4ZWXA

Engineered carbonic anhydrase ix mimic in complex with glucosyl sulfamate inhibitor
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
Knots found
sequence length
257
structure length
257
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVTFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTEGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonic anhydrase 2
publication title Mapping Selective Inhibition of the Cancer-Related Carbonic Anhydrase IX Using Structure-Activity Relationships of Glucosyl-Based Sulfamates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase/lyase inhibitor
total genus 75
structure length 257
sequence length 257
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2015-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 4zwxA00
4QK3A 4WUPA 2FOYA 2FNKA 2QO8A 4YYTA 4QY3A 4XE1A 2W2JA 5FLTA 5FL4A 5DRSA 3DA2A 4E4AA 4YXUA 4QK2A 2ZNCA 1CAYA 3M67A 4YHAA 3MDZA 1ZGFA 3KOKA 1BN1A 6CA2A 5E2NA 1I91A 2WD3A 3N3JA 5JEGB 1RZEA 1RZDA 4FRCA 5FNJA 2NNGA 4E49A 1TG9A 1BICA 4CNXA 4Q6DA 5JQ0A 5CACA 4XZ5A 1CNBA 3T82A 1DCBA 2WEOA 3HKNA 4K0ZA 4Q06A 3MHCA 3DBUA 4BF6A 1OQ5A 3HKUA 4GL1X 1CNKA 3U45X 1CAOA 4Z1NA 1TEQX 2HOCA 1FQRA 3U3AX 4CACA 1OKNA 4TWMA 4Q6EA 3BL1A 4HEZA 1RAZA 4QSIA 2CBBA 4QSJA 4JS6A 4R59A 2EU3A 5BRVA 5G0BA 1DMXA 4M2UA 1I9QA 5L3OA 5BNLA 1CRMA 3D92A 4Q8ZA 1CNIA 4KUVA 5JG5B 3M40A 5FLRA 1ZGEA 4E3GA 3CAJA 4Q7PA 1HCAA 4HU1A 4DZ7A 4E5QA 1TE3X 4Z0QA 3S71B 5L6KA 3RZ0B 1CVBA 3M5EA 3CZVA 4CA2A 1CVDA 5EH5A 1LGDA 12CAA 5FL5A 1J9WA 1OKMA 2VVAX 5CJFA 3RZ8A 1H9NA 1ZH9A 5CLUA 3DC9A 5LMDA 3RLDA 4KAPA 1G4OA 5SZ2A 3M1WA 3MHIA 4ZX1A 3F7UA 4Q09A 5JDVB 5SZ6A 1CILA 5DOHA 3RJ7A 3MHMA 2FW4A 3MMFA 1UGEA 2CA2A 2NXTA 3L14A 3KS3A 3RYXB 3M2ZA 4PYYA 5SZ1A 5FLSA 2OSFA 1I9MA 3MHLA 3PJJA 4E3FA 1BNMA 3FFPX 4FVOA 3TVOX 3DV7A 3ZP9A 5DVXA 1ZSCA 4Q07A 3K7KA 1HEAA 4Q0LA 5E5RA 3DVDA 4YGJA 1CIMA 4ZWIA 5A6HA 3SAPA 3C7PA 1FSQA 4Q7VA 3FE4A 5AMDA 5C8IA 2HKKA 4Q8YA 3M96A 4MTYA 4Q87A 3MYQA 3RG4A 1G45A 4XIWA 4KUYA 4PYXA 1G0EA 3DCSA 3MNUA 3HKQA 4Q99A 4QJPA 5JQTA 3RZ5A 4Q8XA 3DC3A 3JXGA 1I9PA 4HBAA 4YGLA 4Q7SA 1JV0A 1TEUX 1YO0A 1YDCA 2HD6A 4RIVA 1Z93A 2F14A 2NXSA 5SZ7A 1BN4A 5JEHB 3P5LA 3RYZA 4KP8A 3SBHA 1MOOA 1IF5A 1BNQA 1RZAA 1URTA 1Z97A 1DCAA 4LHIA 3SAXA 1UGCA 3M1JA 2NNVA 5IPZA 2Q38A 4QSBA 4Q08A 4MDLA 3B1BA 3F7BA 3MNKA 4RH2A 4RUYA 4MLTA 1CCUA 3IGPA 4Z1EA 2NNSA 1BNVA 5BYIA 1THKA 2POUA 1BNNA 1JCZA 3M1QA 1XEVA 3KIGA 5DSPA 1CCTA 1HUGA 2POVA 2Q1BA 1HEBA 4R5AA 1FR7A 2X7TA 4ZWZA 1AZMA 1IF8A 1HUHA 3ZNCA 4JSWA 8CA2A 2QOAA 1Z9YA 5FNKA 3S76A 3RZ1B 5JEPB 3T84A 3V5GA 4WW8A 5JG3B 3V7XA 3OILA 3M2NA 1FQMA 4HT2A 4ZAOA 4ZWXA 3RZ7A 3RG3A 3P44A 1DMYA 1I9LA 1G52A 5A25A 2HNCA 1CALA 5SZ4A 3D8WA 3M04A 1BZMA 2CBCA 4QJXA 1LG5A 4JSSA 5E28A 4JSZA 5FLPA 4HEYA 1KEQA 1G46A 3OKVA 2NMXA 4WW6A 4COQA 1ZFQA 5E2SA 3EFTA 4L5WA 1CA2A 1RZBA 3QYKA 3P3JA 5BRUA 2AW1A 2HL4A 4YGFA 4G7AA 4KUWA 1CNJA 5EKJA 3S78B 5EKMA 5FL6A 3S97A 5DSLA 3S73B 1FSRA 4JSAA 1AM6A 1BCDA 1CAHA 1FSNA 1ZE8A 1ZSAA 3HS4A 4M2WA 1UGGA 3CA2A 4MO8A 4R5BA 3S74B 3P4VA 4MLXA 1YO2A 5JESB 4HT0A 2H4NA 4KNIA 5EIJA 1I8ZA 2WEGA 1CAIA 4XFWA 1LUGA 2OSMA 1YDBA 1I90A 3B4FA 3OYQA 4RIUA 3BL0A 3U47A 1YDAA 2ABEA 2WEJA 4TWLA 3LXEA 3W6HA 1CAJA 4KV0A 1HCBA 1UGAA 4Q90A 4G0CA 5DSRA 3OY0A 3S72B 4Q83A 1TB0X 5FNIA 1EOUA 1TH9A 1G6VA 5DSOA 3MNAA 5EH7A 1LG6A 4ZWYA 4QEFA 3DVCA 3IBLA 4LP6A 3Q31A 5G03A 1RJ5A 4L5VA 1CVEA 1UGBA 2FNMA 1CVFA 1CRAA 4Q78A 4MDMA 3V3GB 1ZFKA 3M5SA 1V9EA 3T85A 5EZTX 1FQNA 1G0FA 5DSJA 5E2KA 4YGKA 3BETA 4FL7A 3T5UA 2WEHA 3M98A 4Z1JA 5FNGA 4ETQC 4E3DA 3P3HA 1KWRA 4QJMA 5DSKA 1LZVA 3HKTA 4UOVA 1CNYA 5SZ0A 3DVBA 3MZCA 1UGDA 2CBEA 1TBTX 3S9TA 3DD8A 2EZ7A 4CNWA 4FVNA 1UGFA 3OKUA 1Y7WA 1FR4A 3U7CA 5E2MA 5EHWA 4E3HA 4K0SA 1FLJA 2NWOA 3OYSA 4KNNA 4Q81A 3VBDA 5DSQA 2CBDA 1MUAA 4MDGA 5EH8A 3M2YA 2VVBX 5EHVA 1YO1A 5J8ZA 1G4JA 1CZMA 3M2XA 3IBNA 5FLOA 3V2MA 5E5UA 2NWPA 3M1KA 3S77B 4QIZA 5E2RA 1CA3A 5DOGA 4QIYA 3KWAA 3DCWA 4DZ9A 4Z1KA 2O4ZA 3K34A 2NXRA 4HEWA 3MNHA 1I9NA 2ILIA 3N4BA 4ITPA 1RJ6A 1IF4A 3MNJA 1BNUA 1CVAA 1RZCA 5CA2A 4PQ7A 5EHEA 3HLJA 4WL4A 4CNRA 4WUQA 4KNMA 5JGTB 1G53A 1CNGA 2H15A 4ITOA 1KWQA 1BNTA 3UYNA 2X7UA 4WR7A 3OIKA 3F8EA 1FQLA 1T9NA 1CVCA 1JD0A 1ZSBA 4IDRX 5FNMA 3D93A 3P5AA 4RFCA 1HECA 5DSMA 3DAZA 4YX4A 3W6IA 1OKLA 2AX2A 5AMLA 5EKHA 4N16A 1IF9A 4RN4A 2X7SA 5JGSB 3KKXA 4BCWA 2FMGA 3DD0A 2NNOA 4YXIA 5FNLA 3MHOA 1CNHA 4PXXA 3PO6A 1CVHA 4C3TA 3R16A 3R17B 4K0TA 4Q9YA 2EU2A 4KP5A 4FIKA 4QTLA 3M3XA 2NWZA 3JXFA 4QK1A 1TG3A 1V9IC 3NI5A 