  5FNK A;  3PO6 A;  4K0Z A;  1TG3 A;  2NXT A;  1CCU A;  5SZ1 A;  5DSR A;  4BF6 A;  3U3A X;  3BET A;  3LXE A;  4Y0J A;  2NMX A;  3RYY A;  7CA2 A;  4Q8X A;  1I90 A;  1LG6 A;  3CZV A;  3PJJ A;  3RZ0 B;  2NNS A;  5CAC A;  4FPT A;  4YX4 A;  4PYY A;  4ITO A;  4Q7P A;  4YYT A;  4KNN A;  3OKU A;  3S72 B;  4WW6 A;  5SZ2 A;  3MWO A;  1BCD A;  3P5A A;  3W6I A;  2X7T A;  4IWZ A;  2Q1Q A;  4CNR A;  4R5B A;  3T82 A;  4CQ0 A;  4ZX1 A;  3MNH A;  5FLO A;  2ABE A;  2X7U A;  4E9O X;  5SZ7 A;  3S74 B;  1IF5 A;  1I9L A;  3RYV B;  4JSS A;  5EHV A;  4ZWY A;  5SZ3 A;  4ZWI A;  4E3D A;  3MYQ A;  5E2K A;  2QP6 A;  1DCB A;  1KWQ A;  4HU1 A;  3V3I B;  3DCS A;  4MTY A;  4KV0 A;  3DD0 A;  3CYU A;  3MHI A;  6CA2 A;  3P58 A;  3RYX B;  4COQ A;  2POV A;  5EKH A;  5DSO A;  5CLU A;  5G0C A;  2W2J A;  5FLS A;  4KUV A;  3T85 A;  1Z97 A;  4WW8 A;  2HFW A;  4BCW A;  3DA2 A;  1CNB A;  1FQR A;  3MNI A;  4Q9Y A;  4Z0Q A;  3RJ7 A;  1TBT X;  1IF8 A;  5DSQ A;  3DBU A;  4Q90 A;  3HLJ A;  1TEQ X;  5AMG A;  1YO1 A;  3V5G A;  3DV7 A;  1G45 A;  3KKX A;  1BNW A;  1UGF A;  3K34 A;  1CAH A;  1KWR A;  1RJ5 A;  4LHI A;  2GD8 A;  4YWP A;  3Q31 A;  1G3Z A;  1XQ0 A;  3M04 A;  1CA2 A;  1YDB A;  4E3H A;  4YGL A;  1BNN A;  4WUQ A;  1LGD A;  3DVB A;  1I9N A;  3IBI A;  4TWM A;  3HKQ A;  4Q8Z A;  3TVO X;  1BN1 A;  4E49 A;  3C7P A;  4XZ5 A;  2EZ7 A;  4CA2 A;  3ZP9 A;  2FOU A;  3ZNC A;  4DZ9 A;  1HED A;  1MOO A;  2OSM A;  1G1D A;  4K1Q A;  1URT A;  3F4X A;  4JSW A;  3QYK A;  3DAZ A;  3S75 B;  3HFP A;  4K13 A;  1CRA A;  1FQM A;  1OKN A;  4HBA A;  5DVX A;  1CVA A;  2HNC A;  5AML A;  5JQT A;  1RZB A;  4C3T A;  3B4F A;  3IBU A;  3UYN A;  4Q0L A;  1J9W A;  4Q6E A;  3RG3 A;  5FDC A;  3S76 A;  1Z93 A;  1CAL A;  1HEB A;  1KOQ A;  4MDL A;  2QOA A;  4HT2 A;  4YGN A;  5DOH A;  2ZNC A;  5JEP B;  1CNI A;  4XIX A;  5AMD A;  1IF4 A;  4Q87 A;  4QIZ A;  3RLD A;  5E2N A;  1XEV A;  4Z1E A;  1G4O A;  1RAY A;  5JDV B;  1DMY A;  3HS4 A;  3VBD A;  4QSJ A;  2IT4 A;  1CNW A;  4Q06 A;  4LU3 A;  4JS6 A;  3IGP A;  4ETQ C;  3CAJ A;  1CAN A;  1I91 A;  2AX2 A;  1BV3 A;  4Q7S A;  1ZGE A;  1TTM A;  1CNG A;  1V9I C;  1CNH A;  1HUG A;  1LZV A;  2FOS A;  2FNK A;  3IBN A;  5DSJ A;  3RZ7 A;  3EFI A;  2FNN A;  1G0F A;  1ZSB