5BQ5A

Crystal structure of the istb aaa+ domain bound to adp-bef3
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
180
structure length
180
Chain Sequence
RKTIDTFDFTAQPSVDERRIRELLTLSFIDRKENILFLGPPGIGKTHLAISIGMEAIARGYKTYFITAHDLVNQLRRADQEGKLEKKLRVFVKPTVLIIDEMGYLKLDPNSAHYLFQVIARRYEHAPIILTSNKSFGEWGEIVGDSVLATAMLDRLLHHSIIFNLKGESYRLREKRLQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Insertion sequence IS5376 putative ATP-binding protein
publication title An Atypical AAA+ ATPase Assembly Controls Efficient Transposition through DNA Remodeling and Transposase Recruitment.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Atp-binding protein
total genus 60
structure length 180
sequence length 180
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5bq5A00
3WHLA 2DB3A 3MRSA 1QF9A 4KSCA 1E1QD 4DT1A 3MMPA 2A30A 2AKAB 4OQNA 4KCGA 1YE8A 3ETLA 5EP2A 4CEHB 4BE7B 2IXEA 3A8TA 1HH4A 5TV2A 2DHRA 2AN9A 1NVWQ 3HU1A 1H8HA 4O2RA 2O8DA 3B85A 2G1KA 4AURA 1WB9A 3KJEA 1W46A 2ZITA 4D0LB 2IL1A 2GKSA 1KJZA 4M1OA 3DVLA 4KJZA 1E9FA 2QZ4A 4N3NA 2AHOA 1MRNA 3W5IA 2WJJA 1RYFA 5GJCA 2N42A 5BW8A 1G5RA 1ZM2A 1DELA 1MR3F 4MQBA 3ADCA 1QHHA 1TX4B 1N0WA 4XTRA 2BEJA 2PEZA 3THWA 1O3YA 4MUAA 2GTPA 4PAQA 1S96A 4M53A 4NCKA 3T1OA 2W2VA 2DWOA 3QPWA 5H8WA 3BD9A 1VCNA 2P67A 3HYTA 3C4JA 2P6UA 1I4LD 2XITA 3ND9A 1G7RA 4FCWA 4R9UC 4US1R 4OKSA 4ZO4A 4TMTA 4TWZA 1SXJE 2IYVA 3TBKA 3BGWA 4ESVA 3IPYA 1KY3A 4NMMA 4N0DA 4L8GA 2BBSA 1EFHA 3NC0C 4LCBA 1F2TB 4MRRA 4Y0VA 3WRXC 2GXSA 5EJEA 3T1QA 5D3MA 1KJWA 2HV8A 1OFIA 3U6KA 1NJGA 2QAJA 3I61A 1KTVA 4P3YA 2WWYA 1XPOA 2EYQA 2CJWB 3Q5DA 4DLXA 4P33A 3AF0A 4HLCA 1G3QA 4XD7A 3RLFA 2AR7A 2DBYA 4CZ2A 5CK5A 1DARA 2YHSA 3BB1A 1UBFA 4DUGD 4D4LA 3BORA 2RGAA 3GJ6A 3QKSA 4TL8A 3LRPA 5G3ZA 2CHQA 5TDHA 1Z8FA 1W4BA 4TN1A 3K9LA 2EYUA 4LOAA 5C18A 1T6NA 4TTRA 1DAMA 4RFVA 2PT7A 4PANA 2FU5C 3KKNA 2J41A 2ZR9A 5GJBA 4JVNA 3X1XA 2R6GA 2J45A 4JYCA 4D6PA 2FDCA 4F4IA 4XH9B 2BV3A 4U00A 1XP8A 4NCHA 1HUQA 3PENA 2JJ1A 1KAOA 4C7OB 1F2UA 2W6JA 4O3MA 4WAUA 4M2LA 4QL3A 4XIGS 3TR5A 4L9WA 4PHFA 4C0QC 2UZ3A 2G0TA 4ZDKA 3FOZA 3QKSB 3PUWA 1XTQA 4II7A 4TL7A 5J47A 4ZIRB 5L3SB 3PJRA 3C15C 4LHVA 1QDEA 4P4SB 5AUOB 5FBVB 3LDAA 1UKYA 4URVR 2GEDA 1WDTA 3KQHA 1T4GA 2ZJ8A 4PQRA 1W0KA 2GDJA 4PHTA 4G1UC 1JR3D 2BC9A 1GNRA 1PLLA 1Q1EA 1IN4A 2EFEB 3SNHA 2QMEA 1GNQA 4GFDA 3RS4A 4BFVA 2V4ZA 4NDZA 2OSBA 2WJGA 2EFGA 2GESA 1ZNWA 2OAP1 5FUYA 3KB1A 2IUSA 1E3MA 1W0KD 1L7VC 4QHSA 5SZJA 2NZJA 1G19A 4DLVA 1G64A 2ZE6A 1T5IA 4M9ZA 4N1AA 1CIPA 5JRJA 4HEJA 1SGWA 4IOLA 1KI6A 3RANA 1ZCBA 5EXPA 4IVQA 2KBFA 1Z0FA 2QY9A 3LO5A 2R62A 4DWJA 3RS3A 4Z54A 5JI2E 1RVDA 3BFVA 4LV5B 4ZDJA 1F2UB 1KK0A 2XTZA 2C8VA 2BJWA 4L15A 4LBZA 3ADKA 1R0YA 4BRWA 3P26A 1FMLA 4PAMA 2REXB 1ESNA 2QGNA 2GRJA 2VF8A 1SHKA 1XJCA 3U4QA 3I72A 2WSSA 3H4MA 3BC1A 2FEOA 4MUBA 3PEVA 3GLIB 3T35A 4IVRA 4ERNA 3ZVNA 1D2NA 1GKUB 3ICQB 3GJ7A 1YR7A 4R2HA 2EFHB 1RC8A 3BBPA 4NCIA 4I1UA 3DOEA 1TEXA 1GRNA 1KO4A 3FE2A 3VNVA 1VG1A 3SJAA 3EAQA 1U0LA 5LD2B 4GL2A 2QE7A 1BIFA 1N6HA 4E22A 5AUNB 3QENA 4NYMQ 2FSGA 1X8LA 2VSFA 2OCPA 4KLNA 1VCOA 3K0EA 1HA3A 4XD7D 3QNUA 4PZLA 4LHWA 1M34E 1HE1C 3CRVA 5FOUA 3UXMA 4D2IA 1ZUIA 1SVKA 1R5NA 3OIWA 5JBQA 3RS0A 3M1IA 3FVQA 2EQBA 4OHXA 2NPIA 1L4YA 4Z8XA 2V3CC 1JJVA 1IY1A 4WZAE 3TNFA 1PJRA 2YWGA 1XF9A 4HLUA 4W5WA 2Z4SA 1CBUA 2X8AA 2CE7A 2Z5FA 3L8ZA 3MAAC 5DN6D 5L3QB 2JLZA 3THXA 2PCJA 2ZRKA 1U98A 4AIIA 3V00A 3CB4A 1NVXQ 1KI4A 4KXFB 4PPGA 4RD3A 3L82B 5J5CA 1E2NA 3T5DA 1E4VA 4JL5A 1E9DA 4DCUA 4LJ7A 4I81A 5EXTA 2LWIA 3K1JA 4LV6A 1COWD 1II9A 4GMXA 5GJVC 1XMIA 4V0ME 2F9LA 4PSKA 3THWB 1GKYA 2QTVB 3H84A 4EFNA 1TUIA 4C0HA 2V7QA 1ESMA 1K6MA 1GOTA 2BJVA 4HZUB 2G9NA 4EJSC 5BN4A 5FTLA 3NIBA 3EZFA 4M9QA 3NEYA 5GVRA 1U2RA 3THXB 1S2MA 5L3VA 1OXVA 1XDBA 2Q3HA 4NPHA 4ITRC 3HU2A 1S9DA 3NH9A 4Q21A 2JIZD 4CDGA 2O5VA 1ZVQA 4URYR 1E9BA 2F1RA 2BKUA 3TIFA 3RRMA 2GEUA 3QVUA 1O87A 2ZI5A 1YVDA 2QP3A 2ZSFA 3U44A 1CU1A 1E79A 1VG8A 5FPYA 2V6IA 4JKIA 5JI3E 1N5JA 2IYRA 4OHWA 3ZIAD 1S3SA 4IDHA 1Q21A 221PA 2UKDA 3EZ9A 1QHHB 1ZNZA 4M8NE 3E5HA 5FTJA 2J5XA 5B58C 3ICEA 2K5UA 1N6NA 2YWFA 5HR5A 1RIFA 2YZ2A 5L3QA 521PA 1JR6A 3MFYA 4XSGA 3OE7A 5A5GA 2JJ1D 3VTKA 3JVUA 2XTNA 2O8FA 5F2EA 1BOFA 2WJVA 3RRYA 2I1VB 2VLIA 4XVRA 1D8TA 1P2SA 1Q0UA 1U99A 1KI1A 5EZ5A 2UVQA 2WIAA 5E3HA 4IOJA 4NBSA 3B6EA 3OZXA 5FL7D 3AVTA 8OHMA 4EUNA 1P9NA 3G5UA 4Q4AA 3KUDA 1P9WA 5FOXA 4DT1B 4A2WA 2R8RA 3KZ1E 3EW9A 4DLUA 1A2KC 3WBKA 5IRCD 4HUTA 1LS1A 4CEJB 2GXQA 2G77B 4Q4JA 2RGEA 1GILA 1XNJA 4DSTA 2AK3A 2GCPA 4PC2A 3GLHE 2RAPA 3TVTA 1R0WA 2BCGY 4JSTA 1U8YA 1E2JA 4A36A 4PO8A 4IDNA 5E7IA 5C2JB 1GSIA 1TPZA 3EA0A 5IF9A 4DCTA 3GLFA 1N0UA 4D25A 2ZANA 1E99A 2JDID 4TQAA 2F55A 3CR7A 3I8XA 3GLHB 2MSDB 5J4VA 1N6KA 1R2QA 4JLOA 3GLFE 2ZRAA 2QAGC 5CLLA 1G291 2R44A 2ZSAA 3DZDA 4HUQB 2I1QA 4BZQA 4ASUA 2GWHA 3SEAA 2DFLA 4LI0A 2R2AA 3VKWA 3VR2A 1XPUA 2W58A 2IYYA 4M1MA 1BMFA 5FL3A 3THOA 5L3SA 2OCYC 2A5JA 2ZJAA 1VYVA 3Q72A 4FINA 3UANA 3ZIAA 5J4HA 1N6LA 4G5GA 4YMVA 1QHXA 3EIHA 1SXJB 3AEZA 4MYCA 4PSAA 2AXPA 5KDLA 1KAGA 2GCOA 1XJQA 4B3FX 4EPWA 2ZIAA 3BS4A 