1XQ0A 5G01A 4RUXA 1G54A 3UYQA 3PYKA 5G0CA 3D0NA 4QSAA 3NB5A 1KOQA 1XEGA 3TVNX 4QJWA 3KOIA 5FNHA 4HF3A 3ML5A 4YGNA 2FOQA 4PZHA 4K13A 1CNCA 4FU5A 4LU3A 1RAYA 1IF7A 1H4NA 1F2WA 1I9OA 3RYYA 1BNWA 2IT4A 4XIXA 2CBAA 4YXOA 2GD8A 4CNVA 4Q7WA 2WD2A 2CABA 1CAKA 4KNJA 2GEHA 3K2FA 3IAIA 3ML2A 3RYJB 3V2JA 4YVYA 3JXHC 3MWOA 3RYVB 2FMZA 1YDDA 3KLDB 1G3ZA 3S75B 4Q49A 4YWPA 1H9QA 5FDCA 1AVNA 5EOIA 3V3IB 5FLQA 4FPTA 3D9ZA 5SZ5A 5DSIA 3N0NA 4ZX0A 5AMGA 3S8XA 2FOVA 3IBIA 1CAMA 1CAZA 2FOUA 2NN1A 3KONA 1XPZA 3OIMA 1A42A 3MNIA 2HFWA 2POWA 4IWZA 9CA2A 1TTMA 4QJOA 4ILXA 2Q1QA 3M14A 3T83A 3V3HB 1CNWA 3IBUA 4RUZA 3M5TA 3DCCA 3NJ9A 4L5UA 4CQ0A 5DSNA 1G1DA 3FW3A 3N2PA 4M2VA 1KOPA 7CA2A 3F4XA 4BF1A 1BN3A 1G48A 5SZ3A 1CCSA 1ZNCA 1BV3A 3RGEA 3P58A 2FOSA 3KNEA 2QP6A 3SBIA 1CINA 4X5SA 1IF6A 2FNNA 1CNXA 4RFDA 4K1QA 4E9OX 3HFPA 5HPJA 1HVAA 4QJ0A 3EFIA 4M2RA 3P55A 3V3JA 3GZ0A 3IEOA 5BRWA 4Y0JA 1CANA 3CYUA 3TMJA 1HEDA 2NWYA 5FDIA 2NN7A 3T5ZA 4N0XB 3V3FA
chains in the Genus database with same CATH superfamily
4QK3A 4WUPA 2FOYA 2FNKA 2QO8A 4YYTA 4QY3A 4XE1A 2W2JA 5FLTA 5FL4A 5DRSA 3DA2A 4E4AA 4YXUA 4QK2A 2ZNCA 1CAYA 3M67A 4YHAA 3MDZA 1ZGFA 3KOKA 1BN1A 6CA2A 5E2NA 1I91A 2WD3A 3N3JA 5JEGB 1RZEA 1RZDA 4FRCA 5FNJA 2NNGA 4E49A 1TG9A 1BICA 4CNXA 4Q6DA 5JQ0A 5CACA 4XZ5A 1CNBA 3T82A 1DCBA 2WEOA 3HKNA 4K0ZA 4Q06A 3MHCA 3DBUA 4BF6A 1OQ5A 3HKUA 4GL1X 1CNKA 3U45X 1CAOA 4Z1NA 1TEQX 2HOCA 1FQRA 3U3AX 4CACA 1OKNA 4TWMA 4Q6EA 3BL1A 4HEZA 1RAZA 4QSIA 2CBBA 4QSJA 4JS6A 4R59A 2EU3A 5BRVA 5G0BA 1DMXA 4M2UA 1I9QA 5L3OA 5BNLA 1CRMA 3D92A 4Q8ZA 1CNIA 4KUVA 5JG5B 3M40A 5FLRA 1ZGEA 4E3GA 3CAJA 4Q7PA 1HCAA 4HU1A 4DZ7A 4E5QA 1TE3X 4Z0QA 3S71B 5L6KA 3RZ0B 1CVBA 3M5EA 3CZVA 4CA2A 1CVDA 5EH5A 1LGDA 12CAA 5FL5A 1J9WA 1OKMA 2VVAX 5CJFA 3RZ8A 1H9NA 1ZH9A 5CLUA 3DC9A 5LMDA 3RLDA 4KAPA 1G4OA 5SZ2A 3M1WA 3MHIA 4ZX1A 3F7UA 4Q09A 5JDVB 5SZ6A 1CILA 5DOHA 3RJ7A 3MHMA 2FW4A 3MMFA 1UGEA 2CA2A 2NXTA 3L14A 3KS3A 3RYXB 3M2ZA 4PYYA 5SZ1A 5FLSA 2OSFA 1I9MA 3MHLA 3PJJA 4E3FA 1BNMA 3FFPX 4FVOA 3TVOX 3DV7A 3ZP9A 5DVXA 1ZSCA 4Q07A 3K7KA 1HEAA 4Q0LA 5E5RA 3DVDA 4YGJA 1CIMA 4ZWIA 5A6HA 3SAPA 3C7PA 1FSQA 4Q7VA 3FE4A 5AMDA 5C8IA 2HKKA 4Q8YA 3M96A 4MTYA 4Q87A 3MYQA 3RG4A 1G45A 4XIWA 4KUYA 4PYXA 1G0EA 3DCSA 3MNUA 3HKQA 4Q99A 4QJPA 5JQTA 3RZ5A 4Q8XA 3DC3A 3JXGA 1I9PA 4HBAA 4YGLA 4Q7SA 1JV0A 1TEUX 1YO0A 1YDCA 2HD6A 4RIVA 1Z93A 2F14A 2NXSA 5SZ7A 1BN4A 5JEHB 3P5LA 3RYZA 4KP8A 3SBHA 1MOOA 1IF5A 1BNQA 1RZAA 1URTA 1Z97A 1DCAA 4LHIA 3SAXA 1UGCA 3M1JA 2NNVA 5IPZA 2Q38A 4QSBA 4Q08A 4MDLA 3B1BA 3F7BA 3MNKA 4RH2A 4RUYA 4MLTA 1CCUA 3IGPA 4Z1EA 2NNSA 1BNVA 5BYIA 1THKA 2POUA 1BNNA 1JCZA 3M1QA 1XEVA 3KIGA 5DSPA 1CCTA 1HUGA 2POVA 2Q1BA 1HEBA 4R5AA 1FR7A 2X7TA 4ZWZA 1AZMA 1IF8A 1HUHA 3ZNCA 4JSWA 8CA2A 2QOAA 1Z9YA 5FNKA 3S76A 3RZ1B 5JEPB 3T84A 3V5GA 4WW8A 5JG3B 3V7XA 3OILA 3M2NA 1FQMA 4HT2A 4ZAOA 4ZWXA 3RZ7A 3RG3A 3P44A 1DMYA 1I9LA 1G52A 5A25A 2HNCA 1CALA 5SZ4A 3D8WA 3M04A 1BZMA 2CBCA 4QJXA 1LG5A 4JSSA 5E28A 4JSZA 5FLPA 4HEYA 1KEQA 1G46A 3OKVA 2NMXA 4WW6A 4COQA 1ZFQA 5E2SA 3EFTA 4L5WA 1CA2A 1RZBA 3QYKA 3P3JA 5BRUA 2AW1A 2HL4A 4YGFA 4G7AA 4KUWA 1CNJA 5EKJA 3S78B 5EKMA 5FL6A 3S97A 5DSLA 3S73B 1FSRA 4JSAA 1AM6A 1BCDA 1CAHA 1FSNA 1ZE8A 1ZSAA 3HS4A 4M2WA 1UGGA 3CA2A 4MO8A 4R5BA 3S74B 3P4VA 4MLXA 1YO2A 5JESB 4HT0A 2H4NA 4KNIA 5EIJA 1I8ZA 2WEGA 1CAIA 4XFWA 1LUGA 2OSMA 1YDBA 1I90A 3B4FA 3OYQA 4RIUA 3BL0A 3U47A 1YDAA 2ABEA 2WEJA 4TWLA 3LXEA 3W6HA 1CAJA 4KV0A 1HCBA 1UGAA 4Q90A 4G0CA 5DSRA 3OY0A 3S72B 4Q83A 1TB0X 5FNIA 1EOUA 1TH9A 1G6VA 5DSOA 3MNAA 5EH7A 1LG6A 4ZWYA 4QEFA 3DVCA 3IBLA 4LP6A 3Q31A 5G03A 1RJ5A 4L5VA 1CVEA 1UGBA 2FNMA 1CVFA 1CRAA 4Q78A 4MDMA 3V3GB 1ZFKA 3M5SA 1V9EA 3T85A 5EZTX 1FQNA 1G0FA 5DSJA 5E2KA 4YGKA 3BETA 4FL7A 3T5UA 2WEHA 3M98A 4Z1JA 5FNGA 4ETQC 4E3DA 3P3HA 1KWRA 4QJMA 5DSKA 1LZVA 3HKTA 4UOVA 1CNYA 5SZ0A 3DVBA 3MZCA 1UGDA 2CBEA 1TBTX 3S9TA 3DD8A 2EZ7A 4CNWA 4FVNA 1UGFA 3OKUA 1Y7WA 1FR4A 3U7CA 5E2MA 5EHWA 4E3HA 4K0SA 1FLJA 2NWOA 3OYSA 4KNNA 4Q81A 3VBDA 5DSQA 2CBDA 1MUAA 4MDGA 5EH8A 3M2YA 2VVBX 5EHVA 1YO1A 5J8ZA 1G4JA 1CZMA 3M2XA 3IBNA 5FLOA 3V2MA 5E5UA 2NWPA 3M1KA 3S77B 4QIZA 5E2RA 1CA3A 5DOGA 4QIYA 3KWAA 3DCWA 4DZ9A 4Z1KA 2O4ZA 3K34A 2NXRA 4HEWA 3MNHA 1I9NA 2ILIA 3N4BA 4ITPA 1RJ6A 1IF4A 3MNJA 1BNUA 1CVAA 1RZCA 5CA2A 4PQ7A 5EHEA 3HLJA 4WL4A 4CNRA 4WUQA 4KNMA 5JGTB 1G53A 1CNGA 2H15A 4ITOA 1KWQA 1BNTA 3UYNA 2X7UA 4WR7A 3OIKA 3F8EA 1FQLA 1T9NA 1CVCA 1JD0A 1ZSBA 4IDRX 5FNMA 3D93A 3P5AA 4RFCA 1HECA 5DSMA 3DAZA 4YX4A 3W6IA 1OKLA 2AX2A 5AMLA 5EKHA 4N16A 