5DHPA

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with a novel inhibitor
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
264
structure length
263
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGIKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD kinase 1
publication title 8-Thioalkyl-adenosine derivatives inhibit Listeria monocytogenes NAD kinase through a novel binding mode.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Transferase
total genus 67
structure length 263
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 5dhpA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 5dhpA01
2I2AA 2P1RA 5DHSA 3V7WA 2QVLA 2QV7A 1Y3IA 1Z0SA 3VZDA 2I29A 4WRRA 4HAOA 5EJFA 2AN1A 1Y3HA 4L02A 1YT5A 2JGRA 3T5PA 3V7YA 2Q5FA 1SUWA 5DHTA 3V8MA 4DY6A 2I2DA 5DHPA 3V8NA 5DHRA 3PFNA 4WERA 5EJHA 5EJIA 3AFOA 3V7UA 2I2CA 5DHQA 1Z0ZA 5EJGA 5DHUA 3V80A 1U0TA 3V8RA 4V24A 3S40A 2I2FA 3VZBA 3VZCA 3V8PA 1Z0UA 2I2BA 1U0RA 2BONA 2I1WA 3V8QA
chains in the Genus database with same CATH superfamily
3MS2A 4R51A 5IN5A 3L1KA 5L9AA 5F1KA 1IMOA 2K5UA 2WMYA 5BORA 5I51A 2B3DA 1C1XA 2X3UA 5JYBA 5KJ1A 2SHKA 1B6TA 3DEFA 1YMQA 1D7OA 2AFIB 4NEQA 1DL5A 3UBMA 1I51A 1Q2XA 3HRKA 2HJRA 2HU2A 2W00A 1YT5A 3Q7SA 1KE2A 3DLCA 3VH4A 5A6SA 2GN4A 1IHDA 3O8OA 1K3JA 3BWCA 1QO0D 1V7ZA 3CH6A 4R71A 4Z7NB 3L6RA 4LYJA 3GCDA 5JS6A 1H4SA 1IMJA 5JASA 5KQSA 2GKGA 3LF2A 5EJ7A 2P68A 1N77A 3TLGA 2PUFA 1ZXXA 3W3AH 1C7ZA 1P4GA 3SEZA 2YMPA 1EDDA 3K8QA 1O77A 4K1XA 4URWR 3J80A 1JSXA 5IXYA 3LPAA 4PC1A 3QW2A 3D8BA 3MJ4A 1GUAA 3W79A 4CKCA 1WP4A 2YZMA 1Z5ZA 3QFHA 1TC2A 1KVUA 3C6KA 1WCIB 1N6IA 2VT6A 2O2EA 4GO1A 4EZEA 2YJNA 1NZDA 1TLFA 5CVUA 4IJQA 1SVLA 5DPMA 3KZVA 2PBRA 5LBIA 3KJEA 4LGYA 1D2CA 3MTEA 3MDBA 3VVBA 1ZOSA 3O9VA 4I0WB 4GLOA 2RB4A 4NQZA 4V24A 3S40A 4XFKA 5H1YA 4KUEA 1SGWA 1XPJA 3LWZA 4PSUA 4R6XA 2XTJA 1GFZA 4JIMA 4BVFA 4CF4A 1BEZA 2HW8A 1U81A 4QULA 5KYTA 4A6PA 2QI9F 4CFSA 3W8NA 2WSYB 1O0BA 4RIIA 2UUBB 1JR3A 3JVIA 3B70A 3K5HA 4ARBA 5FBHA 3UM9A 1A8SA 4GEGA 4CM8B 3I9JA 2COKA 1I7LA 4Y1RB 2Z8YM 5DIFA 3U44B 3P9SA 1F2TB 4GFDA 4P7KA 4ENPA 2ID9A 2R8YA 3VYSB 1VYTA 3JARA 1FFBA 1R4MA 2GSDA 3A77A 4TVKA 3QX7A 2D74A 2B4RO 4LRUA 2JA2A 3LYHA 4LOLA 2NTEA 2M6SA 1VL5A 3WWDA 1YHNA 1G2OA 4IS3A 2C9ZA 2CF6A 2G17A 2XW6A 3PG5A 4KRXA 5L51A 1KYWA 1GZ7A 3C14C 1ZUNA 4GX5A 5IM4F 1GFIA 3N53A 1NUSA 4AS1A 4UBKA 3VZQA 4JUBA 4GI2A 1U0HC 3QHPA 1KI4A 3ZIAD 4M0PA 3SQLA 1P2SA 2B8JA 3K53A 1VIAA 2P9CA 3IUEA 3AXTA 4X45A 2FKAA 3OCUA 1ENOA 5EZQA 4N8EA 5K3SA 3BGVA 3AILA 4N3CA 1XP5A 4MKXA 3ELUA 3P9RA 5LMNB 3EG9B 3JQEA 2ZJAA 3I92A 2BJHA 5THKA 1SQ5A 1XNHA 3QKUA 3WNZA 3HA7A 4WXMA 5NLLA 4EGXA 2G63A 2PCLA 4G8BA 3PC8C 4BP1A 4DZTA 4GR9A 3K31A 1TM2A 3K9CA 2R3SA 5C8DA 2QTZA 9LDBA 1NJ8A 3NS7A 3TW6A 4BRWA 4C3ZA 4R0MA 5HKKD 4GG1A 5KKCA 5DHSA 2W6IA 2XNJA 1R6BX 4RHFA 3VTAA 2P1ZA 1OVMA 1SU8A 2CC2A 5E4YA 1YCHA 2FWAA 2GNOA 4ZYZA 4AKEA 3LHKA 3TSYA 1ORWA 1L5HB 2XOKD 4D56A 1DE0A 1LU9A 3FCCA 1Z5UA 2MU1A 4QOSA 4EYQA 5I01A 4RY2A 4Y2PA 1UHTA 2QTVB 1H6DA 2QLBA 2J9FA 4OMFG 3DM9B 2XE6A 5DXJA 5PGMA 4NU8X 1M6VA 3FVVA 2PIEA 3MTJA 1B42A 2C7GA 3M6AA 1TU4A 3W5DA 1XZBA 3D6MA 4LYAA 3OVMA 2AGVA 3R0IA 4LRTB 4JBLA 4OB6A 5JDCC 3ANLA 4OFZA 4LF9B 1KK0A 4L9RA 3HLKA 5HVNA 4XX0A 3KZCA 5HIMA 2XA1A 3AIMA 1Z74A 3DCNA 1FNBA 3CEHA 3FD8A 4UEQA 3TQIA 5A4MS 3C24A 4QASA 4FCCA 3JVUA 1C1DA 3QMPA 5CJPA 4J3NA 4CMJA 1WXHA 4I3HA 2CJYA 2FN8A 4GC5A 3ZS8A 3CPJB 4X1KA 1VSVA 2YOHA 3NBFA 2ZU6A 5JCOC 3LCUA 2MSNA 4L3OA 1I5OA 1PGPA 3H1TA 4PS1A 4YYEA 4EFDA 3K4PA 1WZCA 2G1AA 4FILA 2PGOA 3MNFA 4OHRA 3GFGA 4TXNA 2CL7X 3FNRA 1Z6QA 5IK2A 4IIEA 5IEBA 2GYUA 1FNSA 2I6QA 1NU6A 2G07A 3KQQA 2D2XA 1P4HA 4PRYA 1OFIA 1U2EA 1KMNA 3B85A 3ZYCA 1QMPA 3A6GA 5DI3B 3UNNA 3AMVA 1S3IA 3F96A 3X1MA 5CH3A 4DADA 4TMVA 2GEUA 5T6MA 4JI1B 4BKQA 3UG7A 4YJKA 2YWRA 1IY8A 5J43A 1PI3A 2WTXA 5HKOA 1PLLA 1QFMA 1R6XA 3OUTA 4I1PA 3NTOA 3NBMA 2ONKA 1F8XA 5DN6D 2IH5A 1YE8A 3CZMA 3N0RA 1YKFA 4RCVA 4WKPA 1H23A 1E9AA 3MYYA 4L0DA 3BIJA 4MI3A 1PVDA 3AEYA 2HGSA 3DOCA 5JDIA 4LJ8A 4H9GA 4UPDA 1EUQA 1E61A 3I30X 4RDHA 4REMA 3V48A 1X1SA 1L9KA 2J3LA 2CXRA 3QEOA 3B9BA 3UTCA 3W3AD 2P40A 5HK9A 5K45A 1KYQA 1VLLA 5LM3A 4IAOA 4DSOA 3K92A 3R44A 4S2EA 2EBFX 2GN1A 2VJCA 4O4JA 1NKVA 5LA6B 1QFSA 1IH8A 2KS6A 3R5JA 1EVLA 2FH5B 2ZAOA 2ZWIA 3F3MA 2JARA 3UH0A 1M2VA 3AJAA 4FZRA 1I7DA 1RHRA 2XUIA 4LHSA 1ZQ9A 4UNIA 4F72A 2PD4A 2B25A 2HA7A 4NU5A 4PWZA 4TS4A 4EI9A 2YHSA 1ORVA 1Y34E 3HCAA 2OG1A 3M6LA 1SC1A 3L0IB 2VYCA 4NFLA 2HQBA 4KQ1A 4QGFA 1FA9A 1H3EA 2Q3LA 2YZ2A 1MMFB 2AEFA 3DDWA 1QH1B 4GDFA 1JKXA 5EINA 2V65A 4DMCA 4QVIA 1VMEA 1CW2B 1YZNA 1SCAA 4D6YA 4C6TB 2O2JA 1DADA 1U0TA 1NBOA 3KJZA 3GQBB 4NU6A 4XRRA 5AQEA 4JI5B 3UMVA 4F2DA 5LFAA 1LPBB 1WPRA 4R69A 5C1OA 4HEJA 3ICPA 1GQFA 5DMXA 4RKFA 5IX8A 3Q7EA 3NHYA 3CLUC 1RAEA 3SBDA 1QTQA 4FK8A 2FETA 1P33A 3UF0A 4DCCA 1MO5A 2W4QA 3FE2A 3NHUA 4HQKA 2B8TA 3NM5A 1P2DA 3I6BA 3SS9X 4XQCA 2FMTA 4GUAA 4LY9A 2GF9A 1KEKA 1TEZA 4NYIR 3GJ8A 4RBNA 2I2DA 1G6HA 5A9SA 4AKSA 2C88A 4MV1A 1Z07A 1BMFA 1Z6TA 4LE0A 3RQIA 3BWXA 2ZUFA 5EEHA 