2CHVA 1E0SA 1S1MA 5SZKB 1ZM4A 1PV4A 5JHHB 3KQUA 5F9HA 1TL7C 5FPHA 1H8HD 1JPJA 2ZRFA 3RC3A 4TMVA 1HYQA 1MOZA 2GJAA 2CNWD 1TF2A 3B9PA 3UG7A 1G20E 3KXLA 3CH5A 1FMJA 3P4XA 3QBVA 4NE2A 4TZ6A 4EJSA 1E1QA 1CULC 1LFDB 4OI4A 4U02A 4UNRA 1E9EA 5K8IA 4QXAA 4TLDA 2FFQA 1YJ5A 1W5SA 3OFND 1MRSA 4WBSA 2AX4A 4HAWA 4A0FA 1G16A 1E2KA 2XJ4A 3FKQA 4NU0A 2QQ0A 2WKRA 5FBLB 4IFEA 1BMFD 1X1SA 2VF7A 4F38A 4IVPA 5KSPA 2H5EA 1XEXB 2PMDA 1QHNA 4FMCB 5IK2D 3PCRB 1DTSA 4KV9A 1II8A 1G5PA 4IFBA 4MGKR 4Q1DA 2V54A 2WTUA 4L5BA 3SBEA 3ZVLA 2F9MA 3CZQA 1DG1G 1KMQA 3VX4A 4HB3A 4KAXA 1X86B 4NYIQ 5JJIA 2GVDC 1W0JD 5TB5A 5LB4A 4OYHA 2C78A 3IEVA 3OEEA 3AF2A 2ZU0C 2ZSEA 2G0NA 4PC6A 1AK2A 4NHOA 1H8EA 2PLRA 3C5HA 1M1YE 4X8MA 3HPQA 3W5JA 4TT3D 3TR0A 1VYTA 1P61B 2YWHA 3EZ6A 3LWNA 4MYUA 2D2EA 2OAQ1 4OHZA 4M1KA 4G01B 3L0SA 2KBEA 4FMDB 3GPLA 2NPFA 1I4TD 3GEHA 3K0FA 4QFMA 1HURA 1TQDA 4B3CA 3Q7QA 3AVYA 1ZM7A 2P6NA 2OCAA 2YYZA 3TQFA 3DOFA 4XVUA 5IHPA 4MDEA 2XAUA 4PSVA 2B8WA 1XD2B 1YZKA 3C5CA 5AWFC 1K5GA 1KDRA 621PA 3W6PA 1W36C 2ECKA 2J87A 5L8VA 3GFOA 2JGNA 2BIFA 4FD2A 4KFUA 1SKQA 2QM8A 3FKSD 1KHTA 2PJRA 2WAXA 1OXUA 1XPRA 2WZQA 3TUJC 3CPEA 1CF4A 1OPXA 1ZP6A 3QQ5A 2ZI9A 2BWJA 1MO4A 1XX6A 3K70B 2VPPA 3IHWA 2QM7A 3F5FA 2IS2A 1VG0B 3OF5A 2FA9A 3BK7A 1G8GA 1G18A 2XEXA 2JATA 1LVGA 2GAAA 3FDIA 3MWLA 4QKQA 4CIDA 1SHZA 4LHZA 2NO7A 3GD7A 4QJ4A 4BFYA 2CEAA 1ZUHA 1ZBDA 4FWIB 4YMWA 4EFLA 2XGJA 4YC7A 1SKYB 4D80A 1HT2E 1P2TA 2WJIA 1I2DA 2VHJA 4HAVA 4TSFA 3PEUA 4HDQB 2QBYA 5KHOC 1P62B 2CBZA 3BWDD 4WXRA 3AGPA 4V0MA 1IHUA 5BYKA 3GJ3A 3I4LA 4DSNA 5JWRA 3EC1A 3UPUA 4QNRA 4Q00A 4AC9A 4PC3A 5AJZA 3Q3JB 4ZDWA 1SKYE 1ZM9A 3RYTC 1NKTA 4C2TA 4B3XA 1KI3A 1Q1QA 1W1WA 4Q48A 2O8CB 1CP2A 1WE2A 3CNOA 5JJLA 2CCJA 2VQSA 2V7QD 1R5OA 1X3SA 4FWTA 2NMVA 3AVPA 3I5XA 2O8BA 3KJIA 4KYIB 3D6TB 1ONBA 4LRWA 2TMKA 1VIAA 3GJ4A 1SULA 2A5YB 2AWOA 2C9YA 1LF5A 2H17A 2IT1A 3KKPA 3FHCB 4QM6A 2N46A 4PFSA 5GJWC 4J0QA 4DDWA 5JEEA 5JRZA 2W00A 2ZRGA 1E6CA 1C9KA 1KDOA 4UNQA 2W83A 4AG6A 4Z51A 5KNBA 2F1IA 2WWHA 2YVUA 1AS0A 2DWQA 3N70A 1GAJA 2WJYA 2IBMA 4KVGA 4X8LA 3OIVA 3T1VA 3DMDA 1EFRD 1JECA 2R9VA 3KKQA 4ZPXA 3PEYA 4TLBA 3MJRA 2CLCX 4B2IA 1UBEA 4QJ3A 1ZINA 4ACAA 1AQYA 1E4YA 1ODFA 3PUVA 2ONJA 3QI2A 1OB2A 3IIMA 3U61B 4MGIR 2QG6A 1CR0A 5CDFE 3A1VA 3GFTA 1FPMA 4DEYA 3KUCA 1VTKA 4A0HA 4Q9HA 5HZHA 4RD4A 1OH7A 3CH4B 1F48A 2HLDA 1G8HA 3DKPA 3B1WA 5KDOA 4F91B 2QI9C 4K81B 3ZVRA 1OF1A 1T8TA 4GMDA 5FUXA 3FTQA 4LYFA 2ZJZA 3MG9A 2GEVA 3QKUA 4ILEA 5IDVA 5BYJA 2XZLA 4Q1BA 1FTNA 4HB2A 4IKEA 3NH6A 4PPFA 3BAFA 1I4DD 1WXQA 4UJ3A 4M1YA 1RRPA 3CPJB 1W49A 3V4RA 1CRPA 2HYDA 3JZAA 1FW6A 2HT6A 3EG5A 2J59A 1KSFX 1F3OA 4AYWA 3U3MA 821PA 1P73A 2QPOA 1TNDA 2B8TA 1Z6AA 2OV2A 4DLRA 4ZIRA 4DLSA 3A4MA 2ZE7A 3TJZA 3B8HA 2FPLA 2PBRA 1VECA 3VR6A 3W90A 4ACBA 5HZKA 4AY2A 1SVIA 4JL6A 3RC8A 1IJEA 3RSLA 2VHCA 4ON9A 2E1RA 1XJ0A 1QBKC 3ZZTA 2IHYA 2YINC 3HU3A 1S8FA 1TUEA 4PHHA 2AFHE 4OQXA 1ZAKA 3B2EA 5EQTA 3TRFA 1ETUA 4BECA 2CDNA 1NIPA 1WCV1 4B43A 5FTMA 1AA9A 2VHQA 3KTAB 1X6VA 3LV8A 5JWHA 4EPTA 3H1TA 4NZYA 3TGPA 2B92A 2Y8EA 5CIWA 2GXAA 4S2EA 4GSYA 3NDBB 4E03A 1XTIA 2YKGA 1F6BA 4EAQA 3OEHA 4RCYA 2HF9A 4C9BA 4O2LA 4Z1MD 5JFGA 4AI6A 3F0TA 3ADBA 2C5LA 5FR1A 1JAHA 3CWZA 3RWMB 1T3HA 3CM0A 3QF4A 1KDPA 1T5LA 1Z6YA 3IGFA 2LKDA 4TTPA 3KQLA 2ZUCA 4QG7A 4NYJR 3IEUA 3LAWA 2KB0A 2EU8A 4DXAA 4OI2A 3VR4A 3E2IA 1TF5A 3QOFA 1GM5A 5L3RA 3SYKA 3LD9A 3BH0A 4HLUC 1OE0A 2WVJA 2WSMA 4GZLA 3W3ZB 5F3WB 4WZ6A 3BFKA 3KQNA 1FL9A 1XTSA 4WZBE 4BUJA 5FBRB 1JBKA 2JLSA 2FFBA 3Q5EA 4OI0A 2VBCA 4KBGA 1EG7A 1KGDA 1XMJA 1EX6A 2HJVA 1HQCA 4HI0E 4TQUS 4XVQA 1E9SA 2IUUA 1Z2CA 2OT3B 4MRNA 4YLGA 3TSWA 3CF2A 1KSJA 3ZJYA 4BFSA 3BIFA 4EIWA 4FMCF 5FUWA 1FX0B 2RB4A 3QEJA 3ASZA 2X2FA 3VHLB 1OLOA 5ELXA 1UM8A 1KMHA 3X1WA 2H18A 3HDTA 1PVOA 4NONA 1UDXA 4D0GA 5EE3A 3I1FA 3BERA 4F4JA 2PX3A 4A6PA 4B6FA 4QBHA 1CTQA 1OT3A 5CIQA 4CEHA 2C9OA 3B5JA 1XXHE 4A2PA 1NIJA 4BFTA 1OV4A 3QG5A 4LPKA 3AUXA 3QSYA 4CW7A 5KO2A 1N6RA 3LH5A 4M1WA 4XTCS 1NY5A 3EPLA 2NQ2C 4DDUA 2R65A 1XCGB 2W6IA 4FXPA 2QSZA 4BLPA 3ASYA 3M0EA 1LTQA 4JLAA 3AVXA 3BE4A 3X1ZA 2PJZA 1SZPA 4RFSA 2XB4A 3TUZC 4M0LA 2EWVA 3HP1A 4JJKA 2IHBA 5FBQB 3OFNA 5B64A 1TEVA 1K5DA 2IX3A 1KKLA 3HYRA 5JS8A 2X1VA 2P2LA 4G5SA 1DAKA 1XFAA 1G7CA 2GHIA 5FTNA 2ODBA 1BH2A 1KZ7B 4G5QA 1ZUNB 2FV8A 2B7BA 2A5DA 5FI1B 4H1VA 2D62A 3RNLA 4EDHA 1LW7A 4MGZR 3T34A 4Y0AA 1QHSA 4JLDA 3SOPA 1Z6TA 2D4HA 3SJZA 2KE5A 2Z4RA 2P5SA 1BKDR 1M8PA 2XNDD 4V0NA 4MYTA 3IQXA 4RSGA 1G41A 1XZPA 1NVVQ 3HR7A 4LC0A 3GCGA 2D06A 1P9RA 2JAQA 4Q7JB 4YQFA 2ZSBA 1Z0DA 2W6ID 3IILA 2GNOA 4NKRA 4BGDA 1Z47A 3QG1A 5C4GB 3CW2A 721PA 5F9FA 1WP9A 3U2QA 4DB2A 1XEXA 2PEYA 2GVZC 4TYPA 4ZCIA 1DAFA 4L9SA 4BFXA 4B76A 2IS4A 3QF7A 4UXIA 2GJ8A 2J0SA 4AKIA 4A6XA 1G3IA 3I8SA 1Z3IX 4A8JB 3TAUA 5J4KA 4H9GA 1CKEA 1ZC4A 4IRUB 4EPXA 4JJZA 1UJ2A 2ZAOA 4RD0A 3J81k 3L43A 2CVHA 2F43B 2ZRPA 2AD5A 4JL8A 3R9XA 2F1JA 4PQFA 4DKXA 2BCJQ 2CLSA 4IW3B 2O8BB 3PV0A 1KIMA 4Q5IA 2CLDX 5KNDA 4BZXA 2UZIR 4C0KA 4I1SA 1JI0A 2BEKA 2VHUA 4LV8B 1NNEA 1TAGA 1ZC3A 1J7KA 4JIMA 4C7OA 2Z0MA 3CLVA 1MKYA 3EXAA 2QENA 4NH0A 2Z6VA 