1IF9A 4RN4A 2X7SA 5JGSB 3KKXA 4BCWA 2FMGA 3DD0A 2NNOA 4YXIA 5FNLA 3MHOA 1CNHA 4PXXA 3PO6A 1CVHA 4C3TA 3R16A 3R17B 4K0TA 4Q9YA 2EU2A 4KP5A 4FIKA 4QTLA 3M3XA 2NWZA 3JXFA 4QK1A 1TG3A 1V9IC 3NI5A 1XQ0A 5G01A 4RUXA 1G54A 3UYQA 3PYKA 5G0CA 3D0NA 4QSAA 3NB5A 1KOQA 1XEGA 3TVNX 4QJWA 3KOIA 5FNHA 4HF3A 3ML5A 4YGNA 2FOQA 4PZHA 4K13A 1CNCA 4FU5A 4LU3A 1RAYA 1IF7A 1H4NA 1F2WA 1I9OA 3RYYA 1BNWA 2IT4A 4XIXA 2CBAA 4YXOA 2GD8A 4CNVA 4Q7WA 2WD2A 2CABA 1CAKA 4KNJA 2GEHA 3K2FA 3IAIA 3ML2A 3RYJB 3V2JA 4YVYA 3JXHC 3MWOA 3RYVB 2FMZA 1YDDA 3KLDB 1G3ZA 3S75B 4Q49A 4YWPA 1H9QA 5FDCA 1AVNA 5EOIA 3V3IB 5FLQA 4FPTA 3D9ZA 5SZ5A 5DSIA 3N0NA 4ZX0A 5AMGA 3S8XA 2FOVA 3IBIA 1CAMA 1CAZA 2FOUA 2NN1A 3KONA 1XPZA 3OIMA 1A42A 3MNIA 2HFWA 2POWA 4IWZA 9CA2A 1TTMA 4QJOA 4ILXA 2Q1QA 3M14A 3T83A 3V3HB 1CNWA 3IBUA 4RUZA 3M5TA 3DCCA 3NJ9A 4L5UA 4CQ0A 5DSNA 1G1DA 3FW3A 3N2PA 4M2VA 1KOPA 7CA2A 3F4XA 4BF1A 1BN3A 1G48A 5SZ3A 1CCSA 1ZNCA 1BV3A 3RGEA 3P58A 2FOSA 3KNEA 2QP6A 3SBIA 1CINA 4X5SA 1IF6A 2FNNA 1CNXA 4RFDA 4K1QA 4E9OX 3HFPA 5HPJA 1HVAA 4QJ0A 3EFIA 4M2RA 3P55A 3V3JA 3GZ0A 3IEOA 5BRWA 4Y0JA 1CANA 3CYUA 3TMJA 1HEDA 2NWYA 5FDIA 2NN7A 3T5ZA 4N0XB 3V3FA
chains in the Genus database with same CATH topology
4QK3A 4WUPA 2FOYA 2FNKA 2QO8A 4YYTA 4QY3A 4XE1A 2W2JA 5FLTA 5FL4A 5DRSA 3DA2A 4E4AA 4YXUA 4QK2A 2ZNCA 1CAYA 3M67A 4YHAA 3MDZA 1ZGFA 3KOKA 1BN1A 6CA2A 5E2NA 1I91A 2WD3A 3N3JA 5JEGB 1RZEA 1RZDA 4FRCA 5FNJA 2NNGA 4E49A 1TG9A 1BICA 4CNXA 4Q6DA 5JQ0A 5CACA 4XZ5A 1CNBA 3T82A 1DCBA 2WEOA 3HKNA 4K0ZA 4Q06A 3MHCA 3DBUA 4BF6A 1OQ5A 3HKUA 4GL1X 1CNKA 3U45X 1CAOA 4Z1NA 1TEQX 2HOCA 1FQRA 3U3AX 4CACA 1OKNA 4TWMA 4Q6EA 3BL1A 4HEZA 1RAZA 4QSIA 2CBBA 4QSJA 4JS6A 4R59A 2EU3A 5BRVA 5G0BA 1DMXA 4M2UA 1I9QA 5L3OA 5BNLA 1CRMA 3D92A 4Q8ZA 1CNIA 4KUVA 5JG5B 3M40A 5FLRA 1ZGEA 4E3GA 3CAJA 4Q7PA 1HCAA 4HU1A 4DZ7A 4E5QA 1TE3X 4Z0QA 3S71B 5L6KA 3RZ0B 1CVBA 3M5EA 3CZVA 4CA2A 1CVDA 5EH5A 1LGDA 12CAA 5FL5A 1J9WA 1OKMA 2VVAX 5CJFA 3RZ8A 1H9NA 1ZH9A 5CLUA 3DC9A 5LMDA 3RLDA 4KAPA 1G4OA 5SZ2A 3M1WA 3MHIA 4ZX1A 3F7UA 4Q09A 5JDVB 5SZ6A 1CILA 5DOHA 3RJ7A 3MHMA 2FW4A 3MMFA 1UGEA 2CA2A 2NXTA 3L14A 3KS3A 3RYXB 3M2ZA 4PYYA 5SZ1A 5FLSA 2OSFA 1I9MA 3MHLA 3PJJA 4E3FA 1BNMA 3FFPX 4FVOA 3TVOX 3DV7A 3ZP9A 5DVXA 1ZSCA 4Q07A 3K7KA 1HEAA 4Q0LA 5E5RA 3DVDA 4YGJA 1CIMA 4ZWIA 5A6HA 3SAPA 3C7PA 1FSQA 4Q7VA 3FE4A 5AMDA 5C8IA 2HKKA 4Q8YA 3M96A 4MTYA 4Q87A 3MYQA 3RG4A 1G45A 4XIWA 4KUYA 4PYXA 1G0EA 3DCSA 3MNUA 3HKQA 4Q99A 4QJPA 5JQTA 3RZ5A 4Q8XA 3DC3A 3JXGA 1I9PA 4HBAA 4YGLA 4Q7SA 1JV0A 1TEUX 1YO0A 1YDCA 2HD6A 4RIVA 1Z93A 2F14A 2NXSA 5SZ7A 1BN4A 5JEHB 3P5LA 3RYZA 4KP8A 3SBHA 1MOOA 1IF5A 1BNQA 1RZAA 1URTA 1Z97A 1DCAA 4LHIA 3SAXA 1UGCA 3M1JA 2NNVA 5IPZA 2Q38A 4QSBA 4Q08A 4MDLA 3B1BA 3F7BA 3MNKA 4RH2A 4RUYA 4MLTA 1CCUA 3IGPA 4Z1EA 2NNSA 1BNVA 5BYIA 1THKA 2POUA 1BNNA 1JCZA 3M1QA 1XEVA 3KIGA 5DSPA 1CCTA 1HUGA 2POVA 2Q1BA 1HEBA 4R5AA 1FR7A 2X7TA 4ZWZA 1AZMA 1IF8A 1HUHA 3ZNCA 4JSWA 8CA2A 2QOAA 1Z9YA 5FNKA 3S76A 3RZ1B 5JEPB 3T84A 3V5GA 4WW8A 5JG3B 3V7XA 3OILA 3M2NA 1FQMA 4HT2A 4ZAOA 4ZWXA 3RZ7A 3RG3A 3P44A 1DMYA 1I9LA 1G52A 5A25A 2HNCA 1CALA 5SZ4A 3D8WA 3M04A 1BZMA 2CBCA 4QJXA 1LG5A 4JSSA 5E28A 4JSZA 5FLPA 4HEYA 1KEQA 1G46A 3OKVA 2NMXA 4WW6A 4COQA 1ZFQA 5E2SA 3EFTA 4L5WA 1CA2A 1RZBA 3QYKA 3P3JA 5BRUA 2AW1A 2HL4A 4YGFA 4G7AA 4KUWA 1CNJA 5EKJA 3S78B 5EKMA 5FL6A 3S97A 5DSLA 3S73B 1FSRA 4JSAA 1AM6A 1BCDA 1CAHA 1FSNA 1ZE8A 1ZSAA 3HS4A 4M2WA 1UGGA 3CA2A 4MO8A 4R5BA 3S74B 3P4VA 4MLXA 1YO2A 5JESB 4HT0A 2H4NA 4KNIA 5EIJA 1I8ZA 2WEGA 1CAIA 4XFWA 1LUGA 2OSMA 1YDBA 1I90A 3B4FA 3OYQA 4RIUA 3BL0A 3U47A 1YDAA 2ABEA 2WEJA 4TWLA 3LXEA 3W6HA 1CAJA 4KV0A 1HCBA 1UGAA 4Q90A 4G0CA 5DSRA 3OY0A 3S72B 4Q83A 1TB0X 5FNIA 1EOUA 1TH9A 1G6VA 5DSOA 3MNAA 5EH7A 1LG6A 4ZWYA 4QEFA 3DVCA 3IBLA 4LP6A 3Q31A 5G03A 1RJ5A 4L5VA 1CVEA 1UGBA 2FNMA 1CVFA 1CRAA 4Q78A 4MDMA 3V3GB 1ZFKA 3M5SA 1V9EA 3T85A 5EZTX 1FQNA 1G0FA 5DSJA 5E2KA 4YGKA 3BETA 4FL7A 3T5UA 2WEHA 3M98A 4Z1JA 5FNGA 4ETQC 4E3DA 3P3HA 1KWRA 4QJMA 5DSKA 1LZVA 3HKTA 4UOVA 1CNYA 5SZ0A 3DVBA 3MZCA 1UGDA 2CBEA 1TBTX 3S9TA 3DD8A 2EZ7A 4CNWA 4FVNA 1UGFA 3OKUA 1Y7WA 1FR4A 3U7CA 5E2MA 5EHWA 4E3HA 4K0SA 1FLJA 2NWOA 3OYSA 4KNNA 4Q81A 3VBDA 5DSQA 2CBDA 1MUAA 4MDGA 5EH8A 3M2YA 2VVBX 5EHVA 1YO1A 5J8ZA 1G4JA 1CZMA 3M2XA 3IBNA 5FLOA 3V2MA 5E5UA 2NWPA 3M1KA 3S77B 4QIZA 5E2RA 1CA3A 5DOGA 4QIYA 3KWAA 3DCWA 4DZ9A 4Z1KA 2O4ZA 3K34A 2NXRA 4HEWA 3MNHA 1I9NA 2ILIA 3N4BA 4ITPA 1RJ6A 1IF4A 3MNJA 1BNUA 1CVAA 1RZCA 5CA2A 4PQ7A 5EHEA 3HLJA 4WL4A 4CNRA 4WUQA 