5DULA

1-deoxy-d-xylulose 5-phosphate reductoisomerase from yersinia pestis in complex with nadph
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
398
structure length
375
Chain Sequence
SNAMKQLTILGSTGSIGNSTLSVVRANPELFKVTALVAGRNVREMAQQCLEFSPRYAAMSDEHSAKSLRLLLAEQGSDTEVYSGETAACELAALDDVDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVKRSRAQLLPIDSEHNAIFQSLPERIQRQLGYSSLNENGVSRIILTGSGGPFRVTPISVDSATMMNKGLEYIEARWLFNASAEQIEVVLHPQSVIHSMVRYHDGSILAQMGTPDMRTPIAHAMAYPMRVSSGVAPLDFCKVGALTFTTPDYQRYPCLKLAIDACNAGQAATTALNAANEISVMAFLDSKIRFTDIEVINRTVVEGLLLSEPTSVEEVLVIDRKARDVAAQVIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
publication title 1-deoxy-D-xylulose 5-phosphate reductoisomerase from Yersinia pestis in complex with NADPH .
rcsb
source organism Yersinia pestis
molecule tags Oxidoreductase
total genus 131
structure length 375
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 5dulA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5dulA01
4ZQGA 1PS0A 5K6AC 1NAHA 1B16A 3ETGA 3QVWA 4GX0A 3E8XA 3PIDA 1OC2A 4MVJE 1IE3A 4YQZA 1B15A 1RKXA 3OEWA 3V8BA 4IGFA 3Q9UA 4XJTA 4D7AA 1W73A 5CEEA 1WWKA 1I0ZA 1UXGA 3FPCA 3MJ4A 4LRSB 3NUGA 5L9AA 2X0RA 4TRMA 2VWGA 3I5MA 1Q0HA 4DMMA 2O2SA 4MVJG 4NU5A 3E18A 3VZQA 1V0JA 4TQGA 3DBHB 1K0UA 2POQX 4Y6SA 3K96A 3ZW8A 5H83A 5TJ9A 3ZZNA 3HDHA 3IP3A 4KDEA 5TRTA 1D1SA 3AW9A 3LT1A 1NXQA 1Y8RB 3V1YA 3CZLA 3VDRA 3OP4A 2NU8A 4PLYA 3VZRA 1B8PA 4U8GA 1JGIA 1CJCA 4A73A 2JFGA 4IQ0A 5ENVA 4BNJA 1PQWA 1T2DA 1LLDA 5GZ6A 3WIEA 2CMDA 5JY6A 1FDVA 1EBFA 2BGKA 4GGOA 3UEQA 3QP9A 3O8QA 2O48X 4IUYA 1FK8A 4QUKA 2WD7B 1Z7EA 3F3SA 4DBZA 4BHTA 4AJOA 4TMFA 4BKPA 4RGBA 4EYEA 1EE2A 2FOIA 3GVCA 1VLLA 5ENDA 3A28A 3KLPX 1BXGA 2D0IA 1U9JA 1JTVA 3GFBA 4CM8B 1D1TA 3PWSA 2PFGA 3NJ8A 3B1FA 4LUPA 2R2GA 3FI9A 5AVOA 2JCVA 1EVJA 2D8AA 2G1UA 3WGHA 2E37A 4P8RA 4ND5A 3D3EA 1ML3A 1OAAA 5C7LO 1K2WA 3TZCA 4P38A 1G6KA 5IDWA 4ZGWA 5IDQA 2EEZA 3NTQA 1C0LA 1LBEA 5DP2A 4F3YA 3IKVA 1E0DA 1PL8A 4IDAA 3BXXA 1NASA 5BNIA 6LDHA 4OJNA 2EKLA 3OECA 5CG2A 1HDGO 3DL2A 4AJJA 3RCBA 3BMCB 1N8KA 3GOHA 4D3SA 2ZJ1A 1YJQA 4UAGA 4FD3A 1QR6A 4LRTB 2Y0EA 3RUDA 4MVJP 4BV8A 5L4SA 4XD2A 3LT4A 4PG7A 2P9EA 2IZ1A 4PN3A 3MZ0A 3ZWAA 2EIHA 4HXYA 3ZU2A 2VRCD 2ZQYA 3OJOA 4JLWA 3DBLB 2AXQA 5TIIA 3TZ6A 1CYDA 4W4TA 1DFIA 1G0OA 1UXHA 1I3MA 5I7VA 4I9NA 4LK3A 5HS4A 5KVCA 1T2EA 2HAEA 2W90A 2X6TA 3GY0A 3INRA 3PXXA 4J0FA 2AG8A 3ROPA 1N92A 4J4TA 5IZCA 1WP4A 5BSGA 5U9CA 2PKQP 4Y9DA 3I4CA 3JD4A 3K92A 4MVJM 4UEJA 1M66A 1P33A 1I10A 1NVTA 2C07A 3HWRA 4IXTA 2DBZA 2NUAA 2QIOA 1B8VA 1MFPA 4J4HA 3JQ7B 3H5AA 3NDJA 