A;  4K0T A;  1DCA A;  1TE3 X;  4QJO A;  4YGF A;  4QK3 A;  3P5L A;  1BN3 A;  4QJ0 A;  1CRM A;  4HEZ A;  5CJF A;  3P3J A;  2HKK A;  1CNX A;  3PYK A;  1CCT A;  1I8Z A;  5FNG A;  4E5Q A;  4MDM A;  3GZ0 A;  4QK1 A;  3M5E A;  2WD3 A;  1CZM A;  4KUW A;  5A25 A;  1YDC A;  9CA2 A;  3FE4 A;  4QSA A;  2NNG A;  1JCZ A;  1UGD A;  1EOU A;  1ZE8 A;  4K0S A;  3DVC A;  4X5S A;  1TG9 A;  2CBD A;  4HEW A;  5EH7 A;  5E2S A;  3DVD A;  4QJW A;  3B1B A;  2NNO A;  5FNL A;  4KNM A;  4QJX A;  5DSP A;  1G0E A;  2H4N A;  2HL4 A;  3M1W A;  1TH9 A;  3U7C A;  3N4B A;  3MNA A;  4R5A A;  3S97 A;  3N3J A;  3OIK A;  4YXI A;  3T83 A;  4PZH A;  3R17 B;  2NN1 A;  2NWP A;  4RUX A;  3M2N A;  3MNK A;  3TVN X;  3DD8 A;  5EHW A;  4DZ7 A;  3SBI A;  2CA2 A;  3EFT A;  3RZ8 A;  1ZGF A;  3T5Z A;  5C8I A;  1Y7W A;  3OYS A;  1UGB A;  3OIL A;  5FNH A;  2HOC A;  5EOI A;  5FLT A;  3P55 A;  4M2U A;  1UGA A;  2POU A;  2X7S A;  4G7A A;  3W6H A;  1CAJ A;  1CAY A;  4FL7 A;  1AM6 A;  1CVE A;  2FMZ A;  3D0N A;  1CVC A;  4L5U A;  1RZE A;  4CNX A;  3IBL A;  4Q08 A;  3S78 B;  1BIC A;  1BZM A;  5EIJ A;  1XEG A;  3JXF A;  1OKM A;  4Z1J A;  2HD6 A;  5EKJ A;  1ZNC A;  1CVF A;  3F8E A;  2NWY A;  1RZC A;  3MHL A;  1G46 A;  1OKL A;  5BRV A;  2FOV A;  4CNW A;  1RZD A;  1IF9 A;  3OIM A;  3OKV A;  3UYQ A;  3D93 A;  2CBB A;  5BRW A;  1FSR A;  2QO8 A;  1Z9Y A;  1V9E A;  1UGG A;  4G0C A;  4LP6 A;  5LMD A;  4YXU A;  4MLX A;  1I9M A;  3F7U A;  5CA2 A;  3S71 B;  3V2J A;  3V7X A;  3T84 A;  3M2Z A;  4KNJ A;  1FQL A;  4M2W A;  2AW1 A;  3D8W A;  1H4N A;  4Q7W A;  3V3H B;  4Q6D A;  4PYX A;  5JEG B;  2NWO A;  5FLQ A;  5EH5 A;  4RUZ A;  1HEA A;  3OY0 A;  5EZT X;  3KOK A;  3JXH C;  3F7B A;  1I9O A;  3MHO A;  3P4V A;  2EU3 A;  12CA A;  1FLJ A;  4M2V A;  4Z1N A;  1CAI A;  4RFC A;  2VVA X;  1CNJ A;  1FR7 A;  4Q07 A;  5FL6 A;  4HEY A;  4QSI A;  1CIL A;  1I9P A;  3S8X A;  1G48 A;  1CIM A;  4N16 A;  1CVH A;  5JGT B;  3KOI A;  3MHC A;  5E2R A;  4RFD A;  5BRU A;  1BNQ A;  1ZH9 A;  3BL0 A;  2Q1B A;  3V2M A;  4ZX0 A;  3M96 A;  2WEG A;  5L3O A;  1FR4 A;  5DOG A;  1YDD A;  3M3X A;  4UOV A;  5JES B;  5EHE A;  1UGE A;  3NJ9 A;  5DSK A;  5BNL A;  3V3J A;  3DC3 A;  4QEF A;  2WEO A;  3U45 X;  2ILI A;  4Q49 A;  1G4J A;  