4KNMA 5JGTB 1G53A 1CNGA 2H15A 4ITOA 1KWQA 1BNTA 3UYNA 2X7UA 4WR7A 3OIKA 3F8EA 1FQLA 1T9NA 1CVCA 1JD0A 1ZSBA 4IDRX 5FNMA 3D93A 3P5AA 4RFCA 1HECA 5DSMA 3DAZA 4YX4A 3W6IA 1OKLA 2AX2A 5AMLA 5EKHA 4N16A 1IF9A 4RN4A 2X7SA 5JGSB 3KKXA 4BCWA 2FMGA 3DD0A 2NNOA 4YXIA 5FNLA 3MHOA 1CNHA 4PXXA 3PO6A 1CVHA 4C3TA 3R16A 3R17B 4K0TA 4Q9YA 2EU2A 4KP5A 4FIKA 4QTLA 3M3XA 2NWZA 3JXFA 4QK1A 1TG3A 1V9IC 3NI5A 1XQ0A 5G01A 4RUXA 1G54A 3UYQA 3PYKA 5G0CA 3D0NA 4QSAA 3NB5A 1KOQA 1XEGA 3TVNX 4QJWA 3KOIA 5FNHA 4HF3A 3ML5A 4YGNA 2FOQA 4PZHA 4K13A 1CNCA 4FU5A 4LU3A 1RAYA 1IF7A 1H4NA 1F2WA 1I9OA 3RYYA 1BNWA 2IT4A 4XIXA 2CBAA 4YXOA 2GD8A 4CNVA 4Q7WA 2WD2A 2CABA 1CAKA 4KNJA 2GEHA 3K2FA 3IAIA 3ML2A 3RYJB 3V2JA 4YVYA 3JXHC 3MWOA 3RYVB 2FMZA 1YDDA 3KLDB 1G3ZA 3S75B 4Q49A 4YWPA 1H9QA 5FDCA 1AVNA 5EOIA 3V3IB 5FLQA 4FPTA 3D9ZA 5SZ5A 5DSIA 3N0NA 4ZX0A 5AMGA 3S8XA 2FOVA 3IBIA 1CAMA 1CAZA 2FOUA 2NN1A 3KONA 1XPZA 3OIMA 1A42A 3MNIA 2HFWA 2POWA 4IWZA 9CA2A 1TTMA 4QJOA 4ILXA 2Q1QA 3M14A 3T83A 3V3HB 1CNWA 3IBUA 4RUZA 3M5TA 3DCCA 3NJ9A 4L5UA 4CQ0A 5DSNA 1G1DA 3FW3A 3N2PA 4M2VA 1KOPA 7CA2A 3F4XA 4BF1A 1BN3A 1G48A 5SZ3A 1CCSA 1ZNCA 1BV3A 3RGEA 3P58A 2FOSA 3KNEA 2QP6A 3SBIA 1CINA 4X5SA 1IF6A 2FNNA 1CNXA 4RFDA 4K1QA 4E9OX 3HFPA 5HPJA 1HVAA 4QJ0A 3EFIA 4M2RA 3P55A 3V3JA 3GZ0A 3IEOA 5BRWA 4Y0JA 1CANA 3CYUA 3TMJA 1HEDA 2NWYA 5FDIA 2NN7A 3T5ZA 4N0XB 3V3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QK3 A;  4WUP A;  2FOY A;  2FNK A;  2QO8 A;  4YYT A;  4QY3 A;  4XE1 A;  2W2J A;  5FLT A;  5FL4 A;  5DRS A;  3DA2 A;  4E4A A;  4YXU A;  4QK2 A;  2ZNC A;  1CAY A;  3M67 A;  4YHA A;  3MDZ A;  1ZGF A;  3KOK A;  1BN1 A;  6CA2 A;  5E2N A;  1I91 A;  2WD3 A;  3N3J A;  5JEG B;  1RZE A;  1RZD A;  4FRC A;  5FNJ A;  2NNG A;  4E49 A;  1TG9 A;  1BIC A;  4CNX A;  4Q6D A;  5JQ0 A;  5CAC A;  4XZ5 A;  1CNB A;  3T82 A;  1DCB A;  2WEO A;  3HKN A;  4K0Z A;  4Q06 A;  3MHC A;  3DBU A;  4BF6 A;  1OQ5 A;  3HKU A;  4GL1 X;  1CNK A;  3U45 X;  1CAO A;  4Z1N A;  1TEQ X;  2HOC A;  1FQR A;  3U3A X;  4CAC A;  1OKN A;  4TWM A;  4Q6E A;  3BL1 A;  4HEZ A;  1RAZ A;  4QSI A;  2CBB A;  4QSJ A;  4JS6 A;  4R59 A;  2EU3 A;  5BRV A;  5G0B A;  1DMX A;  4M2U A;  1I9Q A;  5L3O A;  5BNL A;  1CRM A;  3D92 A;  4Q8Z A;  1CNI A;  4KUV A;  5JG5 B;  3M40 A;  5FLR A;  1ZGE A;  4E3G A;  3CAJ A;  4Q7P A;  1HCA A;  4HU1 A;  4DZ7 A;  4E5Q A;  1TE3 X;  4Z0Q A;  3S71 B;  5L6K A;  3RZ0 B;  1CVB A;  3M5E A;  3CZV A;  4CA2 A;  1CVD A;  5EH5 A;  1LGD A;  12CA A;  5FL5 A;  1J9W A;  1OKM A;  2VVA X;  5CJF A;  3RZ8 A;  1H9N A;  1ZH9 A;  5CLU A;  3DC9 A;  5LMD A;  3RLD A;  4KAP A;  1G4O A;  5SZ2 A;  3M1W A;  3MHI A;  4ZX1 A;  3F7U A;  4Q09 A;  5JDV B;  5SZ6 A;  1CIL A;  5DOH A;  3RJ7 A;  3MHM A;  2FW4 A;  3MMF A;  1UGE A;  2CA2 A;  2NXT A;  3L14 A;  3KS3 A;  3RYX B;  3M2Z A;  4PYY A;  5SZ1 A;  5FLS A;  2OSF A;  1I9M A;  3MHL A;  3PJJ A;  4E3F A;  1BNM A;  3FFP X;  4FVO A;  3TVO X;  3DV7 A;  3ZP9 A;  5DVX A;  1ZSC A;  4Q07 A;  3K7K A;  1HEA A;  4Q0L A;  5E5R A;  3DVD A;  4YGJ A;  1CIM A;  4ZWI A;  5A6H A;  3SAP A;  3C7P A;  1FSQ A;  4Q7V A;  3FE4 A;  5AMD A;  5C8I A;  2HKK A;  4Q8Y A;  3M96 A;  4MTY A;  4Q87 A;  3MYQ A;  3RG4 A;  1G45 A;  4XIW A;  4KUY A;  4PYX A;  1G0E A;  3DCS A;  3MNU A;  3HKQ A;  4Q99 A;  4QJP A;  5JQT A;  3RZ5 A;  4Q8X A;  3DC3 A;  3JXG A;  1I9P A;  4HBA A;  4YGL A;  4Q7S A;  1JV0 A;  1TEU X;  1YO0 A;  1YDC A;  2HD6 A;  4RIV A;  1Z93 A;  2F14 A;  2NXS A;  5SZ7 A;  1BN4 A;  5JEH B;  3P5L A;  3RYZ A;  4KP8 A;  3SBH A;  1MOO A;  1IF5 A;  1BNQ A;  1RZA A;  1URT A;  1Z97 A;  1DCA A;  4LHI A;  3SAX A;  1UGC A;  3M1J A;  2NNV A;  5IPZ A;  2Q38 A;  4QSB A;  4Q08 A;  4MDL A;  3B1B A;  3F7B A;  3MNK A;  4RH2 A;  4RUY A;  4MLT A;  1CCU A;  3IGP A;  4Z1E A;  2NNS A;  1BNV A;  5BYI A;  1THK A;  2POU A;  1BNN A;  1JCZ A;  3M1Q A;  1XEV A;  3KIG A;  5DSP A;  1CCT A;  1HUG A;  2POV A;  2Q1B A;  1HEB A;  4R5A A;  1FR7 A;  2X7T A;  4ZWZ A;  1AZM A;  1IF8 A;  1HUH A;  3ZNC A;  4JSW A;  8CA2 A;  2QOA A;  1Z9Y A;  5FNK A;  3S76 A;  3RZ1 B;  5JEP B;  3T84 A;  3V5G A;  4WW8 A;  5JG3 B;  3V7X A;  3OIL A;  3M2N A;  1FQM A;  4HT2 A;  4ZAO A;  4ZWX A;  3RZ7 A;  3RG3 A;  3P44 A;  1DMY A;  1I9L A;  1G52 A;  5A25 A;  2HNC A;  1CAL A;  5SZ4 A;  3D8W A;  3M04 A;  1BZM A;  2CBC A;  4QJX A;  1LG5 A;  4JSS A;  5E28 A;  4JSZ A;  5FLP A;  4HEY A;  1KEQ A;  1G46 A;  3OKV A;  2NMX A;  4WW6 A;  4COQ A;  1ZFQ A;  5E2S A;  3EFT A;  4L5W A;  1CA2 A;  1RZB A;  3QYK A;  3P3J A;  5BRU A;  