1RE0A 1T3SA 1EGAA 3OHMA 4LDJA 5E7JA 2OXCA 3RSOA 5JZVA 1Z6XA 1E0KA 1F2TA 3P32A 4M4SA 1G8FA 2PLFA 2QAGB 2QU8A 2XTMA 3TAHA 2VP5A 2ZJOA 5CITA 5CK4A 2MMGA 1KI7A 4EKDA 3LQRA 2YOFA 3SDZA 4Q19A 2W0SA 2DWPA 2XNSA 3CNLA 4B34A 2V6JA 1N6OA 2ZRLA 4QNMA 4JLKA 5J4LA 1AM4D 2AD1A 4BWYA 3AVUA 4Q7LA 3GLGB 2IYTA 2GXUA 2IYSA 1RRGA 4HDOB 4HZIA 3CWQA 1XD2A 2DPXA 3MD0A 3A1WA 3NXSA 421PA 2WOOA 4GP6A 2JASA 2JLQA 2ZRBA 1DS6A 1EESA 1AQUA 2IXGA 2WIBA 3QKRA 3IBYA 4QOSA 2QPTA 2NO6A 3AP3A 3DO6A 3LXXA 1MV5A 2FZ4A 5LBIA 2OBMA 2NOAA 3MSXA 4F92B 4V0OA 1Z0IA 4YONB 2DYKA 3UK6A 5CDFA 2J0UB 3CRQA 4GRAA 2IA5A 1IM2A 4RCZA 4AWXA 2NIPA 1E9RA 1FQKA 1XRJA 1L8QA 2IYLD 3PFIA 5M04A 1EWRA 1WBBA 2IYWA 3QXCA 4OHVA 2BDTA 2CL7X 5EUQB 3CPHA 3SC3A 1XCPA 2OEPA 2ZYUX 3B1XA 4UXHA 1S0UA 3CO5A 3QKTA 3BJIC 2C95A 4QGHA 4A1FA 2DY1A 4A0RA 1JEEA 3WNDA 3VNUA 1XU4A 2ZR7A 1L4UA 1L2TA 2JLXA 3LLUA 2XJ9A 3NKVA 3A1TA 3PUXA 3LX5A 1FOEB 1A82A 1BYIA 2X77A 1FP7A 3FYHA 3Q85A 2ZM5A 2VHTA 2V9PA 2C9CA 5JSZA 4NP6A 4PR0A 2HCBA 3RRNA 4KFSA 2RGCA 4DLWA 2ZJ2A 2REOA 4GBMA 5JMTA 2IXFA 3GEEA 3UKDA 4KSBA 3A6PC 4TYNA 2ZRCA 1FNNA 4JVSB 4XOIA 5HKKA 3IIKA 2WHXA 1P6XA 2ZJBA 3T1TA 1E2DA 4OI1A 4IXMA 2QRZA 5FFMA 2EW1A 2OE2A 3K53A 1YZLA 4MKIA 1YZUA 1KI6B 1TQ2A 2DR3A 3EZ2A 3NBZC 1TF7A 5LDDC 1P60A 3CRW1 4HLDA 3AP1A 1P4SA 2CCKA 2ZRJA 4RY2A 4B3DA 3A4LA 3IKJA 3RS2A 4DVGA 5JECA 2G88A 4RD1A 3VHXA 1Z63A 2OLKA 3MUFA 1M2OB 1VYUA 4IOKA 2BKEA 4MRPA 3D3QA 4XWKA 2F1HA 1M74A 4YDHB 4MDFA 4EFMA 4ARZB 5FPTA 3TK1A 5JJKA 1I2MA 2QL6A 4C0LA 3LBNA 6Q21A 1E2QA 3G82C 1KNQA 1RRCA 1XCMA 3I3SR 3LA6A 3AF4A 4KHZA 1N25A 4PZZA 4RFSB 5CB8A 2HJGA 1CS4C 4PXAA 4HLQB 3HPRA 4LBWA 1OHHD 1VKJA 5LB2A 3VKHA 3C14C 3N2IA 5JCPA 4L16A 1E2EA 4LYAA 2GAOA 1GRRA 4NYMR 1HTWA 1Y3AA 1Z08A 2QP9X 1NN0A 1P2UA 1J8YF 5KSYA 3FMPB 4Q9LA 3PITA 3VU9B 1G3UA 1P5ZB 1FFHA 3QBTA 2CMKA 3K0AA 4YXWD 4QGFA 2XOKA 4TLAA 1NJFA 4A15A 2ZAMA 1C4OA 1AS2A 5EP3A 4KFTA 1ZJ6A 4O25A 2RKOA 1IONA 2FG5A 3CF0A 1Z0JA 1IN7A 4CEJA 1YU9A 5G41A 5JSZB 3NEJA 1WA5A 1NBMA 4PZYA 3NDPA 4JLMA 4K46A 4PPQA 2O8FB 1UF9A 1NSTA 4IEEA 5FI0B 1NG9A 4LHYA 4MYHA 5UKDA 2ZPTX 4JLVA 4PHGA 3E70C 1D2MA 3MCAA 2QN6A 2CK3D 5TVKA 4DJTA 2GK7A 3KKOA 2QQEA 4IEIA 3P1JA 4D4MA 3VQTA 2RHMA 2WWWA 3SYNA 2GF0A 1Z0AA 2JEOA 4BFZA 4DSOA 1W4RA 4ZKDA 3AGQA 1OXSC 2KWIA 4EPRA 2BBWA 1MT0A 4RZ2A 1E2PA 2E9SA 3QXJA 4TMKA 3BFXA 2IYZA 3VR1A 2G1JA 3B13B 2E87A 2ASEA 1FP6A 3CX7A 1U0JA 1T3LA 1RJ9A 3B60A 4LPSA 3ZGXA 1ZCAA 4Q4HA 4GZMA 1DBSA 5DISB 2ERYA 4JVMA 2ZS8A 3C8UA 3IIJA 1XMVA 5GADl 5E7MA 2QGZA 3DKVA 4V0LA 1G7SA 2PMKA 4I1VA 2FPMA 3RRZA 2ZVQX 1GDDA 3SQWA 3ZS8A 2OBLA 1N5IA 3GFPA 1G1MA 4DLTA 4DUGA 2I4IA 2WWGA 3SN6A 3A36A 4NCJA 4WXPA 1IY0A 2JJ2A 2QT1A 4W7SA 3O8CA 4Q18A 1CEEA 1KSGA 1YR6A 2A5GA 3BXZA 2ZI3A 1X8JA 4DC9A 2JLWA 3RAPR 5FOTA 3ADDA 1OH5A 1OIWA 2F3TA 2GK6A 2H1LA 2VP6A 4TLCA 2O0HA 1HQYE 5FOWA 4V02A 3K09C 4Q7KA 3WYAA 2FX3A 4B48A 1RFLA 1U94A 2BMEA 4NL4H 2P6RA 2ZRHA 1D5CA 5AJVB 2ZSDA 2MSCB 5B57C 1SXJA 2ONKA 4AYTA 2GZHA 3EPKA 2G83A 1W47A 4FW9A 1XB2A 4Q7MB 4DIDA 4GOJA 2VYFA 2V1UA 4DCVA 4A82A 1NMZA 2H92A 3JZMA 5JS7A 4C0BA 1R0ZA 2VP2A 3THYA 2EWWA 1LV7A 1VDZA 1A2BA 2QROA 5IK2A 2PCLA 1GVNB 1T9HA 3TQCA 3AKCA 3WP1B 1Z28A 1Q20A 1D2EA 2QRNA 4Q9KA 2RGDA 1FUUA 2RGNC 3QXHA 4F7WA 1BO6A 2JJ8A 3LW8A 1QVAA 3LY5A 3GLHA 1OKKD 5FBWB 3P27A 4MA4A 1GL9B 4A2QA 1OH6A 2FPKA 3PIRA 4OJQA 2SHKA 1ZNXA 4DCSA 3RWOA 3N5CA 1TQ4A 3RABA 4AG5A 3B1YA 3CR8A 2CNWA 3WHKA 2H7VA 1IN5A 1VMAA 4MH0R 3GLIA 4HATA 3EPJA 1M7BA 1II0A 1OKKA 3CIOA 1YKSA 4LUCA 2RGGA 1JB1A 5AJYA 1UEJA 1GIAA 4B47A 1Q57A 4HAZA 4TMWA 3KL4A 4K8OA 4FN5A 1CR1A 2OESA 2W0MA 4MKFA 2RCNA 4GPTA 2NO9A 4Q66C 4F93B 3B7GA 2X2EA 4DDVA 5EE0A 2ZRNA 3I5YA 1OFTA 3B1VA 2REBA 1GWNA 1VCMA 2QNRA 2CVFA 4CRWB 3THYB 4AD8A 1HE8B 1YZTA 2PX0A 5CM9C 3KTAA 3LLMA 3ZZ0A 2WPDD 4A4DA 3FMOB 2KI5A 3V9PA 4KU4A 3QEOA 2OFOA 5BN3A 3DM9B 2FSFA 4C4PA 2FMXA 2GBLC 4PC7A 2XB2A 3AKYA 3UMRA 4TL9A 2OCBA 1HT1E 1ZM3A 2YOHA 2ZRMA 2RMKA 3IUYA 1V5WA 3WMEA 3H0KA 2ZETA 2PH1A 1KI2A 2O0JA 1XXHA 2ZYTX 1Z06A 3BOSA 3O47A 2JJ2D 2R6CA 4LJ6A 3GP8A 1DAEA 3VKGA 3T06B 2W2TA 2ZI4A 1MABA 3KX2A 3L8YA 5K8TA 4ARZA 4RZ3A 2IS1A 3U6BA 2J9RA 3M6AA 1ZRHA 4HAUA 2VO1A 2A5FA 3H2YA 4DZZA 1NF3A 5F98A 4ESHA 4CEIA 4O0MA 4U5XA 3GLFB 3FMIA 4G3XA 4C30A 3RS7A 4B74A 5FOVA 2BOVA 4URXR 1RKBA 5FL7A 3K70C 3FFAA 2WKQA 1P3JA 4FCVA 1VG9B 5DNYB 3LNCA 2GCNA 4URUR 1NVUQ 3WY9A 3ZZUA 3QVVA 4BLRA 4YMTA 2XXAA 2GBLA 1NY6A 1Z2AA 2PT5A 2ZRDA 1KMHB 1E0JA 2FOLA 3U3JA 3W34A 1RJ9B 3W8RA 2P5TB 4Q1AA 3ZDQA 2BBOA 1QVRA 4IDQA 2ZVPX 4X8HA 3EWAA 121PA 3SJCA 1FX0A 3EIEA 1SVLA 3QUSA 4Z1MA 1VPLA 2XNDA 1YHNA 5TMPA 4Q1FA 3CX8A 1MO3A 3NHBA 4QHTA 2IF0A 4BFUA 4DCNA 5D3MB 5C4MA 5KSZA 2JCSA 2WBLC 1DOAA 2CK3A 1SVOA 1OSNA 1GKIA 3R9IA 5JCZA 3K0FB 3CZPA 3K70D 4LX0A 2IWHA 3PUZA 2BMDA 4CVNA 3LXRA 2CJWA 1QRAA 2Q9BA 2JIZA 2WMOB 1UFQA 1SVWA 2RGNA 2XSZA 4URZR 1DPFA 5KNCA 1UADA 4Z8YA 2ODNA 3WYFA 3A4NA 3IHLA 3FHOA 4D4KA 3U44B 2ZS7A 1OH8A 1AZTA 2WMNB 4CYMA 1DG3A 2FZLA 4DLYA 1JNYA 2OHFA 2C04A 3NG1A 3OIYA 2PZGA 2D3WA 1COWA 4UNSA 2J46A 1HV8A 4UNPA 4YXWA 1LB1B 2ORVA 2P3SA 1S3GA 4HYYA 3U3RA 4GNKA 1FZQA 4DSUA 