3P3H A;  2CBE A;  4Q7V A;  1CA3 A;  3RGE A;  3TMJ A;  4L5W A;  4Q81 A;  2CBC A;  5EKM A;  3RYJ B;  1BNV A;  1A42 A;  3KNE A;  4IDR X;  4CNV A;  4RIV A;  3V3G B;  3HKU A;  5IPZ A;  4QIY A;  4GL1 X;  4KNI A;  1BN4 A;  1DMX A;  2WEH A;  5G01 A;  2CBA A;  1CAK A;  4FU5 A;  3MNU A;  3D92 A;  4WUP A;  4ZWX A;  1YO0 A;  3M98 A;  1HCB A;  4Q99 A;  4Z1K A;  4QK2 A;  5FNJ A;  3ML5 A;  3L14 A;  4E3G A;  2FMG A;  4FVO A;  8CA2 A;  3M14 A;  5FL4 A;  3MDZ A;  5L6K A;  3RZ5 A;  1CVD A;  5G03 A;  4FRC A;  3D9Z A;  3HKT A;  1FQN A;  4Q78 A;  4QTL A;  3KIG A;  3ML2 A;  1XPZ A;  3M1K A;  5E2M A;  3SBH A;  1RJ6 A;  1KEQ A;  4YVY A;  2NN7 A;  2WD2 A;  5SZ4 A;  1UGC A;  1THK A;  3NI5 A;  4WL4 A;  3SAP A;  1AVN A;  4QJP A;  4TWL A;  3U47 A;  3DC9 A;  4PQ7 A;  5JEH B;  2VVB X;  3M5S A;  4FIK A;  1CAZ A;  4FVN A;  1FSQ A;  4Q09 A;  5DSN A;  1CAM A;  1CIN A;  3RG4 A;  3R16 A;  5J8Z A;  1BNM A;  1G53 A;  3N2P A;  2NNV A;  1CNY A;  5FLR A;  1BNT A;  3M5T A;  2FOY A;  3DCW A;  4KP5 A;  3KWA A;  4E4A A;  3T5U A;  1FSN A;  5JQ0 A;  3CA2 A;  3MNJ A;  4RIU A;  4ILX A;  1KOP A;  1T9N A;  5JG5 B;  3HKN A;  2WEJ A;  5A6H A;  1HUH A;  1BNU A;  2FOQ A;  3K7K A;  3M1Q A;  2F14 A;  1TB0 X;  1TEU X;  1I9Q A;  5G0B A;  3KS3 A;  3NB5 A;  4ZWZ A;  3M1J A;  4YHA A;  4YGK A;  4CAC A;  1JV0 A;  1RZA A;  3MHM A;  5DSM A;  3IEO A;  5FNI A;  4Q8Y A;  3MZC A;  1YDA A;  1LG5 A;  1G54 A;  2GEH A;  4E3F A;  2NXS A;  2FNM A;  5HPJ A;  5JG3 B;  1G52 A;  1G6V A;  5E5R A;  2FW4 A;  4YXO A;  3IAI A;  3K2F A;  1JD0 A;  4ITP A;  4WR7 A;  2EU2 A;  4QSB A;  3FW3 A;  2POW A;  5FNM A;  4N0X B;  5JGS B;  3M2X A;  1HEC A;  4JSA A;  4RH2 A;  4ZAO A;  3SAX A;  1H9N A;  1IF6 A;  3S9T A;  1OQ5 A;  5DSL A;  4KAP A;  3S73 B;  4QJM A;  4BF1 A;  2NWZ A;  4L5V A;  5SZ5 A;  5SZ0 A;  4YGJ A;  1HCA A;  3M67 A;  3KON A;  4XIW A;  1AZM A;  3DCC A;  1CNK A;  4R59 A;  4PXX A;  2Q38 A; 
#chains in the Genus database with same CATH homology