2AW1 A;  2HL4 A;  4YGF A;  4G7A A;  4KUW A;  1CNJ A;  5EKJ A;  3S78 B;  5EKM A;  5FL6 A;  3S97 A;  5DSL A;  3S73 B;  1FSR A;  4JSA A;  1AM6 A;  1BCD A;  1CAH A;  1FSN A;  1ZE8 A;  1ZSA A;  3HS4 A;  4M2W A;  1UGG A;  3CA2 A;  4MO8 A;  4R5B A;  3S74 B;  3P4V A;  4MLX A;  1YO2 A;  5JES B;  4HT0 A;  2H4N A;  4KNI A;  5EIJ A;  1I8Z A;  2WEG A;  1CAI A;  4XFW A;  1LUG A;  2OSM A;  1YDB A;  1I90 A;  3B4F A;  3OYQ A;  4RIU A;  3BL0 A;  3U47 A;  1YDA A;  2ABE A;  2WEJ A;  4TWL A;  3LXE A;  3W6H A;  1CAJ A;  4KV0 A;  1HCB A;  1UGA A;  4Q90 A;  4G0C A;  5DSR A;  3OY0 A;  3S72 B;  4Q83 A;  1TB0 X;  5FNI A;  1EOU A;  1TH9 A;  1G6V A;  5DSO A;  3MNA A;  5EH7 A;  1LG6 A;  4ZWY A;  4QEF A;  3DVC A;  3IBL A;  4LP6 A;  3Q31 A;  5G03 A;  1RJ5 A;  4L5V A;  1CVE A;  1UGB A;  2FNM A;  1CVF A;  1CRA A;  4Q78 A;  4MDM A;  3V3G B;  1ZFK A;  3M5S A;  1V9E A;  3T85 A;  5EZT X;  1FQN A;  1G0F A;  5DSJ A;  5E2K A;  4YGK A;  3BET A;  4FL7 A;  3T5U A;  2WEH A;  3M98 A;  4Z1J A;  5FNG A;  4ETQ C;  4E3D A;  3P3H A;  1KWR A;  4QJM A;  5DSK A;  1LZV A;  3HKT A;  4UOV A;  1CNY A;  5SZ0 A;  3DVB A;  3MZC A;  1UGD A;  2CBE A;  1TBT X;  3S9T A;  3DD8 A;  2EZ7 A;  4CNW A;  4FVN A;  1UGF A;  3OKU A;  1Y7W A;  1FR4 A;  3U7C A;  5E2M A;  5EHW A;  4E3H A;  4K0S A;  1FLJ A;  2NWO A;  3OYS A;  4KNN A;  4Q81 A;  3VBD A;  5DSQ A;  2CBD A;  1MUA A;  4MDG A;  5EH8 A;  3M2Y A;  2VVB X;  5EHV A;  1YO1 A;  5J8Z A;  1G4J A;  1CZM A;  3M2X A;  3IBN A;  5FLO A;  3V2M A;  5E5U A;  2NWP A;  3M1K A;  3S77 B;  4QIZ A;  5E2R A;  1CA3 A;  5DOG A;  4QIY A;  3KWA A;  3DCW A;  4DZ9 A;  4Z1K A;  2O4Z A;  3K34 A;  2NXR A;  4HEW A;  3MNH A;  1I9N A;  2ILI A;  3N4B A;  4ITP A;  1RJ6 A;  1IF4 A;  3MNJ A;  1BNU A;  1CVA A;  1RZC A;  5CA2 A;  4PQ7 A;  5EHE A;  3HLJ A;  4WL4 A;  4CNR A;  4WUQ A;  4KNM A;  5JGT B;  1G53 A;  1CNG A;  2H15 A;  4ITO A;  1KWQ A;  1BNT A;  3UYN A;  2X7U A;  4WR7 A;  3OIK A;  3F8E A;  1FQL A;  1T9N A;  1CVC A;  1JD0 A;  1ZSB A;  4IDR X;  5FNM A;  3D93 A;  3P5A A;  4RFC A;  1HEC A;  5DSM A;  3DAZ A;  4YX4 A;  3W6I A;  1OKL A;  2AX2 A;  5AML A;  5EKH A;  4N16 A;  1IF9 A;  4RN4 A;  2X7S A;  5JGS B;  3KKX A;  4BCW A;  2FMG A;  3DD0 A;  2NNO A;  4YXI A;  5FNL A;  3MHO A;  1CNH A;  4PXX A;  3PO6 A;  1CVH A;  4C3T A;  3R16 A;  3R17 B;  4K0T A;  4Q9Y A;  2EU2 A;  4KP5 A;  4FIK A;  4QTL A;  3M3X A;  2NWZ A;  3JXF A;  4QK1 A;  1TG3 A;  1V9I C;  3NI5 A;  1XQ0 A;  5G01 A;  4RUX A;  1G54 A;  3UYQ A;  3PYK A;  5G0C A;  3D0N A;  4QSA A;  3NB5 A;  1KOQ A;  1XEG A;  3TVN X;  4QJW A;  3KOI A;  5FNH A;  4HF3 A;  3ML5 A;  4YGN A;  2FOQ A;  4PZH A;  4K13 A;  1CNC A;  4FU5 A;  4LU3 A;  1RAY A;  1IF7 A;  1H4N A;  1F2W A;  1I9O A;  3RYY A;  1BNW A;  2IT4 A;  4XIX A;  2CBA A;  4YXO A;  2GD8 A;  4CNV A;  4Q7W A;  2WD2 A;  2CAB A;  1CAK A;  4KNJ A;  2GEH A;  3K2F A;  3IAI A;  3ML2 A;  3RYJ B;  3V2J A;  4YVY A;  3JXH C;  3MWO A;  3RYV B;  2FMZ A;  1YDD A;  3KLD B;  1G3Z A;  3S75 B;  4Q49 A;  4YWP A;  1H9Q A;  5FDC A;  1AVN A;  5EOI A;  3V3I B;  5FLQ A;  4FPT A;  3D9Z A;  5SZ5 A;  5DSI A;  3N0N A;  4ZX0 A;  5AMG A;  3S8X A;  2FOV A;  3IBI A;  1CAM A;  1CAZ A;  2FOU A;  2NN1 A;  3KON A;  1XPZ A;  3OIM A;  1A42 A;  3MNI A;  2HFW A;  2POW A;  4IWZ A;  9CA2 A;  1TTM A;  4QJO A;  4ILX A;  2Q1Q A;  3M14 A;  3T83 A;  3V3H B;  1CNW A;  3IBU A;  4RUZ A;  3M5T A;  3DCC A;  3NJ9 A;  4L5U A;  4CQ0 A;  5DSN A;  1G1D A;  3FW3 A;  3N2P A;  4M2V A;  1KOP A;  7CA2 A;  3F4X A;  4BF1 A;  1BN3 A;  1G48 A;  5SZ3 A;  1CCS A;  1ZNC A;  1BV3 A;  3RGE A;  3P58 A;  2FOS A;  3KNE A;  2QP6 A;  3SBI A;  1CIN A;  4X5S A;  1IF6 A;  2FNN A;  1CNX A;  4RFD A;  4K1Q A;  4E9O X;  3HFP A;  5HPJ A;  1HVA A;  4QJ0 A;  3EFI A;  4M2R A;  3P55 A;  3V3J A;  3GZ0 A;  3IEO A;  5BRW A;  4Y0J A;  1CAN A;  3CYU A;  3TMJ A;  1HED A;  2NWY A;  5FDI A;  2NN7 A;  3T5Z A;  4N0X B;  3V3F A; 
#chains in the Genus database with same CATH topology