2WYWA 3CLUD 4EMSA 3AVQA 1DAIA 4K6GA 4PE5B 4RVFA 1K7FB 3KWLA 3VZRA 4V2UA 3VZCA 2NNLD 2YS6A 1KYIA 1RYNA 3H0CA 3PNBA 2PX4A 3JV7A 3R2JA 2C61A 3HK2A 2NYRA 3AP3A 4RXTA 5ALMA 3RVBA 2CNWD 2D0DA 4GWLA 1IEVA 4M86A 1VLVA 2XJ4A 2JAOA 4U2FA 4L5JA 3TXXA 1NUTA 4EKEA 4QUDA 3R3VA 2JCSA 4KXQA 3NIFB 2JBAA 2EATA 3VU1A 2G08A 3V4RA 1BDIA 2BM1A 4AK9A 1EFLA 2ORYA 3VNRA 2FSSA 1ZNZA 4WE3A 2Q07A 1JHRA 3T35A 4L95C 5JD5A 1V4BA 4U2KA 3T1TA 1DEVA 3GEEA 4Y3UA 1DAEA 1K4YA 2Q45A 3GV0A 1MBZA 1NPTO 1HDZA 4JGGA 1UANA 1UJ6A 5B3AA 2E85A 3PRYA 3RAPR 5JMOA 2IEYA 1FLVA 1KAEA 1ODJA 2AJLI 1T2AA 4B7AA 1ZSYA 2GVZC 3HL4A 3L7JA 3NOQA 3U7RA 3V7NA 1PYOA 3P8ZA 1SVNA 1BC5A 3KVYA 2OD7A 4KH1A 2OUKA 1ZP6A 3ISVA 3OQPA 5LQCA 2QVZX 2AOVA 2G28A 1GR1A 5K3CA 4JUFA 1J4PA 2Y1KA 3FVTA 2G6TA 4BVJA 1TDJA 4MMYB 1W49A 3E81A 5KKNB 2D2VA 1E9BA 4WESB 1E66A 2AFFA 4B3RB 4CF5A 2P9QA 2HQOA 3KQWA 4UHEA 3M6FA 3EIOA 4AYTA 3MW8A 1AA6A 1RZ3A 4CMIA 5HFJA 4OGGA 2BW0A 3HV2A 4U6QA 5AK5A 1W0JD 1U0NA 2Y76A 4PN7A 3E61A 1DWQA 1C30A 1M33A 1X1AA 3ELWA 3FPSA 3ZXIA 4CV3A 2LCIA 4BQIA 5BSVA 4QEZA 5BWMA 2FP4A 3F5QA 1JT9A 4LYDA 3VSBA 1SOMA 2QLNA 2PAAA 3IHTA 2OFWA 2Q2NA 1I7NA 1YR7A 1WY7A 1QHXA 2ODQA 4GQIA 4RVNA 2GD0A 4P0QB 3LKVA 1T91A 2J9ZB 1E4OA 2FN9A 4HDNA 3UAWA 1F4PA 3TUJC 4YCNA 3P97A 3TFWA 3RNOA 4X8HA 2XF8A 3A3KA 4TRNA 2CL0X 3RRXA 3BIWA 1QC5B 4II2A 5TPZA 3VR5H 2VQ6A 1W36B 4LUCA 1TQDA 1ZD1A 1AKWA 2R4QA 1YQWA 1MO4A 1V1RB 2ZLBA 2J3MA 3PA8A 1GUYA 4WECA 4U2GA 3UJNA 4S24A 4WKBA 1JW9B 1XIVA 4DMMA 1M1NA 3CO5A 2PZ8A 1SY7A 3K09C 2JEYA 4A5SA 3G17A 4PX5A 2XXAB 1YUNA 1V5GA 4GAEA 5J63A 2VI5A 1JILA 2R6AA 5U1PA 2SECE 1RS0A 4KIUA 4PG6A 4PU0A 3LKBA 5JAOA 5TIIA 5J1TB 3S2YA 3LMKA 4DR2B 2AMFA 3OHPA 4F4CA 1V5IA 4F6RB 1VFNA 2OQIA 2I7VA 3MOIA 2HRRA 2R1TB 1TUEA 4JEIA 5FD8A 2I3ZA 4DQLA 5IZCC 1ZY2A 3NEPX 2ZTHA 1N33B 1CT9A 2A5YB 3UHPA 3IP5A 3HRHA 2V7QD 4YIKA 4C4RA 3OPYB 4H1TA 4JP1A 1GV0A 4RSHA 4YIHA 4LXQA 5KNDA 3B5IA 3Q87B 4ZDWA 1C8VB 1J39A 3AKEA 1T10A 3KELA 4MZXA 4YCCA 3ANXA 4DLVA 5BOVA 3UHOA 4OO3A 2J4CA 3ZWWA 5CA1A 3PUWA 1XQXA 4K9LA 4JI3B 3DXFA 2ZATA 4E13A 1NM5A 4Q4JA 4RORA 4TPKA 3LQQA 3IP3A 4NJMA 5AM3A 3WSVA 3KEQA 3OE4A 3JQGB 4HUQA 1CUJA 1QQTA 5EN4A 4QT4A 4R54A 4TMTA 5ALNA 3HC7A 4WPGA 3MERA 1R0WA 3AVYA 4RZ3A 1QX4A 2O1XA 4CLRB 3R9XB 3NW9A 1OZFA 2CNDA 4KWEA 3I0ZA 1TO6A 1Q6YA 1P7VA 1QBGA 2H0AA 2ZVDA 4KQFA 3TJRA 3W9BA 1V6AA 3KT9A 1B1CA 1ZISA 4Z99A 1L2TA 2CFIA 2JFOA 5GZ3A 2C3UA 3COSA 4JP3A 2BEUA 2XBLA 2WF9A 1P1JA 5TPZD 3EZNA 3CZPA 5JH7A 3GVIA 1AD2A 3EQ7A 3SSNA 5IT0A 2ZE8A 1KY3A 2P65A 4WK4B 4ZAWA 3MS7A 3TXAA 3U3JA 2HV8A 4UUMA 3RYFB 1G66A 2GX6A 2PUBA 2M1ZA 4RDIA 1DO0A 1LY1A 1ST2A 1GUBA 2HHJA 3C6ZA 4YEDA 4HGYA 5C3MA 3QX3A 1AF4A 5T4BA 2Z4SA 1RJGA 4UEKA 1P5FA 1N5LA 2QVXX 3E9YA 3DAOA 1VHJA 3EWSA 4YCJA 5K7SA 2QRQA 3ZVKA 3TFOA 4E6EA 1KHUA 5BN4B 1EFTA 1IQRA 2ZSHA 2QLTA 5AIBA 1DINA 2FK7A 2A1UA 4C4ZA 2Q6IA 3HDQA 1GDHA 5EJ4A 2J6IA 1LGYA 1Z82A 2QTVA 3U80A 8MHTA 3DKRA 4IIDA 1GUZA 5AKLA 1XAIA 3CINA 2X19A 3PC7A 2J48A 3Q3HA 5D2CA 1WQ1R 1YAJA 2OWDA 1AGXA 4HWKA 4A8HA 1SKYE 5CA0B 1QJ4A 1DUSA 3MJVA 4Y0VA 5EQFA 3C7AA 2ZGVA 5ALIA 5GM2A 2AJCA 4EGQA 2QN3A 3MC1A 1SZPA 5KCMA 5BVGB 3HXLA 1NP3A 3SKVA 3ZDYB 3RC8A 3FMFA 4E2YA 2CL6X 4PQYA 1KPGA 1VKNA 3HY3A 5BO5A 2ZIAA 1T8SA 3D5QA 2DUMA 4S1WA 3VH1A 5IHXA 3EXHC 1QIHA 2YN0A 1XALA 1JDBC 2VTBB 1IXYA 1YJ8A 1E4VA 3TLZA 3WJ1A 2I8CA 1PUJA 3I6UA 5IJ9A 2JLBA 2ZRMA 1JAYA 2DKNA 1TA4A 3L7KA 4KX3A 4RIEA 5CX1B 5CM9C 3IX7A 4DUGD 1XG5A 2BH2A 4IMJB 1U2ZA 1JR6A 5J5AA 1R5OA 3NH6A 1J21A 4GLJA 4M8NE 1UP7A 3DMNA 4HLUC 4UE3S 1D4OA 3C39A 4YP0A 4DRXB 3BKXA 2Q3FA 3EWAA 3I2YX 3K6SA 3NDBB 2EH0A 5BV0A 3GFFA 2ETXA 2G88A 3G6WA 3PXUA 2H3EA 3HCNA 2EFEB 1K3NA 4I50F 1OLOA 4D8UA 1JZTA 1J4AA 1EJ2A 2GZHA 3FKQA 4CTOA 1LC0A 4FFLA 3QM1A 5JFGA 3AUYA 1O6ZA 1A9XA 2XDWA 4N0EA 3T7EA 1AQYA 1OFGA 2AZMA 1RYBA 5IBQA 3U48A 3JYHA 4B74A 3LJKA 4ZVTA 3TQCA 4Z3KA 3RVPA 3DOJA 1ADGA 3D4PA 1A69A 2GD1O 5F64A 1SNYA 2ZP1A 1F9EA 1HG1A 4CMKA 4PWYA 4HSEA 3WDKA 3M5CA 4V0LA 1CB0A 1N2CB 3OLVA 4WZBB 4G5OA 4C5AA 3DEKA 3KHTA 4G1BA 4GMFA 4O4LB 1I3KA 2GYYA 2C1XA 4GUDA 3VPYA 1CUEA 2V7QA 4MW0A 7REQA 3SOZA 1HKUA 1QGOA 3SQWA 4ZC8A 3MUNA 3EXG2 4AICA 3Q9SA 1VKJA 2NGRA 4AY5A 1R64A 5KTTA 4RTPA 4D6PA 4I9HA 4O2BF 3A9UA 1WF6A 1XTKA 3R7DA 3OIWA 1QP7A 1NWHA 1J9ZA 3ZHCA 1JBEA 3IPYA 3DLHA 5HBGA 4E5NA 3IUNA 1EUYA 2GYWA 1C7RA 1T8WA 1UMDB 2MSEB 2Y6VA 3PR1A 4MKZA 5JZOA 5MN5A 1N6OA 1ZJYA 3P19A 4GZ3A 1M2FA 3MJDA 5GGYA 4PGMA 2J3QA 4S3MA 3E2IA 5BYJA 1ISIA 1VCHA 1VIVA 2QRJA 1L5YA 1JQEA 1NMEA 1U0LA 4M0DA 1X3LA 3I61A 1JQDA 5A2GA 3WKCA 5EWJA 1MO6A 1UK6A 2AG8A 4D79A 1MV5A 3AFGA 4X8OA 5T57A 2RJNA 3B82A 3ONVA 3GLGA 1XZCA 1O2DA 4URVR 4P35A 2C2XA 1Z4LA 1IE3A 5ERXA 1MRSA 2GRJA 1BKDR 1YHZA 2ZUEA 3WLTA 1IUKA 3A9TA 3QXXA 4F12A 5KDDA 4H1WA 2NPOA 3WGQA 1ZRSA 2BZ0A 2HSJA 3EQ9A 3KXLA 3P0JA 2ISSD 4DZRA 5JSHA 1UEXC 1U04A 4PHFA 1GPKA 1F5NA 1T6XA 4ZI2A 1OIXA 4RK0A 5LDHA 3ERCA 1AQLA 1ZNYA 1W0JA 4GXNA 4CDRA 1WMAA 3KHSA 5EIBC 3T3NA 1E20A 5FPQA 4XUDA 1KS9A 3SX2A 2DFVA 1KQPA 2W37A 4Q02A 5JS7A 1DPGA 2UYYA 2F67A 4GOXA 5EE0A 2IITA 3EGXB 5LP6C 5DNCA 4I5FA 3U17A 