4B32A 2IYUA 4RD6A 2GJKA 3ZS9A 1A5TA 1NSFA 4TL6A 4A8JC 4GOKA 3Q7PA 5J4YA 1IJFA 4PAOA 1ELOA 4G0NA 2B6HA 2HF8A 4Q1CA 2HT1A 2QA5A 2ZQ5A 4V03A 1VHTA 1DAHA 1NMYA 4QGGA 5DSZA 4C3ZA 4QC2A 4PPNA 3F3YA 4OK3A 3OAAA 5EE1A 5H68A 3W3AA 4HAXA 1C1YA 1GZSA 2X19A 1B0UA 1TMKA 3WBJA 1CRQA 1W5TA 3W6NA 1N6PA 4P31A 4KLZA 1Q22A 2IEZA 2OLJA 3QKRB 1NLFA 1QG4A 2AK2A 4G5RA 1P2VA 1AKYA 1GL6A 5G53C 3EA5A 1J99A 4HSEA 1KZGB 2IS6A 2QORA 1JR3E 3RHFA 1EFUA 1E94E 3K9HA 4YMSA 1NVVR 3C16C 3GLGA 2ZRIA 3I73A 3REGA 4LK2A 4BQSA 2PZFA 1EX7A 2AFIE 3CUEF 3VMFA 5AJWA 4R7ZA 3ZD6A 4IHQA 4I4LA 4CT5A 4M22A 3AKEA 1OFHA 2G6BA 3CRRA 4KO8A 1KY2A 2WSSD 1AS3A 1Y63A 1E2GA 3MWKA 4W5HA 3WP0A 4B73A 3B9QA 3OAAD 4FMDF 1FQJA 2FEMA 4MITA 2CE2X 2J3EA 1H65A 3B1ZA 2G3YA 3O8DA 3X1YA 5KOYA 2OFWA 1G9XA 4ZCLA 3K09A 4RVCA 1LS6A 3WNCA 1CJKC 2IK8A 4JBYA 1E2LA 4B33A 3PVSA 3TW8B 2O8EA 1WF3A 4LJYA 1WQ1R 1XEFA 4NYIR 4P4TA 3TE6A 2OZEA 1W4CA 1EFTA 4QGAA 3U4QB 3QPUA 1GUAA 2VL7A 2KSQA 1KO5A 1JPNA 1TU4A 1S1CA 4DIEA 5KPJA 1XD9A 3LX8A 4TYQA 3NBYC 4Q4JB 4HDCA 1TADA 3F8TA 5A4JA 4HUQA 2C03A 2XSZD 3R20A 4LYHA 5K8LA 1E9CA 1Q44A 3D31A 3X1DA 1U9IC 3BB3A 3OIUA 1GNPA 2BVNA 4BPBA 3CNNA 3FMFA 3O8RA 3SFZA 3KQKA 2HYIC 3CF6R 5K8UA 3C7KA 3L0IB 2NO1A 5KSOA 4QM7A 3Q9LA 1LNZA 4L4UA 1MH1A 4Q1EA 5EE5B 2D7DA 4UQOA 3SHFA 4M1SA 4JZKA 4OQFA 4EQ6B 4C0JA 1R0XA 2C98A 2ZJ5A 3PEWA 3JVVA 1IXRC 1G8PA 5LPNA 4WOPA 2XOKD 1BYUA 1DADA 2GCOB 2QMHA 3EPHA 1P7CA 1UPTA 5AK0A 1AGRA 1G8YA 4JBWA 4QBFA 1PUJA 3V4FA 1JALA 3AV0B 2QSYA 3UMFA 2RGXA 1US8B 1LY1A 5EXXA 2VTKA 4LSGA 1SVMA 1G3RA 1Q12A 2ANBA 2BMJA 1IXSB 2BM1A 3UWKA 1E2FA 5KDDA 3WMFA 3O8BA 1T8UA 2ZU6A 1OHHA 2GJSA 5DI3B 1V43A 1E1RD 2O0KA 2VSXA 2FFHA 2ZR0A 3ONWA 4B71A 4MGYR 3EIQA 1G21E 1N0VC 2IEYA 3KXKA 5KU1A 4AYXA 1ANKA 4JMPA 1G6HA 4Q9IA 3PXGA 1YR8A 3GMTA 2DFKB 3SE0A 1NMXA 4D82A 5HE8A 4EPYA 5CYPA 4BLQA 1CLUA 2VSOA 3SZRA 4BEJA 5LD2C 3CX6A 4HAYA 1W2GA 1G3MA 5EZ6B 3R7WB 1HEIA 5DI3A 4WVFA 2Q21A 2LCFA 2PL3A 4R2IA 3TMKA 3TW4A 1OXXK 2F43A 2RGBA 4BFWA 3ZLJA 3T5GA 2YNMA 4KODA 3OEED 2KJQA 1EFRA 1PLJA 2IYQA 5HTKA 1IY2A 3DM5A 1US8A 5AJXA 4KBFA 1N5LA 2WOJA 5HKKD 4OQMA 1ZD9A 2CL6X 4US2R 4URWR 2ZI6A 3BB4A 4M1TA 5AR1A 1KOFA 2RH5A 2FJUA 1OFUX 2B7CA 3M4YA 1GTVA 3CONA 3IQWA 3AVQA 4M21A 5G40A 1GRQA 1IAQA 4DBLC 1XTJA 3A1UA 1RYHA 4B6EA 4Q01A 3TLXA 4KITB 3WMGA 2HCJB 4PO9A 4RKFA 4KI0A 2ZUBA 2IF2A 3P4YA 3P20A 3ECCA 3DMNA 4XWAA 5HE9A 4B2LA 1CR4A 5P21A 2WWXA 2QP4A 4OJKA 2YC4C 3QXSA 5DLQC 2J0VA 4QBIA 3I62A 1KI8A 1UKEA 1II8B 4ZV4A 1G6OA 1AIPA 4EJSB 3R8FA 1KSHA 4FI3C 2A3RA 2YV5A 2V1XA 3SJBA 1SVSA 1Z07A 3OESA 1KK3A 4KFRA 3KKMA 1XD8A 2NTYC 3T15A 1M7HA 3TKLA 1J2JA 1E9AA 1NL3A 2CCGA 3SU8A 2FF7A 1EK0A 5BN5A 3IO3A 5FPKA 1GITA 1J70A 3RVBA 1Z5ZA 3W9YA 3U5ZB 3VX3A 2ODEA 1DVRA 3KXIA 4HZUA 1UBGA 2QMUA 2XZOA 2YC2C 3TSOA 2JLYA 4FIDA 4UKDA 1XBTA 3G0HA 3SI7A 2P0EA 3DZ8A 2HDNB 3CKLA 4PC1A 1R7RA 4ZI2A 3FFBA 3HR8A 4H1UA 2XX3A 2FNAA 2C2HA 2J7PA 2BMFA 4LC1A 4Q9JA 2ZS9A 1X1RA 1SXJD 4B44A 4TYWA 4A8JA 4PO1A 3EC2A 4CEIB 5AUPB 3PG5A 4MKHA 2JDIA 4JLBA 1GG2A 2NO0A 4TMZA 5TARA 3EASA 1E2MA 4M9XA 5E4FA 1BS1A 2VEDA 4ZCMA 4BLTA 2WV9A 1NRJB 3D8BA 5EP1A 3AP2A 4A9AA 3A1SA 1GL7A 4D26A 2ORWA 5EXSA 5H1YA 2B21A 3R8CA 2GILA 1R8SA 3NHAA 5KUTA 1YRBA 2QMOA 1G17A 2YJTD 5JHGB 5AUQA 2GETA 3TUIC 1DAIA 3I32A 2FN4A 2GZDA 3FGNA 1R8QA 4LJAA 4B3BA 5HCNA 4TT3A 5FH9A 4DLZA 1CJVC 3A58B 1XTKA 1S9HA 1XWIA 2VP4A 3FPAA 2J0UA 1NI3A 2OM2A 2WPDA 5D3QA 1W0JA 4PQYA 3EZ7A 1KO7A 5B2ZA 5DGXA 1M7GA 1W2HA 1Z6GA 3KDSE 3L0OA 1ZD8A 2D74A 3D7MA 3SS8A 2ERXA 1DO0A 2HUPA 4B75A 3DL0A 4WA7A 4ZI3A 4Q4AB 1RPZA 4CF7A 3CRMA 3LQQA 4LZZA 3GJXC 1VIYA 1KO8A 3PR1A 3OEHD 4IOMA 3AF3A 4P4SA 3WRYC 1QZXA 2JLUA 1WBDA 2IW3A 3UIEA 1YR9A 2J7KA 3NTUA 3BH6A 4AKGA 3K8YA 1JXMA 3SQXA 4BLSA 2GZAA 4EPVA 4IXNA 1NBMD 2O52A 1QHIA 2Q3FA 4HB4A 3A37A 5JEDA 3AUYA 1X8KA 1NLZA 5DI9A 2R6AA 3L2OB 2H57A 2ZROA 1SQ5A 4WW0A 1HY3A 2IC5A 4GOXA 4OQLA 1AGPA 1Q3TA 4KYUA 4BRUA 4M9SA 3VR3A 1UKVY 1PLKA 4BLOA 5HCIA 2ORIA 3VFDA 1G4AE 4JVLA 4ASUD 1KK1A 4JYBA 1CJMA 3LFUA 5DE3A 1NBME 2P65A 3K0CA 4JT4A 1DO2A 2ZREA 5TXGA 3SYLA 4AKEA 3KJHA 5DO9A 1ZU5A 3IPXA 3K9NA 3SBDA 2AXNA 4DB4A 1Q3HA 1G5TA 5DYGA 4LHXA 5BWMA 2V55B 3U3OA 1Q1BA 5EP4A 1W48A 4E07A 3U60B 1W44A 1YRAA 5FPSA 5JLJA 2BBTA 1Q1ZA 3TSZA 5CLQA 2OO7A 4RJLA 4GI7A 1CR2A 1XXHB 2AKYA 1QHYA 4NTZA 2Q9CA 3QXXA 2FE4A 2QTHA 3QY0A 4Q4HB 4ZDIA 2R6DA 2XXAB 2WWIA 1N5KA 1YQTA 3I92A 4B2PA 3NBXX 5G3YA 4QBGB 2JLVA 4D4JA 3DHWC 1U81A 3GJ5A 4Q02A 5EUMA 1W4AA 1ZD1A 2N1BA 2OFXA 1E1RA 2ZE5A 4PTLA 4TQ9A 4ZKEA 4XJXA 5SZHB 2AL7A 1OYWA 4LBVA 2EFCB 3EX7C 2QTFA 3B78A 1N2CE 3T61A 2IUTA 1UAAA 1NLYA 1UEIA 1D6JA 1PUIA 3X2SA 5CYOA 1IOZA 1MABB 2FGJA 1YZNA 2L0XA 1DAGA 2DFNA 2C96A 2OBNA 5SZIA 3TH5A 4POAA 1OYYA 5KPDA 3K0AB 3DDCA 3W6OA 2C99A 5KTYA 4RZUA 3AM1A 3VR5A 3U7FB 4QHYA 4LGMA 3LBIA 5BXQC 3AVWA 1E79D 2WM9B 3MJHA 2NZ8A 4DDTA 2GA8A 2PZEA 2ATVA 3DPUA 1JAIA 1OIVA 3MWJA 3QJYA 4DHEA 1E98A 2GF9A 3AF1A 3HWSA 2I3BA 4JLNA 4OL0A 2A9KA 1T0HB 1ZIOA 2CL0X 3NWJA 3U7GA 3GJ8A 2ZE8A 2YOGA 5CJPA 4OK5A 1VHLA 2ANCA 1WMSA 4W5JA 2A7QA 3SHWA 5C1BA 2O8EB 1OXTA 1RZ3A 3AH8A 2ZYWX 3EWSA 3Q8XB 4I99A 1KKMA 