 4QK3 A;  4WUP A;  2FOY A;  2FNK A;  2QO8 A;  4YYT A;  4QY3 A;  4XE1 A;  2W2J A;  5FLT A;  5FL4 A;  5DRS A;  3DA2 A;  4E4A A;  4YXU A;  4QK2 A;  2ZNC A;  1CAY A;  3M67 A;  4YHA A;  3MDZ A;  1ZGF A;  3KOK A;  1BN1 A;  6CA2 A;  5E2N A;  1I91 A;  2WD3 A;  3N3J A;  5JEG B;  1RZE A;  1RZD A;  4FRC A;  5FNJ A;  2NNG A;  4E49 A;  1TG9 A;  1BIC A;  4CNX A;  4Q6D A;  5JQ0 A;  5CAC A;  4XZ5 A;  1CNB A;  3T82 A;  1DCB A;  2WEO A;  3HKN A;  4K0Z A;  4Q06 A;  3MHC A;  3DBU A;  4BF6 A;  1OQ5 A;  3HKU A;  4GL1 X;  1CNK A;  3U45 X;  1CAO A;  4Z1N A;  1TEQ X;  2HOC A;  1FQR A;  3U3A X;  4CAC A;  1OKN A;  4TWM A;  4Q6E A;  3BL1 A;  4HEZ A;  1RAZ A;  4QSI A;  2CBB A;  4QSJ A;  4JS6 A;  4R59 A;  2EU3 A;  5BRV A;  5G0B A;  1DMX A;  4M2U A;  1I9Q A;  5L3O A;  5BNL A;  1CRM A;  3D92 A;  4Q8Z A;  1CNI A;  4KUV A;  5JG5 B;  3M40 A;  5FLR A;  1ZGE A;  4E3G A;  3CAJ A;  4Q7P A;  1HCA A;  4HU1 A;  4DZ7 A;  4E5Q A;  1TE3 X;  4Z0Q A;  3S71 B;  5L6K A;  3RZ0 B;  1CVB A;  3M5E A;  3CZV A;  4CA2 A;  1CVD A;  5EH5 A;  1LGD A;  12CA A;  5FL5 A;  1J9W A;  1OKM A;  2VVA X;  5CJF A;  3RZ8 A;  1H9N A;  1ZH9 A;  5CLU A;  3DC9 A;  5LMD A;  3RLD A;  4KAP A;  1G4O A;  5SZ2 A;  3M1W A;  3MHI A;  4ZX1 A;  3F7U A;  4Q09 A;  5JDV B;  5SZ6 A;  1CIL A;  5DOH A;  3RJ7 A;  3MHM A;  2FW4 A;  3MMF A;  1UGE A;  2CA2 A;  2NXT A;  3L14 A;  3KS3 A;  3RYX B;  3M2Z A;  4PYY A;  5SZ1 A;  5FLS A;  2OSF A;  1I9M A;  3MHL A;  3PJJ A;  4E3F A;  1BNM A;  3FFP X;  4FVO A;  3TVO X;  3DV7 A;  3ZP9 A;  5DVX A;  1ZSC A;  4Q07 A;  3K7K A;  1HEA A;  4Q0L A;  5E5R A;  3DVD A;  4YGJ A;  1CIM A;  4ZWI A;  5A6H A;  3SAP A;  3C7P A;  1FSQ A;  4Q7V A;  3FE4 A;  5AMD A;  5C8I A;  2HKK A;  4Q8Y A;  3M96 A;  4MTY A;  4Q87 A;  3MYQ A;  3RG4 A;  1G45 A;  4XIW A;  4KUY A;  4PYX A;  1G0E A;  3DCS A;  3MNU A;  3HKQ A;  4Q99 A;  4QJP A;  5JQT A;  3RZ5 A;  4Q8X A;  3DC3 A;  3JXG A;  1I9P A;  4HBA A;  4YGL A;  4Q7S A;  1JV0 A;  1TEU X;  1YO0 A;  1YDC A;  2HD6 A;  4RIV A;  1Z93 A;  2F14 A;  2NXS A;  5SZ7 A;  1BN4 A;  5JEH B;  3P5L A;  3RYZ A;  4KP8 A;  3SBH A;  1MOO A;  1IF5 A;  1BNQ A;  1RZA A;  1URT A;  1Z97 A;  1DCA A;  4LHI A;  3SAX A;  1UGC A;  3M1J A;  2NNV A;  5IPZ A;  2Q38 A;  4QSB A;  4Q08 A;  4MDL A;  3B1B A;  3F7B A;  3MNK A;  4RH2 A;  4RUY A;  4MLT A;  1CCU A;  3IGP A;  4Z1E A;  2NNS A;  1BNV A;  5BYI A;  1THK A;  2POU A;  1BNN A;  1JCZ A;  3M1Q A;  1XEV A;  3KIG A;  5DSP A;  1CCT A;  1HUG A;  2POV A;  2Q1B A;  1HEB A;  4R5A A;  1FR7 A;  2X7T A;  4ZWZ A;  1AZM A;  1IF8 A;  1HUH A;  3ZNC A;  4JSW A;  8CA2 A;  2QOA A;  1Z9Y A;  5FNK A;  3S76 A;  3RZ1 B;  5JEP B;  3T84 A;  3V5G A;  4WW8 A;  5JG3 B;  3V7X A;  3OIL A;  3M2N A;  1FQM A;  4HT2 A;  4ZAO A;  4ZWX A;  3RZ7 A;  3RG3 A;  3P44 A;  1DMY A;  1I9L A;  1G52 A;  5A25 A;  2HNC A;  1CAL A;  5SZ4 A;  3D8W A;  3M04 A;  1BZM A;  2CBC A;  4QJX A;  1LG5 A;  4JSS A;  5E28 A;  4JSZ A;  5FLP A;  4HEY A;  1KEQ A;  1G46 A;  3OKV A;  2NMX A;  4WW6 A;  4COQ A;  1ZFQ A;  5E2S A;  3EFT A;  4L5W A;  1CA2 A;  1RZB A;  3QYK A;  3P3J A;  5BRU A;  2AW1 A;  2HL4 A;  4YGF A;  4G7A A;  4KUW A;  1CNJ A;  5EKJ A;  3S78 B;  5EKM A;  5FL6 A;  3S97 A;  5DSL A;  3S73 B;  1FSR A;  4JSA A;  1AM6 A;  1BCD A;  1CAH A;  1FSN A;  1ZE8 A;  1ZSA A;  3HS4 A;  4M2W A;  1UGG A;  3CA2 A;  4MO8 A;  4R5B A;  3S74 B;  3P4V A;  4MLX A;  1YO2 A;  5JES B;  4HT0 A;  2H4N A;  4KNI A;  5EIJ A;  1I8Z A;  2WEG A;  1CAI A;  4XFW A;  1LUG A;  2OSM A;  1YDB A;  1I90 A;  3B4F A;  3OYQ A;  4RIU A;  3BL0 A;  3U47 A;  1YDA A;  2ABE A;  2WEJ A;  4TWL A;  3LXE A;  3W6H A;  1CAJ A;  4KV0 A;  1HCB A;  1UGA A;  4Q90 A;  4G0C A;  5DSR A;  3OY0 A;  3S72 B;  4Q83 A;  1TB0 X;  5FNI A;  1EOU A;  1TH9 A;  1G6V A;  5DSO A;  3MNA A;  5EH7 A;  1LG6 A;  4ZWY A;  4QEF A;  3DVC A;  3IBL A;  4LP6 A;  3Q31 A;  5G03 A;  1RJ5 A;  4L5V A;  1CVE A;  1UGB A;  2FNM A;  1CVF A;  1CRA A;  4Q78 A;  4MDM A;  3V3G B;  1ZFK A;  3M5S A;  1V9E A;  3T85 A;  5EZT X;  1FQN A;  1G0F A;  5DSJ A;  5E2K A;  4YGK A;  3BET A;  4FL7 A;  3T5U A;  2WEH A;  3M98 A;  4Z1J A;  5FNG A;  4ETQ C;  4E3D A;  3P3H A;  1KWR A;  4QJM A;  5DSK A;  1LZV A;  3HKT A;  4UOV A;  1CNY A;  5SZ0 A;  3DVB A;  3MZC A;  1UGD A;  2CBE A;  1TBT X;  3S9T A;  3DD8 A;  2EZ7 A;  4CNW A;  4FVN A;  1UGF A;  3OKU A;  1Y7W A;  1FR4 A;  3U7C A;  5E2M A;  5EHW A;  4E3H A;  4K0S A;  1FLJ A;  2NWO A;  3OYS A;  4KNN A;  4Q81 A;  3VBD A;  5DSQ A;  2CBD A;  1MUA A;  4MDG A;  5EH8 A;  3M2Y A;  2VVB X;  5EHV A;  1YO1 A;  5J8Z A;  1G4J A;  1CZM A;  3M2X A;  3IBN A;  5FLO A;  3V2M A;  5E5U A;  2NWP A;  3M1K A;  3S77 B;  4QIZ A;  5E2R A;  1CA3 A;  5DOG A;  4QIY A;  3KWA A;  3DCW A;  4DZ9 A;  4Z1K A;  2O4Z A;  3K34 A;  2NXR A;  4HEW A;  3MNH A;  1I9N A;  2ILI A;  3N4B A;  4ITP A;  1RJ6 A;  1IF4 A;  3MNJ A;  1BNU A;  1CVA A;  1RZC A;  5CA2 A;  4PQ7 A;  5EHE A;  3HLJ A;  4WL4 A;  4CNR A;  4WUQ A;  4KNM A;  5JGT B;  1G53 A;  1CNG A;  2H15 A;  4ITO A;  1KWQ A;  1BNT A;  3UYN A;  2X7U A;  4WR7 A;  3OIK A;  3F8E A;  1FQL A;  1T9N A;  