3I6WA 1T4MA 1M6HA 1FHRA 4I08A 2FPGA 4IWNA 5CDYA 2QQEA 4P58A 3FDXA 2AJBA 3GR6A 3RM3A 4M9RA 3VHRA 3TR0A 1J09A 2H1HA 3P9QA 2DT5A 2P1DA 2PPVA 3F4LA 2G09A 2VXYA 5ADHA 1Z6XA 1EUCA 4P32A 1QH9A 2PRIA 3DZDA 1WMFA 2H07A 3H8SA 3N1UA 3TSCA 4BNZA 1KMHA 1SRRA 2E1PA 2Y9MB 4J43A 3R6GA 4OXRA 5CA0F 3VX4A 4BP3A 2AHOA 2QTHA 3T0GA 3HPQA 2A5LA 3HCFA 1WCXA 4L85A 4PLFA 4BXOB 3DZFA 3K4QA 3SCZA 1LV7A 1BQ3A 3IFSA 1ESZA 1P3JA 2DBVO 3CGWA 4JCCA 4K6HA 4K0RA 3VISA 3ANYB 3ME5A 2QZPA 3WIBA 4TMWA 3ADDA 2Q1TA 2ZXUA 4B3XA 2YXDA 2ZYDA 5DCLA 1V1RA 2MYNA 2E7ZA 5H83A 1MO2A 4HAWA 5E7MA 3D0RA 3GA0A 3HB5X 3JQ9C 4OLBA 3ZWVA 2GNPA 3GD7A 4FNAA 2JIOA 3JWEA 1E94E 1L4YA 4RPJA 5A05A 3GJTA 2G9UA 1G3MA 3P2IA 7ADHA 3T5PA 2CJPA 3LT0A 1DIOB 2IBSA 1WPQA 1YJCA 1CUSA 2X5JO 5SY9A 2ZBVA 3F6RA 3QENA 4D74A 4PYKA 5E7JA 1HETA 4UCFA 2WA1A 2P78A 1K6MA 3QEJA 4LCBA 2JFHA 1Z4MA 3DD5A 5ESRA 3ETLA 5EMLA 3EPPA 2NYVA 3HUDA 3LT1A 5JZVA 2GZMA 5B58C 1X70A 1P3Y1 3BB4A 2MR6A 1L8OA 4EA7A 1ML3A 1E5DA 1HXHA 1X7ZB 2HREA 3E4CA 5B30A 4YHHB 1PJZA 2R8PA 2VSXA 5IN4A 1SWWA 2AR7A 2IHTA 1FVXA 1GZUA 3KP1A 1NXXA 4K6MA 5F51A 1JQBA 1C3JA 4G4SP 1QAOA 2JJ2A 3HO6A 1UBEA 2V55B 1H1TA 1DIRA 3LHDA 5EIOA 1NDUA 2DBRA 1NI5A 3BIXA 5G02A 4JL5A 3PLRA 3ZWPA 3KUDA 1TQ2A 3QELB 2CVHA 5HF8A 3GMJA 1T9GR 2XYPA 4YV0A 4QPNA 4MTCA 1E5TA 4M7WA 3ROEA 2YWEA 5CYGA 3B1YA 1OHHA 2FMKA 4DAEA 4CLRA 1G8KA 4O2BB 4YDHB 4F86A 2EZ8A 4FFWA 2XQIA 4L5BA 2PN1A 3CT6A 3K0CA 1G5HA 1N3IA 1QCZA 1FCJA 3BHIA 3P9IA 4AWAA 2BONA 2OHVA 4IICA 1TZBA 2QP3A 1M1NB 1WUJS 4NYMQ 4V0NA 1CCWA 1HDYA 2UDPA 5KQRA 1Q12A 3C87A 1B41A 3QA3E 6LDHA 2DR2A 3AEUA 4E03A 4WOCA 2A35A 3G0CA 4KYTA 3SC2A 5GPBA 2X40A 4CLOB 4C76A 4QJ3A 3QFFA 3RU9A 1M73E 3L6DA 5FWXA 2GPJA 3RAEC 3HCOA 1JR4A 5F5XA 3RRBA 1TE2A 1U65A 2QUJA 4ALKA 1ADCA 1G20B 4PNZA 1UEIA 1L4MA 1QUEA 4MVYA 3E5MA 3K96A 4UAVA 3UK1A 1G7SA 1GL7A 1JU4A 2GBPA 2VYVD 3AM3A 4PG5A 2X2EA 2ZI4A 5GP1A 3OJOA 4UUQA 3DP7A 3HKDA 2O6HA 1J1ZA 5AH0A 3EEQA 4M4SA 2D6FA 1QRSA 3T3DA 1KFKB 3B1FA 1QZUA 2G5GX 2D5AA 5DN6A 4MIYA 1YBHA 1NLMA 3EPKA 4QLAA 1GU7A 4ZMRA 4KLAA 4QBIA 4PZCA 1OXVA 4ZWNA 3SWWA 1CERA 2DUJA 4W5WA 3FTNA 2ZK7A 4TV9F 2F1KA 4B45A 1B0ZA 3A36A 3LLVA 1UT6A 1FRVA 3H1AA 5BVGA 5HE9A 1QWTA 1FDUA 5C5EA 4DLUA 2H06A 3ASYA 4UTZA 2ZTMA 4OG2A 5AJYA 1W87A 2GJSA 2Q7DA 3V33A 1QM5A 3BSWA 3O03A 2XAAA 1ADBA 2CW5A 2O48X 3T9EA 2XUJA 5BNIA 1XROA 3OZWA 2WM9B 2EW8A 3SD7A 3QFRA 3W6ZA 3U16A 1YZUA 3EH1A 3M83A 3PHHA 4S1NA 1XRJA 4MA5A 4NH4A 4OUDA 5ADWA 5AVWA 1DO8A 1RW4A 4R7TA 1UIMA 5KREA 5F12A 4EW6A 1VJTA 1CYEA 5HGXA 2AYXA 3L1IA 3HJUA 2R00A 4ZAZA 4ZREA 5JG7A 1QVZA 1T1GA 1ORDA 3VJLA 3W8DA 4AO7A 3BFPA 2G25A 1JQ3A 4RD2A 3JALA 4XI9A 4CQMB 2WQ6A 4XR4A 3C97A 4ZVQA 4JSYA 1LPMA 4K6KA 3MYRA 4FCTA 1S96A 2J46A 2ATIA 1XPRA 4L4RA 2FPSA 1V41E 3HDTA 2Q50A 3HG7A 4FINA 5IYZF 2B61A 3T3EA 3URKA 4M6WB 1LF0A 1JLKA 1NTOA 2FWIA 4G5QA 1PL0A 3HKCA 4I6GA 5FR1A 4BNTA 2IU0A 2B5VA 4ZT5A 4U7FA 4B9AA 5TPWB 3GRAA 4LJ5A 3KLOA 1CZNA 2IZOA 4BO1A 2RIPA 4W9MC 5E1DA 5L3SB 4RJIA 4H4CA 4X92A 5DGDA 1UJXA 1SHJA 4BJHB 1N0WA 3L7IA 4TQUS 3C6QA 1LV8A 1YJ5C 4CLDA 1G0OA 1O94D 1RXIA 4YI5A 1G41A 2VDWB 4BAGA 4M7OA 5KQMA 3P5SA 2XWPA 4R1OA 1XR3A 4KCGA 1NVBA 2AJ8A 1JZSA 1OBHA 1TEXA 1VYVA 2EW2A 3I45A 3IT0A 5B53A 3FYCA 1P2VA 3THYB 3VNSA 4E6PA 4ETIA 5CFMA 1JB1A 3OX1A 2HLHA 1THTA 2P5TB 3P9NA 1ABFA 2AUNA 2RFLA 1JX6A 1XQ9A 1GZDA 1LX6A 4DGSA 1WLSA 2FQXA 3DMTA 5FX2A 4HQFA 1LLFA 3JTEA 1U63A 1QIKA 2BFBB 1HV8A 4ZIRB 1H6AA 1ONBA 4DMFA 1G7RA 3DE3X 2B1JA 1VKOA 4I1OA 4ZOLA 3SI7A 1ZG3A 1ESDA 1Z7BA 3KU1A 2KB4A 4FYHA 4QNMA 1K92A 1U1EA 1I24A 3P0FA 4AG6A 4J90A 3JPWA 1BHO1 4WL0A 4M54A 1UQUA 3VDNB 1Q3KA 2XT6A 3GK3A 1BJTA 5PNTA 3SIRA 621PA 3IIJA 3H87A 1SAYA 3H13A 4S1VA 3LVQE 1QO9A 5J4KA 2EHDA 1N0IA 3FOBA 2QUKA 4GKVA 2PRSA 1D2HA 3W2IA 2G8LA 1F8YA 4EUHA 1ZCFA 3B3AA 4X65B 1OWNA 5BN3A 1GL9B 3TZEA 3V4LA 4HXFB 4D0GA 2C84A 3BDIA 2B30A 5G0TA 3CVJA 2AG5A 3QVJA 1P31A 1UZLA 2X7JA 5FULA 1PKEA 1GD1O 1H8HA 4FLMA 4RAOA 1FLDA 4QRIA 4Z7QB 4PGAA 1PRYA 2J3EA 4LBWA 5SZJA 3QE3A 3U3OA 2O5EA 3NAGA 3H6KA 1L8XA 4RQTA 2C9DA 2P11A 1DKUA 3NFRA 4LXGA 2BFCB 4UU0A 2RB5A 2WWTA 4PLTA 3BGSA 1UUFA 1QLJA 3VYTB 1MO3A 3DBOB 4M1OA 1EFVA 4HXEB 3SQDA 1JHPA 1EZ1A 1G3IA 1C1HA 1FTWA 3EBOA 4TS3A 4WEQA 4XDGA 4KI7A 4QWMA 1K2WA 1GOTA 1M34B 3WYBA 2C7RA 3PX7A 3BCUA 4O6VA 3EVFA 3OCZA 3TRJA 3R3HA 5CIYA 3RUHA 3W5SA 2F1JA 1O1YA 2HCFA 3K5PA 5K51A 3UFXA 2PKYX 3OCJA 4L51A 5T67A 3GGOA 2RHTA 4ZQBA 3TXYA 4COKA 4Q00A 1H2WA 3AERB 3J7TA 4JBWA 2I6GA 1R27A 5AUQA 5LVAA 1E6CA 2IUEA 4TWIA 2GZSA 2MCFA 5HP4A 4HADA 4N18A 5SYAA 1S8AA 1US8B 3BD8A 3CZQA 4AF6A 2FF4A 1Y1LA 1N7HA 1Z56C 1E6MA 1ZK4A 2YR0A 4EPYA 1DBPA 5B7PA 4QVKA 4DV0B 1SG9A 2DH5A 3LK7A 2BF4A 1NBMA 1X7YB 2W83A 3HJCA 5GTDA 2IW1A 3D0QA 4Q15A 1BIFA 4QYTA 3ZUGA 4B5KA 2C2WA 3HA5A 1TYDE 1T3HA 3KAPA 4FYPA 5JS1A 3JAKA 1FJGB 1PW7A 1E4EA 3IA2A 3FROA 5EMMA 2V3CC 3HY6A 2BUBA 2CMHA 3R74A 1LNSA 1SD1A 2B0CA 4WZZA 1GAXA 4LHZA 5EZYF 1LDYA 1SG0A 1A5SB 1GTG1 3PV0A 1OIVA 3DDOA 1RHJA 2P3OA 4RFSA 4LIPD 1JA0A 2XJ9A 5AHOA 1UDRA 2ZI5A 3HNOA 3LC0A 4JLWA 1GCIA 4YC7A 5TSDA 2EFJA 4X64B 4AZSA 4HB3A 2H5JA 