 4KP8 A;  4HT0 A;  1HVA A;  5E5U A;  2H15 A;  5FL5 A;  2O4Z A;  1ZSA A;  5E28 A;  3MMF A;  3KLD B;  1F2W A;  4JSZ A;  4KUY A;  4HF3 A;  4M2R A;  5BYI A;  1ZFQ A;  1H9Q A;  3M40 A;  5SZ6 A;  4MDG A;  5DRS A;  3OYQ A;  4XE1 A;  1CCS A;  1RAZ A;  3N0N A;  3P44 A;  4QY3 A;  5FLP A;  2CAB A;  3BL1 A;  1ZFK A;  1LUG A;  5FDI A;  4RN4 A;  5DSI A;  1MUA A;  1CVB A;  4MLT A;  1CAO A;  3M2Y A;  3S77 B;  4XFW A;  5EH8 A;  3RYZ A;  1IF7 A;  3JXG A;  3V3F A;  3FFP X;  4MO8 A;  4Q83 A;  1CNC A;  2OSF A;  3RZ1 B;  2NXR A;  1YO2 A;  1ZSC A;  4RUY A;  5FNK A;  3PO6 A;  4K0Z A;  1TG3 A;  2NXT A;  1CCU A;  5SZ1 A;  5DSR A;  4BF6 A;  3U3A X;  3BET A;  3LXE A;  4Y0J A;  2NMX A;  3RYY A;  7CA2 A;  4Q8X A;  1I90 A;  1LG6 A;  3CZV A;  3PJJ A;  3RZ0 B;  2NNS A;  5CAC A;  4FPT A;  4YX4 A;  4PYY A;  4ITO A;  4Q7P A;  4YYT A;  4KNN A;  3OKU A;  3S72 B;  4WW6 A;  5SZ2 A;  3MWO A;  1BCD A;  3P5A A;  3W6I A;  2X7T A;  4IWZ A;  2Q1Q A;  4CNR A;  4R5B A;  3T82 A;  4CQ0 A;  4ZX1 A;  3MNH A;  5FLO A;  2ABE A;  2X7U A;  4E9O X;  5SZ7 A;  3S74 B;  1IF5 A;  1I9L A;  3RYV B;  4JSS A;  5EHV A;  4ZWY A;  5SZ3 A;  4ZWI A;  4E3D A;  3MYQ A;  5E2K A;  2QP6 A;  1DCB A;  1KWQ A;  4HU1 A;  3V3I B;  3DCS A;  4MTY A;  4KV0 A;  3DD0 A;  3CYU A;  3MHI A;  6CA2 A;  3P58 A;  3RYX B;  4COQ A;  2POV A;  5EKH A;  5DSO A;  5CLU A;  5G0C A;  2W2J A;  5FLS A;  4KUV A;  3T85 A;  1Z97 A;  4WW8 A;  2HFW A;  4BCW A;  3DA2 A;  1CNB A;  1FQR A;  3MNI A;  4Q9Y A;  4Z0Q A;  3RJ7 A;  1TBT X;  1IF8 A;  5DSQ A;  3DBU A;  4Q90 A;  3HLJ A;  1TEQ X;  5AMG A;  1YO1 A;  3V5G A;  3DV7 A;  1G45 A;  3KKX A;  1BNW A;  1UGF A;  3K34 A;  1CAH A;  1KWR A;  1RJ5 A;  4LHI A;  2GD8 A;  4YWP A;  3Q31 A;  1G3Z A;  1XQ0 A;  3M04 A;  1CA2 A;  1YDB A;  4E3H A;  4YGL A;  1BNN A;  4WUQ A;  1LGD A;  3DVB A;  1I9N A;  3IBI A;  4TWM A;  3HKQ A;  4Q8Z A;  3TVO X;  1BN1 A;  4E49 A;  3C7P A;  4XZ5 A;  2EZ7 A;  4CA2 A;  3ZP9 A;  2FOU A;  3ZNC A;  4DZ9 A;  1HED A;  1MOO A;  2OSM A;  1G1D A;  4K1Q A;  1URT A;  3F4X A;  4JSW A;  3QYK A;  3DAZ A;  3S75 B;  3HFP A;  4K13 A;  1CRA A;  1FQM A;  1OKN A;  4HBA A;  5DVX A;  1CVA A;  2HNC A;  5AML A;  5JQT A;  1RZB A;  4C3T A;  3B4F A;  3IBU A;  3UYN A;  4Q0L A;  1J9W A;  4Q6E A;  3RG3 A;  5FDC A;  3S76 A;  1Z93 A;  1CAL A;  1HEB A;  1KOQ A;  4MDL A;  2QOA A;  4HT2 A;  4YGN A;  5DOH A;  2ZNC A;  5JEP B;  1CNI A;  4XIX A;  5AMD A;  1IF4 A;  4Q87 A;  4QIZ A;  3RLD A;  5E2N A;  1XEV A;  4Z1E A;  1G4O A;  1RAY A;  5JDV B;  1DMY A;  3HS4 A;  3VBD