1P72A 4TSFD 2CXXA 3B82A 3FHTA 3KJGA 4CT4B 4MKGA 2V8OA 4Q03A 4GDFA 3RDPA 4IJMA 1R4AA 4A0GA 2ZXUA 2H8KA 4XWOA 2AWNA 2D7CA 5DHFA 2EFDB 4JSYA 4N0EA 2JLRA 4YMUA 1D9XA 3MLEA 2R6FA 1A1VA 1JEDA 2W6JD 2ZJYA 1U0HC 1ZIPA 3NVAA 3RS5A 1Z29A 1TQ6A 1JJ7A 3ZYCA 1ZMXA 1KK2A 4QRHA 3ZD7A 5DN6A 1F5NA 2RHDA 1NN3A 1JQLB 1R10A 4NCNA 1RRFA 2C77A 3K0SA 1E96A 3NBFA 3FKSA 4EQ6A 1A7JA 5A0FA 1NKSA 3H86A 1G7TA 2MSEB 1NP6A 2MMCA 4I1OA 3LW7A 3K0CC 1IN8A 1XZQA 4S35A 4P0TA 1IQPA 1TU3A 4DEXA 5ANRB 4AKHA 4Q4LA 1T91A 2FSHA 2HLDD 2Q6TA 3ND8A 3ZVMA 2Z83A 1YZQA 4LJ5A 5DHAA 1IXZA 1OIXA 1JXOA 2F7SA 5FR2A 4TZ0A 1GFIA 4OK6A 5CB6A 2QE7D 1FUKA 1B23P 2ODWA 1FNMA 2LKCA 5FOSA 1OJLA 2HXSA 1DE0A 2ZUDA 1EWQA 2QT0A 2WAYA 4P32A 5E95A 1P75A 3IO5A 2ZTSA 5FUVA 1U8ZA 2O8CA 1AN0A 1U9IA 3KFXA 5DYIA 2QEQA 2FWRA 4PX9A 4RD2A 1E2IA 3LVQE 3U7HB 2JA1A 1N3BA 2H16A 4HB0A 1H8ED 3ZH9B 4TYYA 4LJ8A 2Q9AA 3KFVA 1KNXA 1Z0KA 2A2ZA 1OW3B 3WXMA 4GT1A 2VP0A 2FH5B 2VP9A 5HPYB 4JT2A 3W8NA 1AJEA 4C0AC 4LJ9A 3S1AA 4KVAA 3S1AB 3NC1C 3PUYA 4C0SA 4TTQA 4D0NA 4B3GA 3T12A 1W36D 3QF4B 5TY0A 1JQJC 3BRWD 5IT5A 4A92A 1J90A 4LBYA 1SXJC 3LBHA 1U8AA 4F4CA 1E69A 4BASA 2WJHA 4JS0A 5H70A 1VCIA 3R7WA 3PQCA 1XTRA 3HJNA 3EARA 4NYJQ 1KYIA 2YWEA 4MRSA 3FWYA 5CJ2A 3AKDA 1XEWX 3TVDA 3IBGA 1XEWY 2OUKA 4XSHA 1Z22A 2CHGA 4IDOA 4WIAA 3FB4A 3AQ4A 1E2HA 1DEKA 1T0JB 4TLEA 1KJYA 3E1SA 2ZI7A 4RKEA 4JLJA 1XMSA 4OBEA 1ZYUA 2VIIA 1CXZA 1Z83A 2QBYB 1KI9A 1ZU4A 3GLGE 4US0R 3BH7A 2ATXA 1JR3A 3WNBA 1W7AA 1MO5A 2QAGA 4UJ5A 2WKPA 2FGKA 3AVOA 2EVWX 1AZSC 3KB2A 2J1LA 2OXRA 5GVSA 1UDWA 4BZPA 1EFCA 3LVRE 1QG2A 5KYKA 2NGRA 2DCUA 2HEIA 1G4UR 1IBRA 1FTSA 3SR0A 5B30A 4JLPA 3UWOA 2FSIA 1KO1A 3UG6A 3C41J 1NG1A 4RZXA 4TMXA 1QHGA 5DH9A 3N2EA 2ZYVX 1E32A 4R71A 4Q47A 3IDQA 3VAAA 4JKYA 2O8DB 2A78A 2VH5R 4FMBB 2Z43A 4QJ5A 1NN5A 3GJ0A 2QUZA 1U90A 4G5OA 3GLIE 4E09A 4UNNA 4U7DA 1ZNYA 3REFA 3CBQA 4AK9A 3L0PA 4X8OA 5CM8B 1UKZA 2F3RA 5FTKA 1WRBA 3U7EB 4LY6A 4ABYA 3VU9A 2J0QA 1KDTA 2VA8A 2WWFA 2OILA 2QPAA 3K9GA 4LYJA 3QPVA 1S4QA 3AVVA 1AKEA 1UBCA 4OHYA 4C2UA 2W2XA 3SFVA 2Q0HA 3DEFA 2IYXA 5JWOA 1J8MF 2BHRA 1A4RA 2DFTA 4CGZA 3GEIA 4GP7A 4YDSA 4JBXA 2F6RA 3UATA 2GJ9A 2NG1A 3UMSA 3U3KA 1PZNA 1YZGA 1ZW6A 2D2FA 2HXYA 2XZPA 2IWRA 3R9WA 4BEBA 4LWZA 1W36B 4LJ4A 5EE9A 2J7PD 3WYGA 1IN6A 1RW4A 3MWYW 1CJUC 1EXMA 1R5BA 1M6NA 3OE7D 3QE0A 4R98A 4FCTA 5C46F 1NN1A 4P4UA 1MO6A 1TTTA 4DRZA 2BM0A 4E5UA 1D9ZA 2Q3MA 3MGCA 5J40A 4MRVA 1E0AA 2FFAA 2OG2A 3QIAA 4V0KA 4D81A 5DIFA 1LF0A 3AB3A 1OB5A 1N6IA 5BQ5A 1R6BX 4IDPA 2WICA 2ZEJA 1F60A 3GQBA 4B35A 4W9MC 2VRWA 3ZQ6A 1CJTC 1GP2A 1K8RA 4UXJA 3ZQJA
chains in the Genus database with same CATH superfamily
3WHLA 5AVJA 3DW1X 2H6EA 3JTEA 1ZN7A 4RVFA 5C8VA 4DMCA 1QF9A 1GD1O 2BW0A 4ROTA 2B8EA 3MMPA 5B1DA 1ONNA 4ATNA 2AKAB 3BIJA 2J32A 5EP2A 4BE7B 1PJ8A 2PUHA 1ZI9A 9MHTA 5A3VA 1M1YA 1IZZA 2C0CA 2I2CA 2XGGA 3HC7A 4ONEA 5HS6A 1GZDA 5CNKA 2J3DA 3D02A 1ODJA 5CVVA 2NXWA 3HU1A 4EARA 4WBXC 4J8PA 4NBWA 3LXUX 4AURA 1WB9A 1ZK2A 4L0CA 3KJEA 5G1NA 4O6VA 3UV7A 1KJZA 2ONZA 3DVLA 1E9FA 3JATA 1HKUA 4N3NA 3HADA 4LZOA 2QVBA 5BW8A 3ADCA 1YE3A 3EGXA 3BK1A 4Q37A 4EJ2A 1UIRA 3GLKA 4HYEA 2IHUA 3U4DA 3THWA 1J0EA 1OUMA 4GMKA 1O3YA 4MUAA 4KLCA 2X7HA 4PAQA 4NCKA 2JG3A 3T1OA 2P75A 3U4AA 2HEGA 3BAZA 3QPWA 4TLMB 4TZKA 4X5OA 3HR4A 4ND5A 1O96A 3RTCA 1L6IA 2P6UA 3LZ6A 2FR1A 3ND9A 4FCWA 4CDNA 1NTOA 4OKSA 3AF6A 3AFNA 4L51A 1IQ0A 4FU0A 1KY3A 4C6HA 2ZGVA 3KOMA 3QYPA 1NR1A 1I36A 2XXBA 4KQFA 2LIPA 5HF8A 1EFHA 2OHJA 1N2OA 2JJQA 3HVIA 2HY7A 4LCBA 3BWMA 1GR0A 3TGLA 1Z18A 1Y81A 2GXSA 5CB0A 3WKDA 5CIYA 1E6UA 5D3MA 1TUBA 4N5MA 1G4HA 4L57A 3WZLA 3I61A 4GPBA 1N32B 4R6XA 3J80A 2WWYA 2Y99A 2EYQA 2ZSJA 1Z8HA 1XPOA 1ODIA 3AF0A 4HLCA 1V8DA 5HM6A 1D03A 2NZ2A 3GGJA 4XD7A 2AR7A 4HYQA 4XPIB 5HIKA 2QTZA 3S68A 1YBAA 3FZNA 4MAFA 4DUGD 1A0OA 2J5KA 2ZJ6A 1Y8AA 4JENA 1JYSA 3C70A 3TD2A 1PWXA 4WGGA 3WK8A 1J2EA 4UNIA 3DBHB 1EWTA 5K3DA 1KAMA 2OC4A 4N8DA 3TKAA 3OX2A 3NCHA 2G4CA 5D8DA 3T4XA 1I32A 3DLCA 4I9GA 5C18A 4RPIA 4XQCA 1UBUS 5AVXA 1U0FA 3HCWA 4G63A 1DAMA 4RFVA 1C3VA 3QEMA 4DOMA 4PANA 2FU5C 2V7GA 1P7VA 2J41A 2ZR9A 3KKNA 4G23A 1JIIA 5GJBA 4JVNA 2RHLA 3OE1A 4OB8A 4RVNA 4IFTA 4QDJA 1NC3A 1ONOA 4JYCA 1GQ2A 3DOOA 3CE9A 1DIOB 5JFTA 4BVBA 2GR9A 2QKYA 2JHAA 4ND4A 4U00A 4L1KA 4NCHA 1HUQA 2JIPA 3PENA 1FU4A 4G56A 2C4VA 4EJ0A 2XT6A 4QOIA 4M98A 3EPRA 4JQZA 4C7OB 4IGFA 3ABIA 2BZ1A 3ENQA 3WFJA 4WAUA 4XIGS 4MQ4A 5KOIA 4L9WA 4C0QC 2UZ3A 4KP7A 4KR6A 4HDMB 4EECA 1O0CA 3EISA 4TL7A 5ERYA 1NUAA 2IXBA 3WJ2A 5AUOB 1QDEA 3K9CA 4EYSA 4URVR 3TCKA 3LPMA 4M0FA 5K51A 1W0KA 1OTHA 4FT4A 3ZD8A 4EMUA 2JGAA 2UZ0A 1E5DA 3AEKA 3STWA 3TJMA 1JR3D 3ZU2A 4M9RA 1IN4A 3G1TA 2FUG6 4D41A 1ZK3A 2X9GA 3M6LA 2FUEA 1LI5A 4WOBA 1GNQA 4GFDA 4UZFA 2DLNA 3IS3A 5DHSA 3RS4A 4BFVA 4YUZA 2XF2A 3BN3A 4NATA 3SYMA 4MV7A 4QQNA 5IMBA 2EFGA 2C3YA 4J90A 1YUMA 2Q5JA 3O4RA 3EDQA 2EZUA 5A05A 4ARAA 1GXSA 2C9ZA 3FCAA 1ZNWA 4PZ0A 5ESWA 5FUYA 1XZCA 3KB1A 4J0JA 4U6NA 3UH1A 4AAYA 4E31A 1FDUA 4LI3X 1M9NA 2OP1A 4J29A 4WBNB 3FYUA 3JQ8B 3W6UA 1SJ9A 3IMGA 1R8XA 1YBHA 3WKBA 2ON6A 4DLVA 5AKKA 1G64A 2ZE6A 2HB6A 4KQ9A 4QO7A 1STOA 