5KNBD 1P1FA 1E2NA 3LT4A 4D82A 2QD1A 4E1BA 3CQ9A 4DMGA 2Y3IA 2YW9A 3KTFA 3QLVA 4NMWA 2A0WA 3LPNA 3ZHYA 4JLUA 3H1GA 2IHBA 4ZTBA 3GUHA 3KR2A 2BMEA 2WFAA 2I71A 1TYAE 2N47A 1TCCA 4LHWA 4LQLA 5JQWA 3NJRA 4I46A 4ND6A 1MXFA 2VAVA 3IQHX 4HRAA 3IAFA 4FSXA 4N03A 5REQA 4CT5A 3M5PA 3G2HA 1E2GA 4DR5B 2YVLA 3OU6A 2EKZA 4JX9A 2KSQA 3LY7A 1YOVA 3ABZA 2R62A 2XADA 1VCNA 1HDIA 1KO8A 3INTA 4LA4A 4Y6LA 4ZCPA 4IKOA 1X8JA 4C4OA 5FWXB 4J49A 4PYLA 4AF7A 1UBHS 4IDAA 1FX1A 1UIRA 2R1VA 3WL8A 3M49A 4ZRMA 3LWDA 3IR6A 5IJZA 4U4AA 4GE3A 3VHXA 3JX9A 1I1OA 4QCJA 2HXSA 2Q9BA 2ZYUX 3DNFA 3L9WA 4JT4A 4DZZA 1HUQA 1D1PA 3C3BA 1MPXA 1QGAA 4LPSA 4NOJA 2BFNA 4A0SA 1MA0A 3A04A 5TF4A 4L4XA 3SZMA 2W6ID 4A92A 4HNGA 3NTXA 2X0EA 4BU0A 3P9KA 4G2SA 1UWKA 2A0FA 4FEGA 5TQ0A 4A03A 2VYVA 2EG5A 3ZLVA 1VBFA 3KXPA 2YJ4A 3DSRA 3CG0A 3OIGA 4CKWA 1ZVVA 2Z6QA 1CC1S 4I9FA 4ZEMA 1VBNA 4EG4A 2DLDA 2GN6A 3GUCA 3OQ1A 4GX2A 5IWAB 4GR5A 3ELSA 3A11A 3LECA 5FPHA 2JFZA 3L0YA 1POXA 4RNDB 4EJ2A 1E9FA 3AG6A 3CUUA 2P2ZA 4CFYA 1C1DB 4JB8A 1LK5A 3MFQA 4A8TA 2WD9A 3MIZA 3C3XA 3UQYS 4ZJPA 1IB6A 1VC2A 5FDFA 4EEKA 1DZIA 2J3HA 3E0QA 4FJ1A 3E3OA 4MI6A 1FJXA 3OQBA 1SHTX 3GZNA 5AVOA 1V3UA 3HYTA 4JP2A 1PD0A 2PTGA 4KJZA 5DT9A 3AUJB 3SKXA 5ITWA 4MQ4A 3N7AA 4F4HA 3JTMA 4GM4A 1DAKA 3DZCA 3R1IA 4ZZ3A 4NXNB 4JYPA 2AEEA 4HT3B 2PZAA 5F1YA 5ERGB 4AJKA 1QLHA 3CLSD 2I3GA 1KFJB 1A4IA 2DZDA 4FD2A 4U3JA 1M34E 4AZWA 4JLNA 2GPYA 2ZB7A 5K4AA 3UV7A 2PGLA 1IG3A 1DXHA 2BEWA 4QPJC 1JBQA 1OCEA 1ZJ4A 2FX3A 5DBIA 1KYZA 2CCGA 1PGJA 4YR9A 1MQ8B 1RKUA 3ESRA 4BNHA 4NVRA 5LOVB 1ECFA 1DSSG 3O94A 4HX2A 1SBIA 1Z7YA 1W88B 3OOEA 4IIGA 4MROA 5FWYB 5I9NA 1AF7A 4OQLA 3WB1A 3H5VA 3FDZA 3V6MA 2YNMD 2D5CA 3S1SA 1E1RD 2KQUA 1NQ5A 2AI3A 2CBGA 5IH3A 3LZDA 3FTEA 4FS8A 5DNUA 3PHJA 4C7MA 1EVKA 2JGDA 3BXHA 1K8XB 1W0KA 2R7KA 3ELDA 2NYAA 3OTIA 1N5DA 2JFQA 2PS9A 4YREA 2A6PA 2JLQA 1QS0A 2X15A 4DYHA 1VGVA 3LHIA 4QPCA 1CV2A 5GONA 1BDMA 1MOSA 1SFRA 3JQ7A 1TAUA 4BLTA 2VAXA 2GD6A 4H1HA 4QYSA 4MUYA 4CR8A 1RKXA 4YRGA 5FUMA 2JB9A 5KYWA 2GBCA 4KG7A 3WGOA 1Z45A 1ZOIA 2KFUA 2FGJA 4Q9NA 1NKSA 2GLXA 2O1EA 5EKTA 4V3CA 3ZV5A 2VK4A 4M1KA 1L8LA 5EGNA 5BXYA 3NM6B 4DSZA 3KZ1E 3GFRA 2V9CA 3O91A 4WZBE 3G6KA 4IWXA 1FUEA 4XFDA 4AF8A 5EJ8A 1QXSA 3EC1A 5FL3A 3AY0A 1KSFX 1G18A 2EP7A 3FB1A 4R31A 2V97A 4IUCS 2QTMA 4YDRA 4XE5A 4CQMA 1NJ1A 5E9JA 4AW9A 5JARA 4AXXA 2GM4A 1QQ6A 2HJ9A 1I9CA 3RK0A 4PYQA 3RK4A 2QU8A 2GPTA 4WUTA 2HIAA 2W6ZA 3MRXA 2FZ4A 3RUDA 1Y33E 3UAXA 1QO0A 3IGFA 2X6QA 3K1YA 5A3SA 3VYRB 4GVLA 4KUGA 3CCFA 3OJEA 2FGKA 1XTQA 1XKQA 1XZJA 5CPFA 2GZ3A 1JIXA 1RNLA 2I4NA 3L41A 5LD2C 3CNNA 2BCEA 2HSZA 4LDRA 1L4BA 3OECA 2G40A 2OZLA 3TAXA 4MVJI 5G40A 1BVRA 2YZ7A 1EDZA 1WUHS 1J1UA 2A92A 3Q9NA 2FR8A 1YS1X 3G0GA 4WINA 3AU9A 3Q4GA 1SIUA 1R3DA 2PUAA 3K3PA 5AESA 1ESMA 1JHUA 3FCAA 4G0PA 2WZDA 3I62A 4FB5A 3GH1A 3CVVA 4HATA 1JHDA 1XNQB 4J6EA 1UKEA 2OPBA 2QRVB 2OK7A 3VJMA 1Y8CA 3IODA 3PJGA 4FGWA 2DTXA 1AS3A 3IPAA 1AJEA 4FFVA 1ZIXA 4FKZA 1VLHA 3IB3A 1AIPA 3COZA 3UNXA 4CCYB 3N3AC 5FORA 1DJMA 3HJRA 3O4IA 1K86A 4OFWA 2Q0SA 4LRYA 1IOVA 1WB6A 5EWLA 2VCHA 2AIRA 3HNPA 4XR9A 1GZ4A 4GBED 2ECOA 1OUMA 1PS0A 4KIFA 3PO8A 1D6NA 3D7KA 3H5OA 4JVNA 1MJHA 1LW7A 3TM5A 1BE6A 2VUSA 4QSHA 5BN5B 4XA8A 3ZDXB 5AVRA 5FLXA 3EEYA 3I6ZA 4U6NA 3RIGA 5JFOA 2H17A 4IG4A 3I9MA 1M2HA 1KYTA 3EVTA 3WKEA 4D8XA 2AA3A 3DCYA 4I81A 4DS3A 1Z8FA 4KK3A 4TQGA 4ZT3A 3G59A 2D7CA 3KS9A 3UAYA 4DAOA 1SQGA 4G85A 3NWEA 5A4DA 8AT1A 2CE7A 5B4UA 5E8JA 5BN3B 4MPPA 2ZTVA 4PAQA 3TQRA 2J6HA 1JAXA 1KAMA 2JJ1D 3DZIA 3ZGZA 3ER8A 4FN5A 3STWA 1F1BA 4GXTA 1OH7A 5GIPE 4GYYA 1XA4A 2G9RA 2CJWB 5ENVA 2JPDA 1RAAA 1ZRHA 3FIUA 1IBLB 3O8BA 3AKCA 2K4MA 3NPMA 3SQMA 1KL7A 3TEFA 3EGVA 2PZEA 3FRJA 4ISBA 2PG3A 3H2KA 1V43A 4Q5IA 1EBUA 3BPSA 3ROGA 1U7XA 1RYHA 1YH3A 3BRWA 3EZLA 1WMBA 1HBJA 3BBPA 1EFVB 1WTAA 3BD7A 3EIXA 4RM2A 4I4LA 4EJSA 4HGPA 1Z0UA 4XWWA 4XDHA 2FJUA 2Z43A 1N8SA 3BTOA 3K30A 4JB0A 4IOKA 1MW9X 4LV5B 2IIQA 1TU3A 3MOSA 2Z5LA 1EEHA 1Y82A 2BE9A 1Z0SA 2CXHA 3BE8A 4PO3X 2R8XA 4JJKA 4XASA 4D25A 4RM3A 4F92B 2RGNA 3GBVA 2V7GA 1QANA 5CHEA 5FJIA 5DHTA 3EIUA 4EPRA 3G2IA 1UP4A 1AY0A 1YDGA 3LT5A 3CRRA 4IHQA 1WEKA 3EGIA 2R5WA 4M55A 1KC1A 4O2AA 5H81A 4EHNA 1FNCA 4EQZA 5TQJA 3A1NA 3H18A 3ZYZA 3EZYA 1NVGA 2QX9A 3JQ8B 4JP8A 2LDBA 4Q4DA 4B3SB 5K5EA 2XUPA 4MTLA 4CN8A 3P4YA 4MQEB 2DFLA 3DKPA 4X24A 3T54A 3TLJA 2WMDA 3H11B 4O5OA 1CZLA 5U4QA 1T26A 4XQ9A 4RA6A 3M2TA 1B8PA 1WA5A 2DWCA 2OCAA 3UXYA 4RANA 3FNIA 1Z5NA 4I1SA 4ZEVA 1E8MA 1F8FA 2QXUA 1F6BA 1NBAA 3GA7A 1V8DA 3ZY4A 2QMEA 5JJBA 4MP6A 3R7FA 1E8DA 1FYDA 3F5FA 4R2MA 3PR2B 4IO0A 4YRRA 4GMGA 4N3NA 3SPXA 4ND8A 2QX7A 1UKZA 1DC7A 3E9DA 3WB2A 3WL5A 2VNIA 5K8UA 4QODA 4LY6A 1QDLB 2JH3A 1M2NA 5F33A 1DRWA 1KZHA 3AI2A 1IN4A 4XGNA 3X1JA 3Q8LA 4YPOA 1DO2A 2X0FA 4NKRA 3TLXA 4EFLA 5JSFA 1C4WA 4UVGA 1L1EA 2OV6A 2F3SA 3MMNA 4NBTA 1IBMB 1V1MA 5F52A 2JJ1A 1EDBA 2XHZA 3AJ9A 4V0MA 1XZEA 3H99A 4MITA 4PTLA 5K9ZA 3DQQA 3IUPA 3QEKA 4ND2A 4OQ4A 1GG2A 4F2HA 2CDCA 3E84A 1CIVA 4ZTZB 1SZCA 1MQSA 3QITA 1JI0A 3KQPA 4ZCMA 4C0HA 2DWOA 3EXHA 3OU2A 4MCHA 5IT5A 4DDVA 2G4VA 1DG9A 1YDFA 