A;  4QSJ A;  2IT4 A;  1CNW A;  4Q06 A;  4LU3 A;  4JS6 A;  3IGP A;  4ETQ C;  3CAJ A;  1CAN A;  1I91 A;  2AX2 A;  1BV3 A;  4Q7S A;  1ZGE A;  1TTM A;  1CNG A;  1V9I C;  1CNH A;  1HUG A;  1LZV A;  2FOS A;  2FNK A;  3IBN A;  5DSJ A;  3RZ7 A;  3EFI A;  2FNN A;  1G0F A;  1ZSB A;  4K0T A;  1DCA A;  1TE3 X;  4QJO A;  4YGF A;  4QK3 A;  3P5L A;  1BN3 A;  4QJ0 A;  1CRM A;  4HEZ A;  5CJF A;  3P3J A;  2HKK A;  1CNX A;  3PYK A;  1CCT A;  1I8Z A;  5FNG A;  4E5Q A;  4MDM A;  3GZ0 A;  4QK1 A;  3M5E A;  2WD3 A;  1CZM A;  4KUW A;  5A25 A;  1YDC A;  9CA2 A;  3FE4 A;  4QSA A;  2NNG A;  1JCZ A;  1UGD A;  1EOU A;  1ZE8 A;  4K0S A;  3DVC A;  4X5S A;  1TG9 A;  2CBD A;  4HEW A;  5EH7 A;  5E2S A;  3DVD A;  4QJW A;  3B1B A;  2NNO A;  5FNL A;  4KNM A;  4QJX A;  5DSP A;  1G0E A;  2H4N A;  2HL4 A;  3M1W A;  1TH9 A;  3U7C A;  3N4B A;  3MNA A;  4R5A A;  3S97 A;  3N3J A;  3OIK A;  4YXI A;  3T83 A;  4PZH A;  3R17 B;  2NN1 A;  2NWP A;  4RUX A;  3M2N A;  3MNK A;  3TVN X;  3DD8 A;  5EHW A;  4DZ7 A;  3SBI A;  2CA2 A;  3EFT A;  3RZ8 A;  1ZGF A;  3T5Z A;  5C8I A;  1Y7W A;  3OYS A;  1UGB A;  3OIL A;  5FNH A;  2HOC A;  5EOI A;  5FLT A;  3P55 A;  4M2U A;  1UGA A;  2POU A;  2X7S A;  4G7A A;  3W6H A;  1CAJ A;  1CAY A;  4FL7 A;  1AM6 A;  1CVE A;  2FMZ A;  3D0N A;  1CVC A;  4L5U A;  1RZE A;  4CNX A;  3IBL A;  4Q08 A;  3S78 B;  1BIC A;  1BZM A;  5EIJ A;  1XEG A;  3JXF A;  1OKM A;  4Z1J A;  2HD6 A;  5EKJ A;  1ZNC A;  1CVF A;  3F8E A;  2NWY A;  1RZC A;  3MHL A;  1G46 A;  1OKL A;  5BRV A;  2FOV A;  4CNW A;  1RZD A;  1IF9 A;  3OIM A;  3OKV A;  3UYQ A;  3D93 A;  2CBB A;  5BRW A;  1FSR A;  2QO8 A;  1Z9Y A;  1V9E A;  1UGG A;  4G0C A;  4LP6 A;  5LMD A;  4YXU A;  4MLX A;  1I9M A;  3F7U A;  5CA2 A;  3S71 B;  3V2J A;  3V7X A;  3T84 A;  3M2Z A;  4KNJ A;  1FQL A;  4M2W A;  2AW1 A;  3D8W A;  1H4N A;  4Q7W A;  3V3H B;  4Q6D A;  4PYX A;  5JEG B;  2NWO A;  5FLQ A;  5EH5 A;  4RUZ A;  1HEA A;  3OY0 A;  5EZT X;  3KOK A;  3JXH C;  3F7B A;  1I9O A;  3MHO A;  3P4V A;  2EU3 A;  12CA A;  1FLJ A;  4M2V A;  4Z1N A;  1CAI A;  4RFC A;  2VVA X;  1CNJ A;  1FR7 A;  4Q07 A;  5FL6 A;  4HEY A;  4QSI A;  1CIL A;  1I9P A;  3S8X A;  1G48 A;  1CIM A;  4N16 A;  1CVH A;  5JGT B;  3KOI A;  3MHC A;  5E2R A;  