5EZYA 3QJ5A 4HEJA 4IOLA 1DKNA 5BV7A 3L7OA 1KI6A 2QZSA 3DYBA 3K9FC 4KREA 4I8IA 5FLYA 5L3ZA 1VJ0A 3PC7A 3AESA 1Z0FA 4YJ3F 3O2JA 1MENA 1TCBA 1D1TA 4LV5B 1SIUA 4DLNA 2VK1A 2PZ8A 4DSAA 2BD0A 1LFAA 1I7SB 3I9JA 4L15A 2ISCA 4AT1A 5IU6A 2DX7A 1YCDA 1WO8A 1X7XA 1JA1A 1M1NB 2EG5A 3PQ4A 4HL6A 4X1KA 4BRWA 5JQGA 2CWWA 2O1EA 1K66A 2AC7A 2VF8A 2GO1A 3O21A 4KQ2A 4BNHA 1W5FA 4BVHA 2WSSA 3OKCA 2AYYA 1DQYA 2FEOA 1EYZA 3JAKA 4BNUA 1T8WA 4C6TA 4FTWA 1HLGA 4V1CB 3GLIB 4R3NA 1GKUB 3GEBA 4NXNB 1L5VA 2GYUA 2HQSA 5CXXA 3M4NA 1L7EA 3ENWA 3LPAA 5EZQA 1FXWF 2CJFA 4I1UA 1KZ4A 4KQWA 3DOEA 1AZWA 1TEXA 4FYHA 5JALA 3IUEA 5E38A 1QV7A 3EAQA 5CFNA 1U0LA 2EGUA 3BSWA 1PZXA 5KOJB 4FOSA 2UU9B 1QGZA 2PWAA 5I8ZA 1RADA 1BIFA 2QL5A 2HZ7A 2QE7A 2VEOA 2VQ3A 3QENA 4IGAA 4BV2A 3MRXA 3K96A 2CUTA 2NV6A 3OLCX 1O77A 1JP7A 2A86A 3DO8A 3OJCA 4I50F 3UM9A 4LHWA 4EG6A 1M34E 1HE1C 2NTJA 3DV0A 3HJHA 1H2XA 1NBOA 1VP9A 3FM9A 3MB8A 3QXGA 5FA8A 3UXMA 4WBNA 1R5NA 1YJQA 1TO6A 2W4QA 3BWEA 2NP7A 1NOJA 1EIWA 1DQRA 3W78A 2B34A 4CU5A 2I99A 4L4ZA 2EQBA 3UPDA 2H1CA 2NPIA 3ST7A 1L4YA 1JQKA 1WSDA 2HV9A 3WTBA 1IY1A 3MT7A 3T5BA 2HHHB 2XD9A 3UKJA 3U19A 4P3OA 2JZCA 1T9KA 1J5EB 2UUOA 3OCWA 4MULA 2II6A 1XF9A 2YWGA 4HLUA 3BWBA 4W5WA 2WB4A 3N76A 1FSFA 5E9QA 2CE7A 2LRHA 2OZLA 2H8GA 3JASA 3THXA 1GRVA 2J9ZB 4XVCA 1T2NA 3ER6A 1RM4A 3CB4A 3DMPA 5JAUA 2OTCA 4YI5A 5IEJA 3QVWA 1CY6A 4HNQA 4CMHA 4PPGA 5K0LA 4KK4A 4RD3A 4EI9A 1E2NA 2ERCA 1E4VA 3T5DA 4DG9A 3JQAA 3O3OB 4LJ7A 2ZAGA 4UPVA 1R6VA 1R4ZA 1II9A 4GMXA 2G5TA 4J75A 1EP3B 2IPXA 3JALA 4LV6A 4MR7A 4A26A 1GKYA 4EFNA 2RJ3A 3RVJA 1CWUA 1TUIA 1L7QA 3KWJA 1JG7A 1W0CA 5GVRA 4IV0A 1S2MA 1PU2A 3T7IA 3BIOA 3M6MD 1OXVA 3Q11A 5TMBA 3EHDA 4X93A 4D02A 1VSUA 2FWMX 3ZHTA 3HU2A 1S9DA 2NU7B 3D4IA 3NH9A 1I2BA 4Q21A 2WK1A 2J6HA 1Z2OX 3QVTA 5K0TA 3GP5A 1M2FA 3NEPX 4AJLA 3I76A 2JGDA 3TLKA 3ODPA 2F1RA 3D43A 1XAHA 3TRJA 3RYFA 1JU4A 1GA6A 3BF8A 3VGJA 2FPSA 1O87A 1YVDA 2RHOA 3IEKA 2WABA 3U44A 4RY9A 1EQUA 4MYDA 4JKIA 4LMRA 1Y5NA 5DB4A 4E5MA 1CE8A 1V7PC 5JNLA 2HFJA 1DMRA 4OHWA 2AZXA 1S3SA 2UKDA 1U2DA 2Y1LA 3CV3A 4AJ1A 1QHHB 1WVIA 1ZKDA 3E5HA 5LA6B 4TKLA 4CHTA 4B4UA 1U7PA 2H0RA 2K5UA 4D96A 3OURA 5HR5A 2YHIA 5L3QA 1P1CA 4ZO6A 1JR6A 3OE7A 2XY4A 3VTKA 2VNAA 4Q7QA 3DV2A 4G1CA 4FFNA 1DC8A 3RRYA 4KQEA 5CHYA 2O2DA 4YP0A 3ZDXB 3OHPA 1O5OA 1U99A 1WHSA 4XVRA 1KI1A 1XTZA 4RK0A 3M7IA 3W06A 3SGLA 2B30A 3NWPA 3LJKA 3HCDA 4PYLA 3P0EA 5FL7D 4ZU6X 4WOJA 8OHMA 3ZBUA 4RXMA 2CY0A 4EUNA 5A62A 2QL7A 4U7TB 4NZPA 2CMHA 2GPBA 4XWTA 2MCFA 3GZNB 1OAOA 5EIBC 2JNWA 3R9XB 3SEQA 2DBRA 1R12A 4J3JA 1DEXA 2XI4A 3PQDA 1NJ1A 5DYYA 3AR6A 5FHQA 3SR3A 3QLUC 5HUJA 4EB8A 1H0KA 1M72A 1AMUA 2X0NA 3ENVA 4PLZA 5ALZA 3NYQA 5EPEA 4V0SA 3O91A 3ESXA 3MFQA 4N6NA 1JS1X 2GCPA 2AI1A 1R0WA 4CV2A 2R66A 4WE3A 1H9CA 1A9OA 1BRMA 3OUZA 1E6EA 3P0JA 1ZK4A 2FFJA 2H3EA 3KOWA 4H17A 5ECGC 5C2JB 3EA0A 3GLFA 3KB6A 3SG0A 4JR0A 3E61A 3OSUA 1T2AA 3INNA 2J09A 4MQFB 1SHJA 1MIOA 4ND6A 1QTQA 2JDID 4KQIA 1CEYA 3TG8A 3OJWA 4QTXA 1QV6A 4E5DA 3I8XA 3B51X 4JUFA 4EA7A 2B4AA 1NAIA 3L0ZA 3X1MA 1BHO1 2PE5A 4Y2XA 1ORDA 2A58A 2ZRAA 1GNLA 1C0PA 5AKLA 5LP6B 3K1YA 1DIRA 3DNPA 1C0LA 3KWMA 4WLOA 2PMBA 5K6AC 4UU1A 1VBFA 4YRBA 2CLEB 4CIAA 3DZDA 1CVLA 2IJGX 4HUQB 4PCLA 3UENA 4BZQA 1M2GA 3MJ4A 1NZFA 3SEAA 2DFLA 4LI0A 1A3CA 3DMGA 1XPUA 5FL3A 4M1MA 1BMFA 3THOA 5EJ9A 4MYRA 2FVYA 1QORA 2A5JA 4FINA 3Q72A 5J4HA 4BB5A 1RI5A 3MMZA 4UHDA 5DXJA 4HAOA 1Q0PA 1QHXA 1SXJB 3AEZA 2AXPA 1I7PA 4FNGA 1XNRB 4L07A 1XRRA 2AEMA 2G17A 4B3FX 2R5NA 1U1GA 2ZIAA 3DXFA 3FB1A 4EPWA 2JKYA 4G9GA 2CHVA 1E0SA 5JSQA 1ZM4A 2P69A 5KQSA 1PV4A 3O1LA 5F9HA 3RSCA 1MOZA 5I7FA 3OZ7A 2XDWA 1XQ6A 3B9PA 1C7FA 1NA5A 5FHRA 3KXLA 3CH5A 2JLBA 1I94B 2X7XA 1KC3A 4E7PA 3ERCA 4CIYA 4W1RA 2EP5A 3K1TA 1CULC 3NT4A 1E3JA 5KTSA 3U3XA 2Q1WA 5K8IA 2HIAA 4TLDA 2QZ9A 4TKZA 3B6IA 2PRYA 1M76A 1MAHA 5C8YA 5T3UA 4WBSA 2YWRA 5CW1A 2Y77A 3DCYA 4RQBA 3U7QB 2XJ4A 2FP4B 4NU0A 3GQVA 2WKRA 4CMIB 1KBZA 3H1BA 5CNJA 1UKBA 4F38A 1EFAA 4IVPA 4KNYA 3O4JA 3Q8KA 1C5KA 3I0NA 1IBMB 1ZN8A 2WF5A 1II8A 4IFBA 4I7EA 4MGKR 4MQLA 2FPPB 2ID4A 4YP5A 3VC1A 3IT2A 1BC5A 2WP8J 3D6AA 3NHLA 4LSZA 1ONSA 5J2TB 4L2IB 4HEQA 3LO8A 3IAXA 1XZAA 3SBEA 3WB1A 2O8VA 2PSSA 3CZQA 4ER6A 4AB1A 1J1UA 1X86B 2PX4A 1HK7A 1ID1A 3ASUA 5TB5A 3QKIA 4OYHA 2EXXA 1Y34E 2IYOA 1VJ5A 3IUQA 4QRIA 2O5EA 2VDUE 3FAKA 1KYXA 1XR3A 2FVXA 4ZHSA 1FUEA 3CLUC 5TGDA 4GGMX 2EZ9A 4NHOA 4UVEA 3KD2A 1XMPA 1VYTA 2YWHA 3M1YA 3JR7A 4FKMA 3FPFA 1MFZA 3FHLA 3FPCA 4MYUA 3UAWA 4YWJA 1S7CA 4M1KA 3G5AA 3SZGA 1LK0A 1L7NA 1U8CB 5AK4A 1C9NA 1LZKA 3I6ZA 4K26A 4OHRA 4QEDA 4X3OA 4FEYA 2C3MA 1PJCA 1OLUB 3K0FA 3K9BA 4HWOA 4WFJA 4OHCA 4X97A 2CXRA 2J6BA 2W2MA 2GUGA 2Q4OA 4NMWA 3TRDA 2GN9A 1ZM7A 3AONB 4BNMA 3FF1A 2DR2A 1ZA2A 2YYZA 1CF2O 2ZJ4A 5B5SA 4XVUA 2OHXA 5DNWA 1R0BA 2B8WA 1YZKA 1EFPA 3A0UA 2B61A 4FFWA 1KDRA 4GXNA 4K28A 3W6PA 5DPMA 1XU9A 4NS4A 4IWNA 2NSHA 1A5ZA 2BIFA 2VT6A 3PTAA 3I64A 4FD2A 1F8GA 1H2FA 2QM8A 3FNBA 2PRSA 2ZM6B 1KHTA 1FDVA 1FPQA 2NV2B 2RSLA 1C8BA 1OXUA 1PDWA 2A9OA 4FFSA 4JHXA 4F2DA 5BWOA 4ZU3A 5LZ8A 1OPXA 5FO1A 5LLTA 5DCWA 5BMVA 1MVNA 2POCA 5AQ1A 1ECJA 1MO4A 