2NU7A 4HX9A 4X44A 5DU2A 5CW2A 2CLMB 1SVKA 2PXAA 1CWUA 2GB4A 2RHWA 1BCRB 1P6QA 2QN1A 1QHFA 1A50B 2Y99A 3PHIA 1A5TA 2PZGA 1HLFA 1ZWLA 3BL6A 1UWVA 2WJWA 4KR0A 2QMUA 3L6UA 5D5PA 5TRTA 5JALA 1U7PA 1SVMA 1X8KA 3RJTA 3WISA 1Z47A 2FG5A 3DT9A 2MSKA 4KIGA 4Q9AA 4X95A 4I55B 3QPUA 1K7YA 2JFYA 4ZVPA 1V3TA 2C5HA 3OQJA 4H31A 4HGOA 5E0OA 5FUXA 1CUUA 1NN5A 4JLSA 1CB7A 2O0HA 3WK4A 1IRIA 1NDHA 1PZMA 3B6IA 3H9BA 3WLRA 5HQJA 1T9ZA 4V38A 1KF0A 4D9VA 2RI6A 5KDOA 1NVFA 3UMJA 1Y8ZA 3IR5A 1PJTA 4WADA 4MKIA 4CLHA 5A5FA 3ZWOA 1C3OB 2C2OA 2J32A 4IRUB 4O08A 5CX1A 3OE1A 4AROA 5I9BA 3B1JA 3S29A 1MB3A 3VM6A 2VP6A 4P34A 1IY2A 1W9MA 3I2IA 2VP3A 3KPWA 4D4GA 1E96A 6YASA 1XLVA 1A8HA 3GAFA 5FUYA 5K1ZA 4R16A 1E1DA 8ABPA 2G1LA 3WIUA 2OC4A 3A37A 3R5SA 4MRVA 5B6JA 2XUZA 3QUBA 1SC3A 4OHCA 2DXIA 2QAGA 2NUPB 4RVGA 4UU7A 4AURA 2C96A 1PSWA 1XVTA 2DSTA 1OZHA 5DSTA 3WO0A 1J9GA 3MT7A 3PNSA 1K5GA 4X9XA 4Y9TA 4X00A 5D7BA 1NDQA 2JFUA 5IVIA 1A9XB 1JMYA 3PRHA 3QKRA 3H1EA 3OQ6A 3LL4A 1D0VA 3W4IA 4ROSA 4BL5A 2PVSA 3JW8A 4WIAA 1P1IA 4CF3A 2OCIA 3WXBA 5DEIA 2VDJA 5EJ5A 4HRVA 3RS8A 3JQDA 2VRNA 3TPFA 3I2HA 3G9TA 3N7UA 1IONA 1L4FA 5A06A 1JSLA 1WHSA 1DKOA 1H0RA 2HPAA 4CKEB 3C3KA 4F1WA 3EAQA 3IUBA 3HGQA 1M74A 2QRHA 4M9UA 5KX5B 5IT9A 1Z63A 1PV2A 2B5WA 1R4NB 2PNFA 4KPUB 1SUDA 1CK4A 3T5BA 2OSVA 5B2FA 3U6BA 4Q03A 1Y4ZA 2Z8ZA 5EHNA 1WTCA 3GLSA 3T1HB 1NATA 3QVGB 1TAHA 1VE3A 2IODA 5D3KA 3D64A 5CIWA 5E7QA 2OQ2A 1QFYA 1WHTB 1LPNA 3ECAA 2JLVA 1XLUA 1UF9A 3FPKA 1PZHA 3LXUX 1GR0A 4LYFA 5D3MA 3X2EA 4DL9A 5LOVF 4RPLA 3MT8A 1JSCA 4R9VA 2ZXFA 3CONA 3DBVO 5JWOA 2WT9A 4ZKEA 1BD4A 4RZQA 4CDNA 1KQFA 3DJFA 2XDYA 2BSQA 3W05A 4GYKA 2VCYA 1G9XA 2IHJA 2XOEA 1RI2A 1UEJA 5KDLA 3RVNA 1GVNB 1NI4B 3D6VA 2RDMA 2DY0A 2X0IA 1ZMTA 3CZ4A 4FSDA 4K8RB 4LVCA 5DHQA 5E2IA 4IYRA 2XI4A 3MLAA 4U1RA 3GJ4A 5BQ5A 3T0IA 5EE5B 2RGRA 1L5RA 3NGMA 1DX6A 1JTEA 3KC2A 1YWGO 1SOVA 3L5KA 4G67A 4MWTA 4UW9A 1ZSVA 2PQ6A 4FI3C 2IF2A 3SJAA 4ER0A 5EJ2A 2NLOA 1H05A 2VPQA 3NRBA 4ND1A 1SURA 4QJ5A 4YJHB 5JOQA 3E8SA 2HA3A 2Z8YA 1C7JA 1CUVA 5EWMA 1LX7A 4IXTA 1BYIA 1ZLXA 3CLSC 1GSAA 1HMPA 2AN9A 3KLNA 1M1UA 1LPAB 2ZJ1A 1EVJA 4LC0A 5AI4A 3PD0A 5T6BA 1CNMA 1SXIA 2XVAA 4G5YA 4PSCA 1A2BA 3RVSA 1V0JA 1S6YA 3ZCXA 2IK8A 4WOBA 4EW2A 1RI4A 1EGAA 1W75A 2YJ5A 1PS8A 1U2QA 2X8LA 5AJHA 2WJHA 3DWEX 2H9AA 1G5FA 4Z54A 4BEVA 2CV2A 3KZOA 3AX6A 3HABA 2ORIA 4INPA 1GADO 2XF2A 4RE6A 4X1YB 5H3LA 2FPGB 3U4DA 4AG3A 3KLBA 2MINA 2WG2A 3IAS6 4X41A 2G5CA 4OH7A 1DCFA 1RCFA 4JYMA 3V46A 5BSWA 1TJ5A 5AM1A 2VK8A 4XWKA 2O6LA 4RJLA 1PDWA 1UXGA 3RABA 1Y3CE 4UU8A 1D8TA 1YSCA 3WFIA 4Z5XA 5JC8A 4UE6A 2IBMA 1E3WA 1MX3A 4ZMBA 3GEMA 3IVAA 3GLUA 3IE1A 1OJLA 3AESB 3EA4A 1VI2A 4HN4B 1KO7A 1GLGA 3ROKA 4CG3A 3PQ2A 2GN0A 4ER3A 1IULA 2XKAA 1Z88A 4Q4LA 1IAQA 5HR5A 2WIBA 2F9MA 3AHCA 4Y6QA 2ZRKA 2W6MA 3K1AB 2H00A 3QQPA 4PCUA 3UFBA 1MQ9A 1RWVA 4AS3A 1H5QA 3GLKA 3PQDA 3QKTA 4YYZA 5CM2Z 5GJBA 3MLBA 1OB5A 1LUAA 1XTIA 1FDTA 4TROA 3SBXA 2YIVX 3WGMA 3ETHA 2PE5A 2I80A 5E1MA 2A9RA 3QQ5A 2GKSA 5GJWC 3UOTA 3M33A 4Z2YA 4FFPA 1T5LA 4GICA 3KT6A 2ADFA 2GEKA 2WTBA 1QPGA 2ORWA 3F47A 2HRZA 3MWFA 3PXAA 3K94A 3THWA 4C88A 3W5AA 1HT0A 1DI0A 2TMGA 4P31A 1ZEMA 4IR7A 1WRBA 4UEOA 4UXHA 4ZXFA 4B44A 4DLBA 1Y3DE 1ADYA 1NZFA 1R0CA 4TXMA 1GCGA 4G8JA 3W2TA 2HA4A 1R3UA 3MILA 4P38A 4YR7A 2GCPA 1O4VA 4D44A 4BNFA 1WE2A 4MUHA 3ZCPA 4OFXA 2V54A 3V8VA 4RMGA 3W6NA 3QPCA 4IBOA 2CSUA 3PD1A 3LUJA 2HSDA 3LW7A 1GGEA 3PEEA 4LOKA 5C31A 5BV7A 5IDXA 3SLKA 3DE7X 1E8NA 3DPIA 5B12A 3A4IA 1M2GA 4F8JA 2LWIA 3C43A 1C0LA 4L9WA 4BMSA 4Q82A 3UN1A 4E4RA 5JY1A 4MKHA 1KTVA 1Z2CA 3EA5A 1QRRA 1HLDA 3A6FA 3TQSA 3I72A 1DOAA 1DCMA 2JZCA 3HWX1 4WESA 4A0GA 3ET4A 1FMFA 2DQKA 3IDQA 1JLLA 3NBAA 1KJYA 3EFOB 2CUKA 2X7XA 4NEGA 5IJ0A 3WLAA 2WNSA 1G8PA 2Y71A 4RDXA 1BE1A 2W58A 4OF4A 3AM4A 3P9ZA 4ND4A 4QOJA 4XQEA 3A2NA 5ITZA 5EQJB 3MJHA 3D3QA 4Z4IA 3GRYA 3FHOA 5MGNA 1MP0A 3EIWA 1NV9A 1T0BA 4JJGA 2BR5A 2VQDA 2VWHA 3OESA 5JE8A 1D5WA 3ENKA 4RVSA 2W70A 4A10A 4EL0A 4D4JA 5AKJA 3R9XA 3VSAA 4NX2A 5E6SA 4IJ6A 2IPXA 2YWXA 3B38A 3TIGA 2OORA 1T1EA 3PJFA 1ZOOA 2AFHB 1BFUA 4R9SA 1KFEB 4DUPA 2QE7A 4ES6A 4P4TA 2J4FA 2P3LA 2V5UA 1V9LA 3QLJA 1FMCA 2OXCA 3KQLA 2Z3ZA 3K2BA 3KZXA 1RYMA 1WU7A 2EWWA 3FM8A 1K6IA 2HTFA 3GGJA 3SXUB 5IJAA 2J85A 3X1XA 1Z7WA 2FU5C 5AWFC 1QZ3A 2OTCA 4FCVA 4DDKA 2WVGA 3V8PA 4KPYA 1SMKA 1JLHA 4U2DA 2ZWPA 4A3SA 2IYOA 2XMZA 4X6UA 3PHBE 2PYDA 2Q4OA 1U3TA 3LLSA 2AQ8A 1XCJA 4KBFA 4LVUA 5AP9A 3QBJA 4YONB 2OA0A 3WKDA 2YJZA 3ICEA 2GUWA 3ZQ4A 1U7FB 2WMOB 3DMHA 3R40A 1JE0A 3B3GA 5J59A 1PK7A 3MQ4A 4DHWA 3OEED 1USUA 1T3ZA 3MF4A 3N0XA 1C9JA 2J67A 2CLHB 4P7JA 5IAGA 1ENYA 1PJQA 3NGLA 1YACA 3PE3A 3EH2A 3R23A 4ZQHA 3S2EA 2ZB3A 1PS9A 2XE8A 1RWXA 4FQ5A 4FLFA 5HF5A 3VR6H 1WW8A 4M88A 5KVCA 2WHRA 2ZE5A 2ZT5A 4HJRA 1GLNA 1HM5A 2DP4E 4MUEA 5BMVF 5CIQA 4BWGA 2OV1A 4E3WA 1FVOA 4AQYB 3NOXA 2MYPA 4S04A 1X9HA 1U8EA 4ITVA 4FX2A 2W6CX 4L08A 4XD7D 4JI8B 3R6TA 5DM2A 3UEOA 3K1ZA 3DCJA 4Y6GB 5ESDA 2HJSA 5DLDA 4Z2AA 3KOOA 4HWPA 2HQ1A 2O57A 2WY2D 3MRVA 3OTWA 3OF2A 1YI0A 4D9JA 3FJYA 2HHAA 3EWIA 1EK6A 2QRMA 1NW5A 1JIKA 1GUDA 2H4XA 