The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
84
|
sequence length |
252
|
structure length |
252
|
Chain Sequence |
GYVGIKIRLTDVAPQAQELFKKESLDVKENKVYLVAATLRPETMYGQTCCFVSPKIDYGVFDAGNGDYFITTERAFKNMSFQNLTPKRGYYKPLFTINGKTLIGSRIDAPYAVNKNLRVLPMETVLATKGTGVVTCVPSDSPDDFVTTRDLANKPEYYGIEKDWVQTDIVPIVHTEKYGDKCAEFLVNDLKIQSPKDSVQLANAKELAYKEGFYNGTMLIGKYKGDKVEDAAPKVKQDLIDEGLAFVYNEPE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Ligase
|
molecule keywords |
POTENTIAL CYTOSOLIC LEUCYL TRNA SYNTHETASE
|
publication title |
Analysis of the Resistance Mechanism of a Benzoxaborole Inhibitor Reveals Insight Into the Leucyl-tRNA Synthetase Editing Mechanism.
pubmed doi rcsb |
source organism |
Candida albicans
|
total genus |
84
|
structure length |
252
|
sequence length |
252
|
ec nomenclature |
ec
6.1.1.4: Leucine--tRNA ligase. |
pdb deposition date | 2015-02-02 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | Isoleucyl-tRNA Synthetase; domain 2 | Valyl/Leucyl/Isoleucyl-tRNA synthetase, editing domain |
#chains in the Genus database with same CATH superfamily 3ZJV A; 5AGI A; 1JZS A; 4ARC A; 1QU2 A; 1WKB A; 4CQN A; 1OBH A; 3ZJU A; 2WFE A; 1WK9 A; 1H3N A; 4K48 A; 1WK8 A; 4AS1 A; 5AGT A; 3PZ6 A; 1QU3 A; 1WZ2 A; 1ILE A; 1WKA A; 5AGH A; 2V0C A; 2WFG A; 5AGJ A; 4K47 A; 4AQ7 A; 3O0A A; 4ARI A; 1FFY A; 3PZ5 A; 2AJG A; 5AGS A; 1WNZ A; 2AJI A; 1OBC A; 3ZJT A; 2BYT A; 1WNY A; 2BTE A; 1GAX A; 1UDZ A; 1UE0 A; 2AJH A; 5AGR A; 1IVS A; 3PZ0 A; 2V0G A; 3ZGZ A; 2WFD A; 1JZQ A; #chains in the Genus database with same CATH topology 3ZJV A; 5AGI A; 1JZS A; 4ARC A; 1QU2 A; 1WKB A; 4CQN A; 1OBH A; 3ZJU A; 2WFE A; 1WK9 A; 1H3N A; 4K48 A; 1WK8 A; 4AS1 A; 5AGT A; 3PZ6 A; 1QU3 A; 1WZ2 A; 1ILE A; 1WKA A; 5AGH A; 2V0C A; 2WFG A; 5AGJ A; 4K47 A; 4AQ7 A; 3O0A A; 4ARI A; 1FFY A; 3PZ5 A; 2AJG A; 5AGS A; 1WNZ A; 2AJI A; 1OBC A; 3ZJT A; 2BYT A; 1WNY A; 2BTE A; 1GAX A; 1UDZ A; 1UE0 A; 2AJH A; 5AGR A; 1IVS A; 3PZ0 A; 2V0G A; 3ZGZ A; 2WFD A; 1JZQ A; #chains in the Genus database with same CATH homology 3ZJV A; 5AGI A; 1JZS A; 4ARC A; 1QU2 A; 1WKB A; 4CQN A; 1OBH A; 3ZJU A; 2WFE A; 1WK9 A; 1H3N A; 4K48 A; 1WK8 A; 4AS1 A; 5AGT A; 3PZ6 A; 1QU3 A; 1WZ2 A; 1ILE A; 1WKA A; 5AGH A; 2V0C A; 2WFG A; 5AGJ A; 4K47 A; 4AQ7 A; 3O0A A; 4ARI A; 1FFY A; 3PZ5 A; 2AJG A; 5AGS A; 1WNZ A; 2AJI A; 1OBC A; 3ZJT A; 2BYT A; 1WNY A; 2BTE A; 1GAX A; 1UDZ A; 1UE0 A; 2AJH A; 5AGR A; 1IVS A; 3PZ0 A; 2V0G A; 3ZGZ A; 2WFD A; 1JZQ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...