4OSEA 4HQLA 3K70B 3DHEA 1U2GC 2QM7A 1N2IA 1DWPA 1SU8A 4HNAB 4PGMA 2PUJA 4RMHA 1JB9A 4WXMA 5TEWA 1V8FA 3OF5A 2J9XB 1G8GA 3GC6A 2EIHA 3K6SA 3MWLA 3JD3A 5EWLA 1ML4A 4Q1VA 4BVGA 1ZNQO 2DKOA 9GPBA 2R25B 3AEXA 1QLJA 1SHZA 2NO7A 4RDIA 5DEIA 3UJ8A 1I6LA 2G4LA 5IS2A 2CEAA 1QRRA 1PWEA 4YMWA 1A9ZA 1S2NA 4EFLA 1G66A 1WNFA 1LBSA 2GLXA 5G4KA 2OO5A 5IVIA 3RSQA 1I2DA 3Q8LA 3I05A 2R48A 2NUPA 2HMYB 1QZUA 4H7PA 4NG5A 4NOMA 5ALLA 3NM4A 4ZOAA 4KG7A 3JQ7A 4G5HA 4I4IA 4AZ0B 4D42A 2QBYA 3N0XA 2CBZA 1BFDA 3BWDD 3EAGA 3Q0IA 4WXRA 4XGRA 3USES 2XMZA 4F71A 5JWRA 4HH4A 1I2AA 1BWPA 2ENUA 4B4WA 2R5WA 4HNTA 1BDBA 1BROA 4PC3A 4AC9A 1KS9A 1E1CB 3QA9A 4GE3A 5CA0A 3W8FA 1ZM9A 3D3NA 2FPIB 4CTKA 1U8EA 4QOHA 3K0HA 1CP2A 5JS1A 1WE2A 3CNOA 1FYVA 1OZHA 2ONYA 3EF3A 5AXDA 2VQSA 2V7QD 1X3SA 2NYVA 2XKAA 4FKBA 4UAUA 1ULZA 5KC9A 2V7BA 2LIVA 3KJIA 3PX3A 5ISMA 3SDBA 2XT0A 3HCBA 1SBCA 4ALNA 1E6KA 3AC0A 2TMKA 3GJ4A 4JI8B 3VSBA 4EVRA 2A5YB 2AWOA 1LF5A 2P8JA 3FHCB 2HPAA 3JASB 2N46A 3IAEA 4NI5A 4J0QA 5JRZA 4D1YA 3MJVA 4MR9A 2HSZA 4X64B 4TVSA 5CCEA 4LQDA 3KOYA 5EYPB 5IN5A 4Z51A 4YT8A 5KNBA 2EX0A 2RB5A 2WWHA 3V6LA 2BTQA 4I4CA 3WLSA 5AVYA 2CDAA 5TGTA 2OENG 4X8LA 3T1VA 3C1TA 2I6GA 2OAGA 4K3VA 1EFRD 1JECA 2GUWA 4GR9A 5TQVA 5B4TA 4TLBA 5C3UA 3I9MA 4N65A 1HDGO 3ZV7A 4QJ3A 1ZINA 4ACAA 5E4YA 5BVGB 3VC7A 2AF3C 5J2UF 2O7QA 3PUVA 5BYBA 5KTKA 1NDQA 3QI2A 2FMIA 5B3JA 1OB2A 3FTDA 4MGIR 3WB0A 1EP9A 3OU6A 4IQ0A 1W8DA 2C1XA 2WT9A 1COZA 4FYYA 3PC8A 1F8FA 3GFTA 3SVTA 3LY9A 3DZHA 2QW1A 1PRYA 1QM5A 5E6UB 1FPMA 2O2CA 3CIFA 3KUCA 4MV4A 4OFBA 4DEYA 5AW2A 1NULA 4RD4A 4U9UA 4I1RA 4HNVA 1Y4UA 2RJNA 1G8HA 3LQ2A 4EUEA 1PO7A 3ETCA 3GBVA 2HRCA 1GTL1 2G63A 2WUFA 1QH1A 2D8AA 3QUBA 4Z0TA 1FFEA 2PA3A 2NQTA 3N74A 3CWCA 4L5CA 1DFHA 3DTYA 2R68A 1ZBQA 3Q9NA 2FW6A 3IA2A 3M2PA 5CDHA 4NECA 1QK5A 4DNPA 1P81A 1SOMA 2DQYA 2G25A 1YR1A 4XCXA 1J6UA 4G97A 5IP5A 2YRWA 4OB6A 4DG5A 4BNFA 1Q1GA 1I4DD 1WXQA 1W9MA 2AZ4A 1FF9A 4DY4A 5KNBD 1I3KA 1CRPA 3NYRA 1UBSB 1VJTA 4MVXA 4KXUA 4YJ3A 5LU9A 1HFJA 1H2YA 4BP9A 1RBQA 1ACMA 3UTCA 1KSFX 1CUBA 4RZHA 1L1FA 2C8KA 3A26A 4JVOA 4F2HA 2BGMA 4HDNB 4NR0A 4DLRA 3BL8A 1R1DA 4A0SA 4DLSA 3CXUA 3KL2A 2BGGA 3E27A 4GOLD 2VJMB 2FPLA 3LT0A 1VECA 2Z95A 3I2IA 2OD7A 1ZGGA 1NQXA 4JL6A 3RC8A 3NASA 4IZ6A 3N2GA 5TLSA 1R4MB 3NTOA 3PL5A 4TWJA 1U0SY 4X24A 5EXDA 1JU3A 2OZVA 2E1RA 4HH3C 1Z3CA 1ND6A 5AIAA 1L5MA 5I5GA 3DF7A 5AT1A 3DCIA 3B9RA 4JKOA 3K1ZA 3HK2A 1PT6A 4IZIA 3RRJA 5ICFA 4PHHA 2B1IA 2XMRA 3H11A 2ZB7A 3ORSA 4OQXA 2E21A 2ODPA 2FZVA 4MV0A 3TRFA 1IQUA 3SYTA 5C1DA 1SC6A 4R1NA 1ZHHA 4B43A 3M4ZA 5EVCA 3KTAB 5FTMA 3LV8A 1HDRA 1UUFA 1X6VA 4JCOA 4GEGA 4OGGA 3WG9A 3H1TA 3IT1A 1ADJA 3EIFA 3TGPA 3VSDA 5CIWA 1JJIA 1TA0A 1EVLA 2FWAA 2V98A 3EQ7A 1J42A 3GWZA 3CTMA 4GSYA 1UJ4A 2JVIA 3GOHA 3F67A 3NHPA 5HKAA 2HF9A 5DM70 4O2LA 4BFLA 4D8XA 5JFGA 4AI6A 1J2UA 1U3CA 1XYGA 1X80A 3DXYA 1ZMTA 5L4LA 1JAHA 2V9ZA 3RWMB 3ICWA 4UUQA 3VPCA 4PG5A 3LMKA 3CG4A 1PP4A 5AW9A 2LKDA 1N8KA 4ALKA 3K92A 4YRLA 2EDCA 1WL8A 2WSYB 3EBLA 2KB0A 5KKNB 1ADCA 1W94A 2GBGA 5L53A 2GSDA 5AI0A 4H59A 3T0IA 2BELA 2QLBA 4EF6A 4JP3A 4FEAA 4R8SA 3LS2A 1GM5A 3IE0A 2Q4TA 1N2ZA 2J4CA 3KEQA 4BMZA 3BH0A 3ZE0B 2WVJA 1ZH4A 3BFKA 2DQZA 4IH4A 3VZBA 3N8GA 4ZAFA 2N0SA 4CI0B 3OCYA 1THGA 4M8SA 2ATEA 3AHJA 4QQRA 3BXOA 4DJEC 4KBGA 1OYVA 4H4DA 5C7LO 2F3UA 1CZLA 1EX6A 3DMTA 4XM2A 5A6SB 2PT9A 4O2BF 2X5JO 3GGOA 2EL9A 1NASA 2PM8A 1KAHA 1CUCA 3BWVA 3CF2A 2WDZA 2GRUA 1F9EA 2DAPA 2W71A 3ITNA 4GSLA 1KDZA 3RKRA 4GWGA 1U9CA 1FX0B 3QVKA 3UW3A 2WNSA 3QEJA 2DBQA 4CM3A 4JI6B 3W5AA 3PYLA 1NQ5A 1UODA 4LGYA 3NVMB 1OLOA 3L7BA 3NIDB 4F1JA 1NDHA 3A6DA 1D6MA 2J67A 3HDTA 1GPUA 4IIBA 1K75A 2P77A 4RY0A 3N53A 3UJ3X 4CG1A 4HGNA 1LPMA 1Y3DE 4RABA 1JQEA 1KDVA 4W99A 1I51A 1TE2A 2WMDA 3HLKA 3UHOA 4Q4CA 3FUWA 2GLUA 3RQSA 3VTFA 8AT1A 1IOVA 4A6PA 3KSBC 4QBHA 4BGEA 3SXPA 1TJ4A 1RWOA 2EKPA 4CEHA 1PJBA 2YJZA 4UM9B 1CW2B 2C9OA 2KQUA 2VOJA 2Q2NA 3OX4A 4EHAA 3LX4A 5BR1A 3QG5A 5ENDA 1SOAA 3STXA 3B3QA 3QSYA 2IITA 1D5WA 1TYBE 1N6RA 4DV3B 3FWKA 3SZMA 2G09A 2NQ2C 4DDUA 1XCGB 3KJQA 5H3CA 3R7DA 3GO4A 1X14A 1BW9A 1LTQA 3BE4A 1L9XA 3G5LA 1J2TA 2HGSA 2WU8A 3KT6A 2P9EA 3SX4A 3VYSB 2H85A 3WV5A 1WCYA 4NBNA 4QGBA 3JTMA 5B64A 1QX4A 4A23A 3ROPA 3TEFA 4HBGA 3ZNNA 2IX3A 1KXZA 4E4YA 3I28A 1J21A 1GPWB 5JS8A 2C4KA 2ZJ0A 1Z38A 2X1VA 1XSEA 2P2LA 3BQNB 4G5SA 8LDHA 1U2ZA 1P2BA 3NOQA 1X3LA 4B9AA 5FLEX 1ZGBA 2ODBA 2WF7A 5FWDA 3ECAA 3ADOA 3NOXA 4G5QA 4W8GA 3S4YA 2OP0A 5J1TB 1CG6A 2FV8A 4GBED 3MHTA 2D62A 4EDHA 5LQMA 5E8RA 1E0DA 4UULA 1QHSA 5F5NA 3FNRA 3T5PA 4FNAA 4LOJA 1OLSB 4IHKA 2E7ZA 4HT3B 3SOPA 1BMQA 4OQPA 3ZUPA 1K5PA 5ECDA 2KE5A 4Y6QA 5FIUA 3QRWA 2P5SA 3L7LA 1M8PA 1B0PA 2HQ1A 4MYTA 3T9CA 5CEEA 2VRNA 4RSGA 3H2GA 5DULA 5IT4A 3LECA 1KY5A 5ER6A 1ISIA 1P31A 4MWOA 4Q7JB 1P9RA 2QTWB 2VDRB 2RH8A 1Z0DA 4BGDA 5C31A 2CVQA 4G89A 5AVRA 2H7YA 2SKEA 5F9FA 2FR0A 4CUKA 1FP2A 3OFKA 1Q1NA 1RP7A 3A3PA 4PBTA 5EQJB 1RAAA 3FUXA 2E1PA 5P8WA 4UXIA 2IS4A 1YH3A 2EJBA 3KD3A 2X23A 1EJ2A 4AKIA 4A6XA 3ETNA 1EMDA 1G3IA 3I8SA 1I33A 5E1MA 3BBLA 1HWYA 3FNFA 4I4NA 5E0OA 4A8JB 4ENQA 2QTLA 2G0AA 3KCQA 4LY0A 3P71T 4GU5A 