3LRPA 4HDSA 3WNVA 2YNMC 1Q0HA 1MAUA 3OJCA 3PJDA 4FYYA 1WXQA 4HTFB 1ISSA 5EAIA 1BRMA 4RMJA 5AW5A 4ZI3A 2BGNA 2XE4A 4PONA 2TMDA 1G5QA 1JLSA 1TZJA 2I3DA 4ZICA 2C4UA 2V3WA 4D5EA 1BMTA 3ELBA 4LJKA 1KOGA 3AUFA 1SBTA 3U13A 3AR2A 3L1VA 1CF4A 3DXXA 3WDLA 1XZNA 4ED9A 3K15A 5K0BA 1L7VC 3FN4A 5CVCA 1CJTC 5ALFA 2NPFA 3UGKA 1V8ZA 2ZJ2A 2BRUC 3A4NA 5JZBA 5LZ2A 5B3LA 4OPMA 3DV0A 1R4NA 2VTKA 3IBFA 4EGFA 3QVXA 3E2PA 4Q21A 3EY4A 3QU2A 4YMLA 3QWIA 2FOLA 3CN7A 3T3PB 4EUEA 3GP3A 2IGTA 3LW8A 3FHCB 4QO8A 3REGA 2NU6B 2HD4A 3OICA 1G9TA 1J1IA 3H6GA 4AN1A 4TTJA 4DIMA 5B55A 1V2HE 2YJ3A 5IULC 5KHLB 5HX7A 4M9ZA 1U8AA 4CWAA 3G2MA 3ABQB 2P35A 4R1TA 1HR0B 4F4IA 1A9RA 3KNZA 2C78A 5ER9A 4JD5A 4C07A 1BFDA 3PF8A 4N8DA 2ZI3A 4EG5A 4KBYA 1NI4A 2Q7XA 4AY6A 4GL4A 4Q7LA 3W5UA 3NEYA 1E1LA 3O73A 4CEJA 2C82A 4KVAA 4E5PA 1DEKA 1DKNA 1F2UA 1KYXA 1AKEA 1IWBB 3OIVA 3QIAA 4M0KA 4R9PA 4FFBB 4R4JA 4L7QA 1G59A 1KY4A 2P6PA 1NASA 2VHUA 4XEUA 2Q5IA 4ENUA 1RRGA 3K9HA 4AY2A 1VSBA 1Q0QA 2DX7A 3UJDA 5HQ3B 2ZJ5A 1P17A 1JEYA 4Q39A 3QEAZ 4IXWA 4M2LA 2C4TA 1X8LA 1LFDB 1K2VN 2JDIA 4Y7DA 4MS3B 2G9QA 3WGJA 2J5RA 1AUQA 3M82A 4NBNA 1SULA 2ZI9A 2ZT6A 3HXTA 2WIDA 5KX5A 3ZG6A 3D4OA 1RMQA 1L4KA 2JQLA 2COUA 4XM2A 1P75A 1OXTA 3ND5A 2B6NA 1CKEA 3MELA 4PAGA 5C8YB 3GHHA 4B5LA 1OSNA 3DE5X 3FOZA 1TVMA 2IHYA 1NXPA 3H86A 3FOEC 1CY4A 3U7GA 2JD1A 1SHZA 1ZS9A 1SO8A 2I4IA 3J81A 3QV2A 3UMZA 1L5OA 3EEFA 1F0PA 5IMBA 2JK0A 2FMFA 1LDMA 4NFHA 2EP8A 2FPMA 3C8MA 1NG1A 4YRZA 1TAGA 2A1IA 4DANA 1YB2A 4W82A 1CR1A 5ULLA 3OZRA 4ZFNA 3QFSA 4MQBA 3IVMA 5EFOA 1ZMBA 3OI7A 3PGVA 3ST7A 1XN1A 5ICGA 2ZRHA 4RACA 1H9CA 3HB0A 1XK7A 4ESVA 1KK2A 2XQFA 3U9SA 2KHZA 4U7DA 2HXYA 1QK5A 1BOFA 1NUPA 2HF9A 1NXVA 1W85B 2NIPA 1B23P 1H5NA 4JDPA 3G8DA 3SXJA 1ZGHA 4QGSA 4LF5B 3Q8MA 4E5VA 3AF5A 2GESA 1UMDA 2IQ5A 4HDMA 5DGTA 5C8XA 5FPKA 2I1VB 1OXMA 3TLEA 5K0CA 5LDDC 3CYFA 4C2TA 4FDAA 3FSRA 3H4IA 1E2UA 2H7CA 1IK4A 4QPPA 4EX6A 1OHHD 2D1TA 3FBWA 4HWRA 1OZGA 3WWCA 2PKCA 3THXB 2JAWA 3EDMA 5KSWB 2ZYVX 5K3OA 3DTVD 2ICAA 2HNBA 4BB6A 2X2PA 1ISFA 4G36A 2P30A 2DUUA 4A9AA 5M2QA 4IS2A 1ZI9A 1FFDA 4GZ6A 2WHPB 4H87A 1MJFA 2HMWA 2X6RA 7ABPA 4B71A 4RQBA 5FQOA 1JALA 3HBMA 2W2LD 3LLMA 1CUGA 2N3ZA 1ZOLA 3FZYA 1G8GA 4HL6A 4MKRA 1AV6A 1QHHA 1GJRA 5E3HA 3DDNA 5LQJA 4CZ2A 2J3DA 5CLGA 3SY8A 4ZOQI 2Z83A 2P2GA 2QZJA 3STYA 3H83A 2K7ZA 4CMBA 4LI0A 3VOBA 4WBXC 1UR5A 1TK3A 2Q29A 3LIIA 4NBVA 2JBHA 4UULA 3DFKA 3V7UA 3KM0A 5IRCD 3RSCA 3S81A 2CV1A 1T5IA 5EXXA 1SH7A 4UTNA 4OJQA 4RLSA 4UE2A 5HZGA 5HDBB 2O3UA 1QVAA 2BMFA 4WXPA 1MIHA 4JMLA 5IM5A 3U4MA 1YAHA 5TGZA 4RLQA 1DEHA 5HJ7A 4QG7A 3V1MA 4FT4A 1PWHA 2WVHA 5JEDA 4MWOA 4YXWA 3E82A 3MBIA 2EKPA 3R3UA 4DQVA 1DMRA 1NBHA 1U3VA 1XEFA 4PIMA 5EESA 2RHGB 2BJWA 4BMNA 1NMXA 2HT1A 3AG5A 4Z9YA 3WWYA 3I9FA 1VJ0A 3A6DA 1U7DA 3E7XA 4JB2A 5AI9A 5ITVA 1E0DA 3LCVB 1N4AA 4CCWA 2A0TA 3C7KA 4FZJA 4D9BA 4XVQA 3ROTA 3NNNA 5ECGC 4M46A 3ILHA 3G82C 3F97A 3RKUA 4I8DA 1JDPA 2BFDA 3MD9A 2IE0A 1YQ9A 3NAZA 5LYJA 3B5EA 4C7JA 4RTQA 1KJQA 1Y9AA 2D7DA 1TUGA 3KU4A 5CH5A 1TJ4A 1N8KA 2QRGA 3DC2A 1QP0A 3SVZA 2E48A 2Y1FA 4I19A 4A0EA 3N58A 5TQVA 3ONEA 2C1ZA 2AWOA 3W2FA 5IVHA 1JT2A 1JHYA 2ZOSA 2KJQA 1UOEA 5GOTA 2VUHB 3UJHA 3MPUA 3IAS1 1W30A 2I87A 1I0LA 3OE7A 3AI1A 3P45A 4P54A 1BKYA 3IC5A 3WIOA 1C4OA 3GCZA 1RYFA 4KOAA 2W6JD 1I2CA 5B1IA 5BSMA 3WNDA 4KR3A 2Q2QA 3ZW8A 1V7PC 4OSOA 2J3JA 4D4KA 3BQ9A 2VUUA 2H11A 4DG8A 1VBMA 1Q0PA 1KZ7B 5B2EA 1DX9A 4EEXA 1E0JA 1JB9A 1VG9B 3L8YA 2VOJA 3UWSA 1ZK0A 3I9NA 1DRKA 4FWTA 3A9VA 3MTIA 3ZKWA 3FPJA 2HDWA 5K09A 3QG1A 4IJMA 5LLTA 1Z4OA 5FWDA 1KJZA 1EEXB 1XDUA 3G8CA 4K9RA 3OM1A 5JNUA 3JU3A 5KNDH 4HAOA 1CETA 4E31A 2VZ9A 5I7HA 2PKXA 3ZKAA 1R6VA 1YNSA 3AY3A 5TS3A 3JVVA 2H29A 3SF8B 4DCPA 4PPYA 4E2XA 2ZWMA 1GPDG 4U2BA 1LVUA 1ND5A 3TIIA 4PIPA 5FEMA 2Q5EA 3K70C 4U0JA 1FJ2A 9LDTA 1C50A 1U02A 1Y8AA 3M8KA 3Q9LA 2CMKA 1H2HA 2VJNA 1LZKA 2FOXA 4BFSA 3FOAA 2ZJYA 4G3XA 4NBUA 2Y6UA 1WCYA 3GPDG 1L5GB 2R9VA 1Z8NA 1T25A 3N8NA 1DTWB 3I6YA 3PR3A 4TS9A 4YGXB 3L77A 5EHGA 3S5JA 1K97A 2HQRA 3O4RA 4G4JA 5HCUA 2PBLA 1CUCA 4J29A 3SEFA 5DTQA 3S2SA 1DMSA 1HY3A 2P90A 3LTEA 1RLTA 1HDCA 3EXAA 2CSWA 2YQ4A 1TIPA 1XMVA 3NNSA 4I5EA 4QOHA 3RS3A 2V6MA 4ZO6A 4OEHA 4BUJA 2FEMA 1QFJA 2D62A 3L7BA 2X4IA 4HVTA 4K26A 5HGJA 4OIMA 3DAFA 4TWJA 3RKRA 3N2ZB 4CM5A 2C83A 4M1EA 1M5TA 2IE8A 3ZWKA 1R9GA 2Q4DA 4Y2JA 1IYZA 2XWJI 5HMLA 2JLCA 1DT5A 1DXQA 1QMGA 5F76A 3PI6A 1JI3A 4AC9A 1JEEA 3AJDA 1G4AE 2NX2A 4HQOA 3EN0A 4Q4AA 4MHTA 3HCPA 2FRDC 4MLPA 1W47A 4AIRA 4D8TA 1EAMA 4AJ9A 3MGBA 1GZ5A 4IGAA 4NCNA 5CDTA 5TEWA 5CB4B 5I8PA 1B0UA 2BCJQ 1ICEA 1NGSA 1KSGA 1G3GA 4AMZA 3TZHA 1WIWA 2YV1A 1JIJA 3HMQA 1A8PA 1RVDA 3C1AA 3DWGA 3I64A 2A0YA 1V1JA 4TYYA 2ACKA 5KU1A 2QX6A 1VLMA 1DC8A 4BJ3A 2AN4A 1PQWA 3U40A 1BXRA 3ZOZA 3FFXA 5J2UF 2YQ5A 1YUBA 2PGIA 3TVTA 1UXKA 3RTDA 2PXHA 3HLTA 4GQAA 1KI6A 1PDVA 1MC5A 1TEVA 4JWTA 4RDCA 4Q3KA 3IOBA 7REQB 2C0CA 1JFFA 2GVDC 4GNKA 3NV7A 4PIVA 2IV7A 3RUEA 2HFKA 4B9EA 2HWXA 2Q46A 2J31A 4MW7A 4BTEA 5I9TA 3I2JA 4AMBA 1J2FA 3KCNA 3OUNA 1QYRA 4U8HA 1L5NA 1UDXA 3ZX4A 4RTSA 4FDLA 4NV1A 2V58A 5DHPA 4AY3A 4JFAA 