1CVC A;  1JD0 A;  1ZSB A;  4IDR X;  5FNM A;  3D93 A;  3P5A A;  4RFC A;  1HEC A;  5DSM A;  3DAZ A;  4YX4 A;  3W6I A;  1OKL A;  2AX2 A;  5AML A;  5EKH A;  4N16 A;  1IF9 A;  4RN4 A;  2X7S A;  5JGS B;  3KKX A;  4BCW A;  2FMG A;  3DD0 A;  2NNO A;  4YXI A;  5FNL A;  3MHO A;  1CNH A;  4PXX A;  3PO6 A;  1CVH A;  4C3T A;  3R16 A;  3R17 B;  4K0T A;  4Q9Y A;  2EU2 A;  4KP5 A;  4FIK A;  4QTL A;  3M3X A;  2NWZ A;  3JXF A;  4QK1 A;  1TG3 A;  1V9I C;  3NI5 A;  1XQ0 A;  5G01 A;  4RUX A;  1G54 A;  3UYQ A;  3PYK A;  5G0C A;  3D0N A;  4QSA A;  3NB5 A;  1KOQ A;  1XEG A;  3TVN X;  4QJW A;  3KOI A;  5FNH A;  4HF3 A;  3ML5 A;  4YGN A;  2FOQ A;  4PZH A;  4K13 A;  1CNC A;  4FU5 A;  4LU3 A;  1RAY A;  1IF7 A;  1H4N A;  1F2W A;  1I9O A;  3RYY A;  1BNW A;  2IT4 A;  4XIX A;  2CBA A;  4YXO A;  2GD8 A;  4CNV A;  4Q7W A;  2WD2 A;  2CAB A;  1CAK A;  4KNJ A;  2GEH A;  3K2F A;  3IAI A;  3ML2 A;  3RYJ B;  3V2J A;  4YVY A;  3JXH C;  3MWO A;  3RYV B;  2FMZ A;  1YDD A;  3KLD B;  1G3Z A;  3S75 B;  4Q49 A;  4YWP A;  1H9Q A;  5FDC A;  1AVN A;  5EOI A;  3V3I B;  5FLQ A;  4FPT A;  3D9Z A;  5SZ5 A;  5DSI A;  3N0N A;  4ZX0 A;  5AMG A;  3S8X A;  2FOV A;  3IBI A;  1CAM A;  1CAZ A;  2FOU A;  2NN1 A;  3KON A;  1XPZ A;  3OIM A;  1A42 A;  3MNI A;  2HFW A;  2POW A;  4IWZ A;  9CA2 A;  1TTM A;  4QJO A;  4ILX A;  2Q1Q A;  3M14 A;  3T83 A;  3V3H B;  1CNW A;  3IBU A;  4RUZ A;  3M5T A;  3DCC A;  3NJ9 A;  4L5U A;  4CQ0 A;  5DSN A;  1G1D A;  3FW3 A;  3N2P A;  4M2V A;  1KOP A;  7CA2 A;  3F4X A;  4BF1 A;  1BN3 A;  1G48 A;  5SZ3 A;  1CCS A;  1ZNC A;  1BV3 A;  3RGE A;  3P58 A;  2FOS A;  3KNE A;  2QP6 A;  3SBI A;  1CIN A;  4X5S A;  1IF6 A;  2FNN A;  1CNX A;  4RFD A;  4K1Q A;  4E9O X;  3HFP A;  5HPJ A;  1HVA A;  4QJ0 A;  3EFI A;  4M2R A;  3P55 A;  3V3J A;  3GZ0 A;  3IEO A;  5BRW A;  4Y0J A;  1CAN A;  3CYU A;  3TMJ A;  1HED A;  2NWY A;  5FDI A;  2NN7 A;  3T5Z A;  4N0X B;  3V3F A; 
#chains in the Genus database with same CATH homology
 4QK3 A;  4WUP A;  2FOY A;  2FNK A;  2QO8 A;  4YYT A;  4QY3 A;  4XE1 A;  2W2J A;  5FLT A;  5FL4 A;  5DRS A;  3DA2 A;  4E4A A;  4YXU A;  4QK2 A;  2ZNC A;  1CAY A;  3M67 A;  4YHA A;  3MDZ A;  1ZGF A;  3KOK A;  1BN1 A;  6CA2 A;  5E2N A;  1I91 A;  2WD3 A;  3N3J A;  5JEG B;  1RZE A;  1RZD A;  4FRC A;  5FNJ A;  2NNG A;  4E49 A;  1TG9 A;  1BIC A;  4CNX A;  4Q6D A;  5JQ0 A;  5CAC A;  4XZ5 A;  1CNB A;  3T82 A;  1DCB A;  2WEO A;  3HKN A;  4K0Z A;  4Q06 A;  3MHC A;  3DBU A;  4BF6 A;  1OQ5 A;  3HKU A;  4GL1 X;  1CNK A;  3U45 X;  1CAO A;  4Z1N A;  1TEQ X;  2HOC A;  1FQR A;  3U3A X;  4CAC A;  1OKN A;  4TWM A;  4Q6E A;  3BL1 A;  4HEZ A;  1RAZ A;  4QSI A;  2CBB A;  4QSJ A;  4JS6 A;  4R59 A;  2EU3 A;  5BRV A;  5G0B A;  1DMX A;  4M2U A;  1I9Q A;  5L3O A;  5BNL A;  1CRM A;  3D92 A;  4Q8Z A;  1CNI A;  4KUV A;  5JG5 B;  3M40 A;  5FLR A;  1ZGE A;  4E3G A;  3CAJ A;  4Q7P A;  1HCA A;  4HU1 A;  4DZ7 A;  4E5Q A;  1TE3 X;  4Z0Q A;  3S71 B;  5L6K A;  3RZ0 B;  1CVB A;  3M5E A;  3CZV A;  4CA2 A;  1CVD A;  5EH5 A;  1LGD A;  12CA A;  5FL5 A;  1J9W A;  1OKM A;  2VVA X;  5CJF A;  3RZ8 A;  1H9N A;  1ZH9 A;  5CLU A;  3DC9 A;  5LMD A;  3RLD A;  4KAP A;  1G4O A;  5SZ2 A;  3M1W A;  3MHI A;  4ZX1 A;  3F7U A;  4Q09 A;  5JDV B;  5SZ6 A;  1CIL A;  5DOH A;  3RJ7 A;  3MHM A;  2FW4 A;  3MMF A;  1UGE A;  2CA2 A;  2NXT A;  3L14 A;  3KS3 A;  3RYX B;  3M2Z A;  4PYY A;  5SZ1 A;  5FLS A;  2OSF A;  1I9M A;  3MHL A;  3PJJ A;  4E3F A;  1BNM A;  3FFP X;  4FVO A;  3TVO X;  3DV7 A;  3ZP9 A;  5DVX A;  1ZSC A;  4Q07 A;  3K7K A;  1HEA A;  4Q0L A;  5E5R A;  3DVD A;  4YGJ A;  1CIM A;  4ZWI A;  5A6H A;  3SAP A;  3C7P A;  1FSQ A;  4Q7V A;  3FE4 A;  5AMD A;  5C8I A;  2HKK A;  4Q8Y A;  3M96 A;  4MTY A;  4Q87 A;  3MYQ A;  3RG4 A;  1G45 A;  4XIW A;  4KUY A;  4PYX A;  1G0E A;  3DCS A;  3MNU A;  3HKQ A;  4Q99 A;  4QJP A;  5JQT A;  3RZ5 A;  4Q8X A;  3DC3 A;  3JXG A;  1I9P A;  4HBA A;  4YGL A;  4Q7S A;  1JV0 A;  1TEU X;  1YO0 A;  1YDC A;  2HD6 A;  4RIV A;  1Z93 A;  2F14 A;  2NXS A;  5SZ7 A;  1BN4 A;  5JEH B;  3P5L A;  3RYZ A;  4KP8 A;  3SBH A;  1MOO A;  1IF5 A;  1BNQ A;  1RZA A;  1URT A;  1Z97 A;  1DCA A;  4LHI A;  3SAX A;  1UGC A;  3M1J A;  2NNV A;  5IPZ A;  2Q38 A;  4QSB A;  4Q08 A;  4MDL A;  3B1B A;  3F7B A;  3MNK A;  4RH2 A;  4RUY A;  4MLT A;  1CCU A;  3IGP A;  4Z1E A;  2NNS A;  1BNV A;  5BYI A;  1THK A;  2POU A;  1BNN A;  1JCZ A;  3M1Q A;  1XEV A;  3KIG A;  5DSP A;  1CCT A;  1HUG A;  2POV A;  2Q1B A;  1HEB A;  4R5A A;  1FR7 A;  2X7T A;  4ZWZ A;  