4RFD A;  5BRU A;  1BNQ A;  1ZH9 A;  3BL0 A;  2Q1B A;  3V2M A;  4ZX0 A;  3M96 A;  2WEG A;  5L3O A;  1FR4 A;  5DOG A;  1YDD A;  3M3X A;  4UOV A;  5JES B;  5EHE A;  1UGE A;  3NJ9 A;  5DSK A;  5BNL A;  3V3J A;  3DC3 A;  4QEF A;  2WEO A;  3U45 X;  2ILI A;  4Q49 A;  1G4J A;  3P3H A;  2CBE A;  4Q7V A;  1CA3 A;  3RGE A;  3TMJ A;  4L5W A;  4Q81 A;  2CBC A;  5EKM A;  3RYJ B;  1BNV A;  1A42 A;  3KNE A;  4IDR X;  4CNV A;  4RIV A;  3V3G B;  3HKU A;  5IPZ A;  4QIY A;  4GL1 X;  4KNI A;  1BN4 A;  1DMX A;  2WEH A;  5G01 A;  2CBA A;  1CAK A;  4FU5 A;  3MNU A;  3D92 A;  4WUP A;  4ZWX A;  1YO0 A;  3M98 A;  1HCB A;  4Q99 A;  4Z1K A;  4QK2 A;  5FNJ A;  3ML5 A;  3L14 A;  4E3G A;  2FMG A;  4FVO A;  8CA2 A;  3M14 A;  5FL4 A;  3MDZ A;  5L6K A;  3RZ5 A;  1CVD A;  5G03 A;  4FRC A;  3D9Z A;  3HKT A;  1FQN A;  4Q78 A;  4QTL A;  3KIG A;  3ML2 A;  1XPZ A;  3M1K A;  5E2M A;  3SBH A;  1RJ6 A;  1KEQ A;  4YVY A;  2NN7 A;  2WD2 A;  5SZ4 A;  1UGC A;  1THK A;  3NI5 A;  4WL4 A;  3SAP A;  1AVN A;  4QJP A;  4TWL A;  3U47 A;  3DC9 A;  4PQ7 A;  5JEH B;  2VVB X;  3M5S A;  4FIK A;  1CAZ A;  4FVN A;  1FSQ A;  4Q09 A;  5DSN A;  1CAM A;  1CIN A;  3RG4 A;  3R16 A;  5J8Z A;  1BNM A;  1G53 A;  3N2P A;  2NNV A;  1CNY A;  5FLR A;  1BNT A;  3M5T A;  2FOY A;  3DCW A;  4KP5 A;  3KWA A;  4E4A A;  3T5U A;  1FSN A;  5JQ0 A;  3CA2 A;  3MNJ A;  4RIU A;  4ILX A;  1KOP A;  1T9N A;  5JG5 B;  3HKN A;  2WEJ A;  5A6H A;  1HUH A;  1BNU A;  2FOQ A;  3K7K A;  3M1Q A;  2F14 A;  1TB0 X;  1TEU X;  1I9Q A;  5G0B A;  3KS3 A;  3NB5 A;  4ZWZ A;  3M1J A;  4YHA A;  4YGK A;  4CAC A;  1JV0 A;  1RZA A;  3MHM A;  5DSM A;  3IEO A;  5FNI A;  4Q8Y A;  3MZC A;  1YDA A;  1LG5 A;  1G54 A;  2GEH A;  4E3F A;  2NXS A;  2FNM A;  5HPJ A;  5JG3 B;  1G52 A;  1G6V A;  5E5R A;  2FW4 A;  4YXO A;  3IAI A;  3K2F A;  1JD0 A;  4ITP A;  4WR7 A;  2EU2 A;  4QSB A;  3FW3 A;  2POW A;  5FNM A;  4N0X B;  5JGS B;  3M2X A;  1HEC A;  4JSA A;  4RH2 A;  4ZAO A;  3SAX A;  1H9N A;  1IF6 A;  3S9T A;  1OQ5 A;  5DSL A;  4KAP A;  3S73 B;  4QJM A;  4BF1 A;  2NWZ A;  4L5V A;  5SZ5 A;  5SZ0 A;  4YGJ A;  1HCA A;  3M67 A;  3KON A;  4XIW A;  1AZM A;  3DCC A;  1CNK A;  4R59 A;  4PXX A;  2Q38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...