3GDGA 1RYZA 2AX4A 1T13A 1KI2A 3BWDD 4XJTA 1XC7A 4HYTA 4QU8A 3OOJA 4G8CA 4D97A 2I2WA 5CFNA 2HFJA 4Q01A 4NZNA 1I4WA 4JXKA 4DIUA 4EATA 5BSKA 1XE3A 1TPZA 3A27A 1S2GA 4C3UA 4FMCF 2ZB8A 3WK5A 1LK7A 4FHDA 1GZHB 3T95A 4IEIA 4ZZIA 1P1KA 4GIBA 1Z33A 2XDQA 1AURA 1YU6A 3INGA 1B26A 1QF7A 2EBUA 3LOPA 3Q6MA 4KYUA 4EPTA 2XNDD 2JKDA 3EVCA 3QWHA 4XTRA 4WK0B 2WAXA 4RD3A 3STUA 1RYEA 1PSDA 3IAUA 3CKYA 4YAGA 1I8TA 1C5KA 1P5JA 3WGHA 5CCXA 1R10A 4HLCA 3KSAC 2IH4A 5EQTA 4KFSA 2PSFA 1TVKA 5JD3A 3T06B 2K2QB 3OEWA 4KHZA 4B83A 2R8OA 1L4EA 4O4LF 4YAIA 3W1EA 1GA4A 1EINA 1HOXA 4RSGA 4ZI7A 2WINI 5AW7A 2OCDA 4X54A 3WJ7A 3EBLA 5SY4A 1VL8A 2PZLA 3EC2A 1WG8A 4G5FA 4Q1DA 3WGTA 4EHKA 1F14A 2O8NA 3UJBA 1H85A 1OY1A 2ACEA 3INRA 1KIFA 1Z4JA 4J76A 3R7BA 1PYGA 1T4GA 1S2LA 2QE6A 3W9UA 3QXHA 2KBEA 4Y2TA 3L06A 4N0QA 1Z18A 4RGVA 4ZGBA 2BMDA 1T3GA 1PLJA 4R6WA 2WOJA 3AF0A 1EWKA 3ISTA 4OMCA 4NRDA 3TF5A 2C9BA 3WYFA 3G0HA 3KUUA 4XWYA 3GGCA 4JLKA 5IMSA 3NALA 1E6UA 1FLNA 5IJXA 2PKEA 2WJIA 2YWFA 4GP6A 4P22A 5AUPB 3VPFA 1VE7A 1CR2A 1P45A 1TLLA 4Q7QA 5E6RB 4MHOA 1GNSA 4LJAA 1AK1A 3VAZA 4B43A 3IR7A 5L45A 4IMRA 5DISB 1G2PA 3SXPA 1VMDA 1EM8B 1HRKA 2BFFA 4YRKA 4B76A 4BCCA 1RZRA 4X71A 2EWVA 3H16A 5EIWA 4BFYA 1SXQA 3U60B 1EK2A 2A8YA 2VT2A 2YQZA 3GD5A 3VBEA 1XMJA 5EUMA 3AQ4A 2X14A 1GCAA 3ABOB 4HWTA 4INZA 3QUAA 3PNPA 4FTWA 4CODB 1T24A 1PFVA 2O2DA 2IX3A 1DQPA 1YKGA 1RTTA 3CEJA 2OSBA 4RULA 3LDGA 3TW8B 3F6BX 2H7YA 4ZRDA 3GDHA 1G6Q1 2A1TR 2J0SA 1J4QA 2C4VA 4ND7A 5BW8A 2QS9A 2B4QA 2FFJA 3UT5A 1CVIA 1BO6A 4GZLA 1N8NA 5DP1A 2XXBA 4DCNA 3FKJA 2QRZA 5FFMA 4RL6A 5LBTA 1DZ3A 5JNVA 3VNVA 3AEQB 2OV8A 3LM8A 4MGZR 1F8GA 1GQ2A 4NARA 3H04A 2X7HA 2Z09A 3V1UA 4MK4A 2Q1YA 4UD6A 3DMFA 2ESRA 2DGDA 2HWUA 2IEDA 3E15A 1V96A 1P2FA 2FPLA 2PSHA 3GA5A 3SAJA 1TIBA 3X1WA 4YTEA 1YJXA 4W6ZA 1RM3A 4H7FA 1GNVA 5DNAA 1AHPA 3COWA 1MB2A 3BC1A 1YJQA 2UKDA 2PGXA 3ZJ4A 3CA8A 4PM4A 5I48A 1PUIA 1RXWA 3EDYA 4UDOA 1W8DA 3AXSA 4KU4A 1MJGM 5AYVA 2VPIA 5TE9A 4ZHQA 3AC0A 3CNEA 3BJEA 1PNOA 3OLZA 2QN7A 1PX2A 1ZL2A 5ALKA 3PFBA 2QPAA 4GI1A 3M3HA 4ZEXA 1KXZA 4EA9A 5CA1B 1H8EA 4AU1A 1KDVA 3TOCA 4E7PA 1P9NA 1EFDN 3TBKA 3CVWA 2YV2A 2VPZA 3EYAA 3ZWBA 2GK3A 4EF5A 2J0UB 2V1XA 3D9QX 2GM5A 5E9QA 1QGYA 2VF8A 2VQ3A 3GUUA 4G86A 5HYVA 4NCXA 1T15A 4U02A 3VU9A 2ZM6B 2PL9A 3VNAA 3UGTA 1M1YE 2CK3A 2CHQA 3GFPA 2PSEA 4N47A 3TD9A 3V6LA 3GJ6A 3EXHB 1PEKE 2VL7A 4WLEA 1ZL0A 1HQCA 4IDOA 3CWZA 4Y7CA 1WUTA 1CUIA 2O1SA 3KR9A 2R1ZA 3MMZA 2ZKLA 4QOIA 4UHBA 5J5VA 1ARZA 3SZOA 3I5AA 1IXRC 2W2KA 2E18A 3D3WA 3WK8A 5JAHA 1JWLA 3UOWA 3CT4A 1XUOA 1EB9A 3CZCA 4IIJF 3KKPA 4JUDX 4OCZA 3RS9A 4HG2A 3VTKA 1GZSA 3KOUA 4UOZA 3RWBA 1V8BA 1OXBB 1PZGA 3WGVA 1JIUA 3WV4A 1T8UA 2IUFA 4KAXA 4QDJA 5H4GA 2H1FA 2VXCA 1OFVA 4R2LA 5F5NA 3N74A 4CUJA 3R41A 2WG1A 3RC2A 1ZCBA 2Z9BA 3DL0A 4UOQA 3EUFA 2RGGA 3WY9A 2UUPA 1XZDA 1CBUA 1E2EA 4DCSA 4F45A 4JX8A 4EYEA 1WBDA 3IHKA 3Q3IA 4P3XA 1RDFA 5KWJA 2PUVA 1GNPA 3EDOA 3I9KA 4NK4A 1JFLA 1RPJA 1TJNA 1NHWA 2DFPA 3ANMA 2N46A 3ILVA 4I1YA 5DLPA 3VFDA 2DMRA 1ZVJA 3H9GA 3UXHA 3IVGA 1DLJA 2P2SA 1FZQA 4P4LA 4B7ZA 4J0CA 2IU4A 4MUBA 1KO4A 3IOCA 3V55A 5L7TA 3SVTA 3KDPA 2FPIA 3OIFA 4YP5A 3ZU2A 4A27A 4TTAA 2VWQA 4P9NA 1GILA 4XQGA 3RARA 4LRSB 4AL4A 1RI3A 4I4NA 3NYIA 2Z98A 2XZDA 1O6CA 4Z0TA 2HT6A 4N01A 1VSTA 4Q7MB 3SF8A 4C7KA 2B2XA 3PUYA 3PQ6A 3OEEA 2GNAA 2MTBA 2X9LA 2WWVD 1QHIA 2I8AA 5DCWA 5FOVA 3NQ41 1J23A 2C3MA 3IBTA 3LWBA 5TXGA 4L5IA 2FQQA 3AVXA 4M6WA 1GYQA 2EDAA 5HJ5A 2EKLA 3POAA 3FSEA 4YALA 4J9UE 4HWOA 2GPSA 4ZI5A 2PFKA 2CZGA 2QDXA 3D6HA 1U99A 4EAQA 2HJWA 1AB5A 1GRRA 1KEWA 2JK1A 4ZANA 2BE7A 1RXVA 1TQHA 4HPJB 1FFSA 2E4ZA 5DHRA 1L8AA 1UMKA 3GMTA 4LWOA 1J07A 2OBMA 4H3KB 1IBSA 4F7WA 1JPJA 1HGXA 4P2BA 1HNNA 1I4TD 4XYMA 3QF4A 2WOOA 3AOEA 4A0QA 3ZLJA 3ZJUA 4PY2A 2O3SA 1N2SA 2O8DA 2AB0A 2HZ7A 3D8HA 2ZIWB 3UJ6A 4LE2A 3ENVA 3PDCA 4Y2YA 3AL2A 3RODA 3KLMX 2FSVA 4JDUA 4JGBA 4V2IA 3UJ9A 3HU2A 1OF1A 1FUUA 2OLEA 1J7KA 1QIGA 1X7WB 1X1DA 2GH1A 5KB3A 4DR6B 2D0IA 1J90A 1YRBA 3VNBA 2AFRA 4Z4QA 5SZIA 1XTTA 1TGVA 1XMXA 2C58A 4URFA 3WNCA 4PCAA 4W5OA 4ZOCA 4LOJA 2RGXA 4MUAA 4HZUB 4J7UA 4OY3A 4YJHA 4QYIA 2Q5LA 4HWGA 3VYWA 1IVNA 3OMWA 2CLLB 3RJZA 3A1CA 4L3VA 1W35A 4TGLA 3UK2A 1YJMA 5JEOA 3LUBA 3MWEA 3OIUA 5FLEX 2WR8A 3ETDA 3I1JA 1VB3A 4DKJA 4MDEA 3A1SA 2D8AA 2JJYA 1CQJB 2OGWA 2WKPA 3D7NA 5CXXA 3VMFA 3CWQA 5LMZA 3IPXA 3Q3JB 1MR3F 3H0EA 4TWAA 3P5BA 3ZUPA 4ZVMA 3RYTC 4Z86A 2VSYA 3M4NA 1KY2A 1RZUA 4PYIA 2VWGA 4ZALA 4CU2A 4BRZA 1E18A 2XB2A 1MZPA 3L0PA 2V0GA 2O06A 4KQKA 1Y89A 1YB1A 3AW9A 2IV2X 4FB4A 4E70A 4FDVA 1ZCJA 2JIBA 2ZPUA 4UJ3A 3ZOKA 1YGYA 4YLYA 1BTOA 3OETA 3HP1A 4GPZA 4EH1A 1Y3BE 2X3FA 4Y30A 3SYLA 2A9VA 4BV2A 2R4UA 1OXKB 3HI6A 3PVSA 2Y0PA 1T2DA 2HPHA 4AY4A 4J2OA 5DYTA 4EDFA 2YCBA 1QRUA 4UFPA 1TMOA 1A5AB 1ZJJA 1SK8A 4NOLA 3SN6A 1XVIA 4MB0A 3AOGA 5CDFA 1NW7A 1ODSA 3TS1A 5C1PA 2PRKA 1R8XA 2BY4A 2DHRA 2EQ5A 2GEFA 3TDKA 4C05A 2XD9A 2WUEA 1Q77A 4NFSA 3CLVA 3DEAA 3LBFA 2V6GA 4QREA 4IOJA 4D8VA 3L4KA 2YY7A 3R7SA 4KTVE 3DL7A 4UUOA 4M99A 3HR8A 4ESEA 3FAKA 4TV9B 1LS6A 4DBVO 4R40A 2ODEA 2PH5A 2ZIUB 2X2OA 2CLDX 4KACA 