4V1Aw

Structure of the large subunit of the mammalian mitoribosome, part 2 of 2
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
Knots found
sequence length
387
structure length
387
Chain Sequence
PVARYPPIVASLTAKSKAARQRRVEQWQATVHAAKSVDEKLRILTKMQFMKYVVYPQTFALNADNWYQSFTKTVFLSGLPPTPAKLEPEPTLDITALREAVCDCLLQEHFFLRRKKRAPVIQDREAIASPFLDQLVASLTGLLSVHNPVLAAAALDCKRPVHFFWLRGEEIIPRGHRKGRVDALRYQINDKPHNQIRISRQLPEFVPLDYSIPIEVPVMSCKPDKLPLFKRQYENTIFIGSKTADPLCYGHTQFHLLPDKLKREKLLKQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQGVITDGKYFSFFCYQLNTLALTAQADQNNPRKNICWGTQSKPLYETIEDNNVKGFNDDVLLQLVQFLLNRPKED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
molecule tags Ribosome
molecule keywords MITORIBOSOMAL PROTEIN ML37, MRPL37
total genus 90
structure length 387
sequence length 387
other databases KnotProt 2.0: K -31 -31 -31 -31
ec nomenclature
pdb deposition date 2014-09-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...