1AZM A;  1IF8 A;  1HUH A;  3ZNC A;  4JSW A;  8CA2 A;  2QOA A;  1Z9Y A;  5FNK A;  3S76 A;  3RZ1 B;  5JEP B;  3T84 A;  3V5G A;  4WW8 A;  5JG3 B;  3V7X A;  3OIL A;  3M2N A;  1FQM A;  4HT2 A;  4ZAO A;  4ZWX A;  3RZ7 A;  3RG3 A;  3P44 A;  1DMY A;  1I9L A;  1G52 A;  5A25 A;  2HNC A;  1CAL A;  5SZ4 A;  3D8W A;  3M04 A;  1BZM A;  2CBC A;  4QJX A;  1LG5 A;  4JSS A;  5E28 A;  4JSZ A;  5FLP A;  4HEY A;  1KEQ A;  1G46 A;  3OKV A;  2NMX A;  4WW6 A;  4COQ A;  1ZFQ A;  5E2S A;  3EFT A;  4L5W A;  1CA2 A;  1RZB A;  3QYK A;  3P3J A;  5BRU A;  2AW1 A;  2HL4 A;  4YGF A;  4G7A A;  4KUW A;  1CNJ A;  5EKJ A;  3S78 B;  5EKM A;  5FL6 A;  3S97 A;  5DSL A;  3S73 B;  1FSR A;  4JSA A;  1AM6 A;  1BCD A;  1CAH A;  1FSN A;  1ZE8 A;  1ZSA A;  3HS4 A;  4M2W A;  1UGG A;  3CA2 A;  4MO8 A;  4R5B A;  3S74 B;  3P4V A;  4MLX A;  1YO2 A;  5JES B;  4HT0 A;  2H4N A;  4KNI A;  5EIJ A;  1I8Z A;  2WEG A;  1CAI A;  4XFW A;  1LUG A;  2OSM A;  1YDB A;  1I90 A;  3B4F A;  3OYQ A;  4RIU A;  3BL0 A;  3U47 A;  1YDA A;  2ABE A;  2WEJ A;  4TWL A;  3LXE A;  3W6H A;  1CAJ A;  4KV0 A;  1HCB A;  1UGA A;  4Q90 A;  4G0C A;  5DSR A;  3OY0 A;  3S72 B;  4Q83 A;  1TB0 X;  5FNI A;  1EOU A;  1TH9 A;  1G6V A;  5DSO A;  3MNA A;  5EH7 A;  1LG6 A;  4ZWY A;  4QEF A;  3DVC A;  3IBL A;  4LP6 A;  3Q31 A;  5G03 A;  1RJ5 A;  4L5V A;  1CVE A;  1UGB A;  2FNM A;  1CVF A;  1CRA A;  4Q78 A;  4MDM A;  3V3G B;  1ZFK A;  3M5S A;  1V9E A;  3T85 A;  5EZT X;  1FQN A;  1G0F A;  5DSJ A;  5E2K A;  4YGK A;  3BET A;  4FL7 A;  3T5U A;  2WEH A;  3M98 A;  4Z1J A;  5FNG A;  4ETQ C;  4E3D A;  3P3H A;  1KWR A;  4QJM A;  5DSK A;  1LZV A;  3HKT A;  4UOV A;  1CNY A;  5SZ0 A;  3DVB A;  3MZC A;  1UGD A;  2CBE A;  1TBT X;  3S9T A;  3DD8 A;  2EZ7 A;  4CNW A;  4FVN A;  1UGF A;  3OKU A;  1Y7W A;  1FR4 A;  3U7C A;  5E2M A;  5EHW A;  4E3H A;  4K0S A;  1FLJ A;  2NWO A;  3OYS A;  4KNN A;  4Q81 A;  3VBD A;  5DSQ A;  2CBD A;  1MUA A;  4MDG A;  5EH8 A;  3M2Y A;  2VVB X;  5EHV A;  1YO1 A;  5J8Z A;  1G4J A;  1CZM A;  3M2X A;  3IBN A;  5FLO A;  3V2M A;  5E5U A;  2NWP A;  3M1K A;  3S77 B;  4QIZ A;  5E2R A;  1CA3 A;  5DOG A;  4QIY A;  3KWA A;  3DCW A;  4DZ9 A;  4Z1K A;  2O4Z A;  3K34 A;  2NXR A;  4HEW A;  3MNH A;  1I9N A;  2ILI A;  3N4B A;  4ITP A;  1RJ6 A;  1IF4 A;  3MNJ A;  1BNU A;  1CVA A;  1RZC A;  5CA2 A;  4PQ7 A;  5EHE A;  3HLJ A;  4WL4 A;  4CNR A;  4WUQ A;  4KNM A;  5JGT B;  1G53 A;  1CNG A;  2H15 A;  4ITO A;  1KWQ A;  1BNT A;  3UYN A;  2X7U A;  4WR7 A;  3OIK A;  3F8E A;  1FQL A;  1T9N A;  1CVC A;  1JD0 A;  1ZSB A;  4IDR X;  5FNM A;  3D93 A;  3P5A A;  4RFC A;  1HEC A;  5DSM A;  3DAZ A;  4YX4 A;  3W6I A;  1OKL A;  2AX2 A;  5AML A;  5EKH A;  4N16 A;  1IF9 A;  4RN4 A;  2X7S A;  5JGS B;  3KKX A;  4BCW A;  2FMG A;  3DD0 A;  2NNO A;  4YXI A;  5FNL A;  3MHO A;  1CNH A;  4PXX A;  3PO6 A;  1CVH A;  4C3T A;  3R16 A;  3R17 B;  4K0T A;  4Q9Y A;  2EU2 A;  4KP5 A;  4FIK A;  4QTL A;  3M3X A;  2NWZ A;  3JXF A;  4QK1 A;  1TG3 A;  1V9I C;  3NI5 A;  1XQ0 A;  5G01 A;  4RUX A;  1G54 A;  3UYQ A;  3PYK A;  5G0C A;  3D0N A;  4QSA A;  3NB5 A;  1KOQ A;  1XEG A;  3TVN X;  4QJW A;  3KOI A;  5FNH A;  4HF3 A;  3ML5 A;  4YGN A;  2FOQ A;  4PZH A;  4K13 A;  1CNC A;  4FU5 A;  4LU3 A;  1RAY A;  1IF7 A;  1H4N A;  1F2W A;  1I9O A;  3RYY A;  1BNW A;  2IT4 A;  4XIX A;  2CBA A;  4YXO A;  2GD8 A;  4CNV A;  4Q7W A;  2WD2 A;  2CAB A;  1CAK A;  4KNJ A;  2GEH A;  3K2F A;  3IAI A;  3ML2 A;  3RYJ B;  3V2J A;  4YVY A;  3JXH C;  3MWO A;  3RYV B;  2FMZ A;  1YDD A;  3KLD B;  1G3Z A;  3S75 B;  4Q49 A;  4YWP A;  1H9Q A;  5FDC A;  1AVN A;  5EOI A;  3V3I B;  5FLQ A;  4FPT A;  3D9Z A;  5SZ5 A;  5DSI A;  3N0N A;  4ZX0 A;  5AMG A;  3S8X A;  2FOV A;  3IBI A;  1CAM A;  1CAZ A;  2FOU A;  2NN1 A;  3KON A;  1XPZ A;  3OIM A;  1A42 A;  3MNI A;  2HFW A;  2POW A;  4IWZ A;  9CA2 A;  1TTM A;  4QJO A;  4ILX A;  2Q1Q A;  3M14 A;  3T83 A;  3V3H B;  1CNW A;  3IBU A;  4RUZ A;  3M5T A;  3DCC A;  3NJ9 A;  4L5U A;  4CQ0 A;  5DSN A;  1G1D A;  3FW3 A;  3N2P A;  4M2V A;  1KOP A;  7CA2 A;  3F4X A;  4BF1 A;  1BN3 A;  1G48 A;  5SZ3 A;  1CCS A;  1ZNC A;  1BV3 A;  3RGE A;  3P58 A;  2FOS A;  3KNE A;  2QP6 A;  3SBI A;  1CIN A;  4X5S A;  1IF6 A;  2FNN A;  1CNX A;  4RFD A;  4K1Q A;  4E9O X;  3HFP A;  5HPJ A;  1HVA A;  4QJ0 A;  3EFI A;  4M2R A;  3P55 A;  3V3J A;  3GZ0 A;  3IEO A;  5BRW A;  4Y0J A;  1CAN A;  3CYU A;  3TMJ A;  1HED A;  2NWY A;  5FDI A;  2NN7 A;  3T5Z A;  4N0X B;  3V3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...