5BSHA 3JQBC 3GI1A 4AQ7A 5DTRA 5FHQA 1VXRA 1OC4A 2QW1A 3GRKA 2ZAGA 2ODWA 1PNQA 1UCFA 3DR5A 2QTNA 3EXG1 4KQCA 4C4YA 3R9WA 5GY7A 3DOFA 2M6KA 1Y9DA 2QTAA 3L8CA 4JJ7A 4DNXA 4CMAA 3R75A 1DOHA 2PKRA 4LZWA 4MRRA 5JEJA 2EJVA 4XEHA 3A6JA 4ILKA 4B80A 1KDTA 3FI9A 1K5DA 1PTJC 4XIYA 4J7XA 1ZZEA 3ZZ0A 3OFKA 4DJAA 1UBCA 2JG3A 1TQ8A 2PT5A 3FNQA 4I8XA 1J70A 2IPMA 1S3FA 2HYDA 2O52A 2DWUA 5D3ZA 4ENRA 4X20A 1QIMA 5EJ9A 2O5CA 3ETNA 1PR3A 5DHUA 3ZE2B 2XTZA 4JR1A 3L5OA 2R7MA 1R4AA 1XZQA 4C6HA 3A4VA 1RI5A 1YCDA 4O2LA 2IS6A 1HE3A 4DLXA 1XEXB 2VRCD 2WG0A 1H8HD 4C6SA 1IWPB 2TYSB 4ETNA 1P9RA 5DXAA 2P3SA 2QRNA 1UMBA 3LVRE 4KMMA 3ZJ5A 4DKXA 5CEEA 4LOIA 3MWYW 2PBZA 4JEHA 4UEWA 1E3MA 2ET6A 4MAFA 2AFHE 6PFKA 4HNAA 5FV7A 4QZVA 3KPYA 4I1UA 4RK4A 5C53B 2D2FA 2AW5A 4A8JA 1CIPA 4N9WA 4DDWA 1CQZA 1HDRA 3OJLA 3DMTC 2IHKA 3VKHA 4R8RA 3A3YA 1I2DA 3TPCA 5JPCA 5ITZB 4PG7A 1OOEA 2HYIC 2DWQA 2FW8A 3QGMA 1V3VA 3VC7A 3DTYA 4Y0AA 1Q1GA 2IL1A 3CMCO 4L15A 2G5PA 1I6KA 2REQA 2VN8A 2HXGA 2ZQYA 3C3WA 5DCYA 5A4AA 3ZD6A 2J7PA 2JRCA 3C45A 5CH8A 4ACBA 4HNRA 4PNPA 2Q28A 3MOGA 3WQBA 3ENNA 4XJSA 3PJRA 2OCBA 5EOVA 3E22A 4EG1A 4B3JA 2R1VB 4RENA 3PL1A 4P3PA 5I4IA 5B1EA 5FWNA 3IQFA 5MN6A 1KVRA 4JGIA 5K2OA 4CHGA 4N7JA 5CURA 5LZ5A 1UC8A 1XOIA 3DQPA 4TL6A 3OPYA 1NVDA 4HB2A 1QHEA 5CJJA 3B53X 2AMJA 2UZ1B 2YN4A 4O02B 1ZCZA 1Z5WA 3DT6A 4JLAA 2HHHB 2VBIA 3IMEA 4D9NA 4DW8A 1Z5OA 2F1OA 3IAM1 3DMDA 3MB8A 1SQ0A 4N5HX 4G0QA 4UEJA 5EPOA 4HQLA 4ZO8A 1TCVA 3DUFB 4FE7A 4W1RA 1LJ8A 3UB4A 4B0PA 1EXWA 3DYIA 3KT0A 3HFJA 4N0MA 3UA3A 4KITB 3ETCA 1URPA 1Z38A 2IYTA 4TSKA 1TQ6A 3TD2A 5K01A 3CKLA 1AT1A 1GL3A 3K2IA 4KXWA 4RU1A 3IULA 1KPHA 3ZR4B 4DLLA 3HZRA 4MW9A 5C7YA 4QOEA 3F6PA 3A6HA 1QH8A 5ALHA 5MFPA 2X9QA 1VFPA 2F4VB 5LYJF 2IIVA 3G2KA 1B1AA 1JE1A 4QDUA 4KTTE 2FVXA 3LGSA 4KSBA 2Q3CA 3OTHA 3ITDA 3RVDA 1DBWA 2D00A 4MPTA 4N1AA 1UBUS 1HE4A 2O50A 3EPJA 3PC4A 4L07A 5BPHA 1F06A 3L40A 4FYXA 2P8JA 3ZBTA 1R0YA 1GA1A 4RKYA 1T5BA 1J2TA 2GSWA 1AKRA 2DPGA 2FDXA 3U7FB 1U4NA 3HJBA 3OZGA 4BNJA 3ND9A 4CGYA 2IW3A 1CRQA 4OBEA 3UTDA 2LE0A 3ZDFA 5KPDA 5J47A 3P2JA 3GY0A 1AC5A 2R44A 2IBTA 3AIIA 4XGIA 4HS4A 4Q3DA 1CQXA 2RONA 1E5LA 2UVPB 1PJLA 3MAJA 1XTBA 1FVHA 3R7WB 4RY9A 4CIAA 4LXXA 4J6FA 4CMCA 3BD9A 3JY6A 5AM5A 5EL0A 5DH9A 5FUQA 3ER9A 1CULC 4FYJA 4P5EA 3EUAA 1U5CA 2FR0A 1WZEA 4IVRA 4RJ2A 4ZDJA 1JKIA 1PK9A 5T4HA 3ESBA 4FGUA 2O3JA 4OOFA 1MFZA 2FZLA 4XOIA 3TCKA 2BI4A 5IAOA 1FRNA 5AR1A 5HM6A 5D5HA 2B78A 3QSYA 1RXCA 1C9MA 4LNHA 3UMGA 3PGXA 2R1UA 4FEAA 4PLWA 3CBQA 1WMDA 2WIAA 3CRNA 3L93A 4L72A 3HA2A 4AKGA 1WZIA 3JZAA 1RVV1 2QMHA 3IQGX 1Z36A 1YDWA 3MXTA 3ELVA 2J5KA 5CAEA 1N1MA 2FWPA 3GJQA 3HHEA 4DLKA 1V7QA 4Q3CA 1FUIA 2A14A 1IHPA 1QKIA 4GPAA 4OFBA 4ZQIA 3TL3A 4DA0A 1FS5A 4JIVD 1XU7A 2GRAA 3AZPA 4O2RA 4W9NA 5HFAA 4DPKA 3WE7A 2HF8A 4TOIA 3QG5A 4LTDA 3D43A 3GJRA 5FP0A 1RRVA 4M0LA 1LNZA 3FF1A 2QVGA 1ECBA 1P9OA 1PHRA 2OECA 2QSZA 2OQVA 3KQKA 3E03A 1FW8A 3AO0B 3FRIA 2CJFA 4YRSA 1IZ8A 4QTXA 1A98A 1USVA 5EUBA 4B34A 3KKMA 4EJSC 4IG9A 5KYUB 2DY1A 4RV9A 4K8OA 2C9CA 1ORRA 5IXSA 1Z6ZA 2ATVA 2SBTA 1JF8A 2O4CA 3FI0A 1LLDA 3KAJA 1P0PA 3QE2A 1TXGA 2JH9A 4FYWA 4NLLA 2HCJB 3ZK7A 3PC6A 1UPBA 2YZKA 3U56A 1VE1A 1Z2PX 4D99A 4YX9A 1P7PA 3I39X 4W9RA 3SF0A 5BSFA 3EFHA 4HX5A 4AYWA 4BKMA 3JYNA 3ONFA 1TF2A 3IERA 1T5DX 2ZIGA 3C2QA 3RUPA 5HZKA 4TL7A 3LO5A 4GX1A 4WOJA 5I3ZA 5K05A 2A0UA 1TPYA 3LBHA 4D0RA 5FRDA 3FWHA 4C03A 4OHKA 4EKGA 3EZXA 3KAQA 2IV3A 5CB8A 4AKHA 4OBWA 5U4XA 1EJBA 3DMPA 1OBOA 4BYGA 3BYZA 5F1PA 4YMUA 2G77B 4KPFC 5HCNA 1H2ZA 2WPDA 3O7WA 3VR4D 1E2DA 1ZLYA 2XPCA 1Z2NX 2BEJA 1IZZA 1VJCA 4FIDA 4E5YA 3UHFA 4HEA6 4AMGA 2DQYA 4PGHA 3ZGVA 2XKKA 5K0NA 1BX0A 3EUWA 3SBOA 4EKNB 3PEWA 1LJLA 4Q47A 5FA6A 3V32A 4ZO9A 5GVRA 2BZGA 5KAPA 3U5ZB 3FCUB 1PG2A 2I5PO 1E59A 1GY8A 2J5XA 2YMMA 5HIJA 1GT91 4F5WA 3O0DA 3VPAA 3BXGA 1A9OA 5KTMA 1NNI1 1JG3A 2OHGA 3B2QA 5HDQA 5J23A 1DAFA 1QORA 2ZUTA 2PQMA 4EY6A 3V8NA 2OC9A 1JAHA 1OLXB 1U3UA 1V7CA 1RCTE 2HJGA 3BE5A 3KYBA 2ZYGA 2CXQA 4NYJR 3K9NA 4NAVA 4NG4A 1AQ6A 4WY2A 3SSMA 1ZIDA 2BGRA 3VR0A 4YJFA 5JZSA 5AVSA 2NN3C 4P08A 1L5KA 2ACVA 1V4NA 2B37A 3EE6A 1VMIA 3QMVA 4GMDA 4KL8S 1H5UA 5ENDA 6ADHA 4I1VA 2LC1A 4OJKA 2G1KA 2BP7A 3HVIA 5DHAA 1QHGA 2PH7A 2FE4A 4MCIA 5L4SA 1FMTA 3NNDA 1UXJA 3GLRA 1RRCA 4Y2SA 3TBHA 5C1IA 3GCGA 2QZSA 4PO8A 1KJ8A 3FXAA 2QSJA 5EHIA 4CG2A 4AT1A 3MBKA 1JDVA 4MCJA 1KI9A 3IPLA 2Q7OE 2XT9A 4GH5A 1TA9A 4OGKA 3OWOA 3WKAA 4WBNF 5C80A 1MC8A 1LNQA 1M76A 2AFIA 2DPYA 2C5AA 3OJXA 5DTEA 3I2FA 3CUKA 4FMDB 4AP5A 4M49A 1NW6A 1BGWA 3GGGA 3OO1A 3G1WA 3OEHA 3L4EA 4R41A 2E9SA 2POQX 3I1IA 3UKJA 5B64A 1VKRA 4MVJM 1GXSA 3GJZA 3RKSA 3KJXA 4NAHA 1WV3A 2VTDA 4RFLA 1QO7A 3GJYA 5HS6A 2JS7A 4BFWA 2ZWAA 4BLUA 1Q1ZA 4HMPA 3S2FA 1AM4D 4B6SA 5ELXA 2PPLA 2V6JA 3O74A 4M21A 4PGFA 4C2AA 3SR4A 2P9TA 4EG0A 4HYQA 4MYRA 3PHGA 1PVOA 1SCKA 2H4WA 1CQPA 1Y9ZA 2WJGA 3BMNB 4LZLA 4XUEA 3KSMA 2A78A 5LMUB 3GDFA 4Z4FA 4A1OA 4CF7A 4LZAA 2XEDA 1YRLA 1XRQA 2RGAA 4Q1FA 2WT8A 5AKIA 1G8MA 1BHQ1 3CLRC 5DMHA 4RJTA 3HJFA 1SRQA 1UOQA 3AIKA 5CMLA 4WGFA 4ZYXA 4ZTUB 4J4TA 4NZYA 5FTWA 2QIOA 1UT8A 2Q99A