3OX1A 5A5FA 3HP4A 2GTIA 2IOHA 4X7BA 1HEUA 2HRZA 1UJ2A 2ZAOA 3UCEA 1HE4A 2I6FA 2CVHA 2JL1A 2ZRPA 3CC8A 2Z8XA 4JL8A 4WN3A 4PQFA 5LC1A 5IT0A 3QX7A 3R9XA 2BCJQ 2NUTB 4KV7A 2CLSA 4IW3B 1BFUA 4FYPA 4L8YA 5CFPA 1AD2A 1HYGA 2CUNA 1RU3A 2XD4A 1TC2A 3K31A 1M67A 2GBPA 4P7GA 4I1SA 1JI0A 3A27A 4LV8B 4YJ2F 3TS1A 3CLSC 4ZYZA 1NNEA 1R0RE 4FYWA 4C7OA 3HDVA 3CLVA 5EJ4A 1CZHA 2QENA 3PX7A 2QSUA 2Z6VA 1T3SA 1XAIA 2M32A 3GGSA 4BYGA 2OXCA 3O3CA 1A9SA 3KAQA 3A4TA 5EZYF 1NV9A 4CMEC 1QFZA 1K8ZB 1G8FA 4L5IA 2ZYGA 3AFGA 2CVOA 2E5FA 3IP9A 4W9RA 4Z4EA 5LA6A 2QVCA 4KXMA 2ZJOA 3ICCA 3MRTA 2DT5A 2JRLA 1TW3A 1V39A 2ZIEA 2PUTA 5G4KB 4X44A 4EB6A 3JW8A 4IPTA 1F4PA 2YOFA 1VL2A 3W5BA 4U7FA 2Q8QA 1RACA 2DWPA 4R9NA 4AXXA 2B7LA 5J2UA 3MAJA 1M0WA 5DJ5A 4B34A 1N6OA 2V74B 3NYWA 5U4XA 4O8ZA 4LHEA 1NVEA 3LKZA 4JLKA 5ADHA 4MW6A 3STHA 3NRBA 3ER9A 3AVUA 1CJSA 2C00A 3O9VA 2GXUA 1E8DA 4P81A 1TT5B 3ZKAA 1KOJA 3QV2A 2DJ5A 4U0JA 1IXKA 3QWFA 4GP6A 2D1TA 3EZGA 5CXSA 5D00A 1P4HA 1YA4A 2JI7A 2IXGA 3KSAC 2RAVA 2PVSA 2WIBA 3GFBA 4FJ2A 4QOSA 2QPTA 1EVKA 1H2EA 2NO6A 3CUYA 4K9KA 2NOAA 1MB4A 4F92B 1TK9A 4PYMA 4BO8A 2J0UB 4H27A 4AN0A 2JCXA 1IM2A 4IG9A 4RCZA 4ZZ2A 2NIPA 3MXTA 2ZT7A 3EIUA 1HX7A 1E18A 2IYLD 2FJPA 1WBBA 2IYWA 4BQRA 3EXFB 3RUEA 3ISTA 4E88A 2ZYUX 3AILA 4UXHA 5ELLA 4E08A 2R8OA 1JKJA 1FFWA 5JC8A 3GVXA 3OEWA 1FTGA 1WUYA 4JI1B 3VR6D 2QYTA 4BMNA 3R76A 5BPHA 5FLXA 3Q7EA 3G8DA 3A4IA 2DUWA 2BMWA 3MS2A 1E7RA 1ZA1A 4JGGA 3H65A 3MMXA 1LDMA 2PAFA 3Q85A 5AHXA 2G72A 1O1YA 2PGXA 4C4AA 2X1HA 3FR7A 5F12A 1OLUA 3OM9A 3RRNA 5L7WA 1CNMA 1S8NA 4DLWA 1E3SA 3EGVA 5I45A 5U1PA 4LFBB 2IXFA 4TS4A 3UKDA 1E20A 3TMYA 1IH8A 4YT2A 1FNNA 2LCIA 2FYTA 2Q29A 3ELDA 1V8PA 3HBMA 3IIKA 3WR5A 2OAEA 3M8KA 2FQWA 2ZJBA 4TUYA 4OI1A 3AXTA 1RXUA 2YV2A 4O1HA 2QW8A 2QRZA 4EZBA 2EW1A 2OE2A 3K53A 3PXCX 1VKNA 3VJKA 4GS5A 4NJOA 4JIGA 1JLLB 2O06A 4KX5A 3RSFA 4O5AA 3EZ2A 3I2FA 1TF7A 1HG0A 3NBZC 3NP9A 3E9YA 3T6KA 2BEWB 3A4LA 3GK3A 2QX4A 1JVBA 3RS2A 4DVGA 3GN1A 5JECA 5KREA 4U4AA 2G88A 4QTTB 4KWHA 4F0JA 1QGUA 2OLKA 4K9MA 4FHCA 1H4VB 2BKEA 3HJCA 4RA9A 4ETWA 3SP1A 4XWKA 5JQGB 2F1HA 5DX8A 3MGBA 4YDHB 3SMQA 4OLBA 4MDFA 4ARZB 2QX7A 1Q7TA 3IV6A 2HDOA 2O7RA 1PS9A 3A1EA 1J25A 2CNNA 4O4IA 2QL6A 4C0LA 2C7OA 3UV6A 1WV1A 1E2QA 1T5SA 1KNQA 2QTVA 1RRCA 3LOUA 2BI8A 1EQAA 3AF4A 2XMQA 3IESA 2NUAB 2HJGA 4Y2SA 1KBQA 1E1KA 2DY0A 2QRKA 1OBCA 3ZHUA 1TJ3A 1XTVA 1YBMA 2P79A 4LBWA 1OC4A 5EZYB 4B8YA 3C14C 3N2IA 4DWOA 1Q17A 4ML3A 4L16A 1MUUA 1E2EA 3GT7A 4RA9B 1TYAE 4NYMR 1Y3AA 4XA8A 3VPBA 3QYJA 3R5HA 3TL6A 4A6EA 2JGJA 3UC9A 1NTRA 1GQFA 1YQGA 3A6FA 3CKKA 5A9RA 1S4MA 4Q9LA 1EP2B 4RAQA 5CEJA 3AM5A 3RK1A 1P5ZB 2ACVA 1FFHA 5DLYA 3NAQA 2C8JA 5TT1A 4YXWD 3EJWA 1UWLA 2EW8A 3L77A 1ORRA 1VZ3A 2G71A 3KKEA 4E6EA 3C1UA 2Y05A 1C4OA 4F84A 4MIEA 5EP3A 4ETNA 2EEZA 1ZJ6A 1CYEA 5JCXA 2NAFA 4KXLA 4G67A 4O25A 3FI9A 3GPIA 2FG5A 2VHZA 3O8LA 3ROTA 1H9BA 4F9FA 4K6OA 3CG0A 4XYMA 2W42A 2WSBA 5JATA 1YU9A 3C6QA 5G41A 3W1EA 3NEJA 1WA5A 1PZFA 4IZHA 4C20A 1IEVA 4PZYA 3QU4A 3HBLA 2FUG1 3LYLA 2O8FB 2Y1FA 4BNWA 1NSTA 1NG9A 1QMPA 1NFRA 5LLSA 1YONA 2ZDGA 3JD1A 3DGEC 1ZH0A 3GCZA 2FZCA 3QFFA 3UTDA 2QN9A 1YQUA 1Y6GA 3E70C 1D2MA 1BHSA 3C48A 2HMTA 3S2IA 2QN6A 4BO0A 4S04A 4OBWA 4IEIA 4D79A 2BY4A 5EL0A 2WWWA 2BONA 4FOPA 1Z0AA 4BFZA 3S44A 1TIBA 2IIPA 1K6JA 2M2IA 4ZKDA 3AGQA 5TQ0A 4EPRA 3WICA 1MT0A 5GAJA 4Q34A 4RZ2A 3MN1A 4OAOA 4S1PA 4Z4CA 1HZZA 2P4EA 2X14A 1B14A 3BFXA 4D6YA 2I9PA 2G1JA 3VR1A 2FWNA 2ASEA 1FNDA 1MNQA 4QYIA 4URHA 1FP6A 3M34A 1T3LA 1U02A 2GZ3A 3AB8A 2ES4A 3B60A 1EWYA 3BQ9A 4LPSA 1KQOA 3KQYA 4NJMA 4L3WA 1P19A 4Q4HA 4C4RA 4CGZA 3VUFA 2C31A 1OU0A 4HXYA 5EJFA 5BQOA 4JXXA 3BG5A 1P2GA 3C8UA 2HDWA 1AX9A 3RGWS 3AY0A 4RGQA 3QUQA 3R4CA 5JPDA 2VI5A 1LH0A 2P68A 4V0LA 3ZE7A 4YB8A 4A91A 2CF6A 4I1VA 2B1QA 4JJEA 2CSXA 2XQGA 2YXBA 3NFRA 3OPVA 2JC3A 3RRZA 1QIJA 3WLEA 4B3MB 2B9VA 1XN4A 4D4LA 3ZS8A 1YZFA 1CE8B 4AKSA 4DR7B 1JHMA 2OBLA 3UT5A 2WE8A 3N2NA 4LOKA 4BVEA 2AUTA 2GM9A 4PZAA 1TTPB 3AF5A 4UTVA 1JQAA 4DUGA 1J09A 2W6QA 2X6RA 4NCJA 1THZA 4W7SA 2QT1A 3RYFB 4KTVE 1QE3A 2Q2QA 3FOEC 4C04A 3RVOA 1XYYA 1YR6A 1BCRB 2WHQA 1BJRE 2A5GA 4I9NA 1JI3A 3ENZA 1FJHA 3Q7IA 4D0GA 2PUAA 1EKXA 3T5MA 1SUCA 4FFRA 5HKOA 3NDRA 5IKOA 3ADDA 3T99A 4TLCA 1C0KA 2VP6A 4NU5A 1S8OA 1HQYE 2R00A 1MG0A 1ZXLA 2DWCA 3ZR4B 3G7UA 5LJLA 3P2MA 1RHUA 2PVCA 2R7LA 4QU9A 3G6KA 5EKTA 1SA0B 2BMEA 2B98A 1N1GA 2YQ4A 4NL4H 4OY3A 5KYYA 4OLFA 2MSCB 1Z8DA 4MOWA 1GN9A 1RYNA 1WHTA 5FDFA 4RK6A 1ECGA 2CXTA 4Y0NA 2G83A 1MB3A 2A92A 4R1QA 1W47A 4R8RA 5IMSA 4F56A 4DWVA 4Q7MB 1IDN1 3WFZA 1JKIA 1TLFA 1V35A 1B15A 1N7JA 2VUIB 1NMZA 1UK9A 3THYA 1BEEA 3O6VA 4C01A 1OGJA 2GGSA 1UC9A 4RHEA 4AKTA 2PCLA 4PNEA 3L6DA 5CFQA 5B3LA 1XVUA 3H5WA 1BXZA 3WP1B 4NCBA 1Z28A 1JWLA 2NVUB 5BT9A 4UBIA 4YUVA 1Y5RA 1QF6A 1FUUA 1VSVA 1KWGA 4EAAA 5AW7A 4F7WA 3JQAB 1BO6A 4HRVA 3JAWB 3LW8A 4KGVA 4RDCA 4JBIA 3KETA 3GLHA 2G5GX 3M5WA 1KZHA 1GL9B 4CF6A 4WESB 4FGZA 3AIIA 3F96A 1ZNXA 3DB1A 3PE6A 3ZX4A 1FFDA 3RWOA 3ORHA 5ARCA 3EYWA 1GTRA 4AG5A 1DIHA 3B1YA 4DC1A 1V37A 2OMKA 2IUYA 1TZ2A 4NQRA 2EZTA 3ON5A 4X1YA 2VPQA 4MH0R 2HI0A 3L8CA 1FJGB 1M7BA 4MB6A