3ENNA 1UXKA 3DR3A 1WMAA 1A72A 4CLXA 1EUDA 4CQMD 3L07A 3EC7A 4YT4A 5I7EA 1P1RA 3I9JA 2NTJA 2PGJA 3JD2A 4J1SA 1N5DA 1UAGA 4TRJA 4R9SA 4J6FA 1ISMA 5L4LA 4NZ9A 5JE8A 3FR8A 4I5DA 5KJEA 4BGIA 2X58A 1U3VA 1E3SA 2FR8A 4E3ZA 1MB4A 3ONFA 4CLDA 3OETA 1WZEA 3M1AA 1E6UA 5JDIC 3MJVA 3CZMA 4JX8A 1N1EA 3FR7A 1GPJA 3JQGB 4QFDA 1A4IA 2G17A 5ES3A 1NWCA 5BQFA 4YQYA 1UDAA 5ER6A 1LDBA 8LDHA 2UUOA 2ZKLA 2YUTA 4YAEA 3DB2A 2RBEA 5G2OA 4BO6A 5THQA 1JW9B 4A27A 2C82A 4NU6A 4W82A 2GR9A 1SEVA 3EVTA 4U6SA 5DN9A 3UGKA 1A5ZA 2AQKA 2BFMA 3H6KA 1TXGA 1EVZA 2EP7A 4XDZA 4DLAA 1QKIA 1UP4A 2OHXA 3A06A 3I52A 4XIJA 4DL9A 2WPGA 3PDUA 4MP3A 4FQ8A 2C7GA 4UVDA 2J3JA 4NBWA 2V7PA 1ZFNA 2AQHA 1DC4A 4WLEA 3ZGYA 1BSVA 1CETA 1PJ2A 4WNCA 1SNYA 4EJMA 5F21A 2I5PO 4J4BA 1GUYA 1KEVA 1PGNA 4M89A 5AYVA 3DZKA 2C7VA 2YHIA 4IMRA 3EVNA 3GRKA 5GY7A 1PQPA 3V1TC 2JHFA 1UXJA 1GD1O 3KEOA 2MAPA 3G79A 3RIHA 1JVBA 4CV2A 3ROKA 5DBIA 5JW6A 1LDYA 4H16A 1YVEI 4MVJI 4PLTA 1JAXA 4B4OA 2RAFA 1E5QA 1MA0A 1XU9A 1LC3A 2B35A 2OBNA 3JQCA 2ZTVA 1LSSA 4RL6A 2IYOA 4D0RA 3VC7A 3WNVA 1ZCJA 3OIDA 2NLOA 1H94A 2NSDA 3OA2A 3KETA 4MVJA 4ALNA 2HK7A 1DIHA 2EKQA 3HHPA 1H9AA 3AJRA 3JQGA 3JSAA 1LSOA 3SVTA 4RVUA 1H6AA 5JCXA 4Y6RA 4OXNA 4L0QA 4HX5A 1V9LA 3ZHXA 1HZJA 2ZTMA 1GYQA 3FHLA 5C7IO 5L53A 1IYZA 2H6EA 5LCXA 3JQAA 2E4AA 3SXPA 4NBUA 1XQ6A 2ZCVA 3QVTA 4P4NA 5CDTA 1G1AA 1B7GO 1K89A 3JQ7A 3WYCA 2JAHA 5AXCA 2YFQA 4PLZA 3QA9A 3JYPA 5C7OO 1PJLA 3UCFA 3RASA 3H8VA 3B70A 1ONOA 3WGYA 2QRJA 5ILGA 1LLUA 4U7WA 4ALLA 2HDHA 1D8AA 3S8MA 3RFTA 1UJMA 1SOWA 4ND2A 2QRKA 4HFRA 1R0KA 2IODA 3S2EA 3H2ZA 1BRMA 4M1QA 3ZV6A 3PK0A 3C1OA 1PGOA 3OJ0A 3NEPX 3UICA 2UV8A 1MG0A 4FBGA 4OM8A 4XWYA 5ITVA 4K26A 3G49A 5DT9A 4UUMA 5KVSA 3DC2A 1GU7A 4MP6A 2DM6A 3GUYA 1BDBA 4L9RA 1I2CA 2QHXA 4CMGA 2OL4A 1D3AA 4RZIA 1XLTA 3BIOA 4KP7A 1XCBA 4FJ1A 3KOUA 3T4EA 4YT2A 4JJIA 1U3TA 3RUEA 4DUPA 2FZWA 4WOJA 9LDBA 1IB6A 1H9BA 3V2GA 3N74A 3K6JA 2RHRA 3FNHA 5KJCA 1KYQA 1VL6A 1A7AA 4KUHA 5ADHA 2X0NA 5DF1A 3RUCA 3NT5A 3BMQB 3OIGA 1I2BA 2JD1A 1I2ZA 1L1FA 4J1NA 1HETA 2XOXA 3PVZA 1Q0QA 5A02A 2VHYA 1MX3A 1ONPA 3QQPA 5I7SA 2JAPA 1B2LA 3TF5A 2ZYAA 4FFNA 1YGYA 2NVWA 3KSDO 1MVYA 3PQFA 4L73A 4BKQA 1TT5B 4ZN6A 2FP4A 1BXGB 4NI5A 3D0OA 4ROSA 2CDAA 3VPXA 1IULA 4OSOA 1U7HA 4EDFA 3NV9A 3E6AA 2OO5A 3RAJA 3RUHA 3LZ6A 4EI2A 4XX0A 1A71A 4BMVA 3EHEA 4NBRA 1PR9A 1NNUA 1R4MB 2V6GA 3WSVA 2HRBA 4BOYA 3N7UA 2DUWA 2PA3A 3N58A 1Q7CA 3DOOA 4ND3A 2I6TA 1PGQA 5DBFA 3ST7A 1MG5A 5L4NA 4N18A 1XYGA 4FW8A 1R4NB 3GPIA 1U8XX 1DBVO 2Z5LA 3ZCXA 3BAZA 1PJTA 3BTUA 3CXRA 1F8FA 4E31A 2J5KA 2OUIA 4YPOA 4R01A 2PWZA 3VPSA 5A5FA 3EGOA 2AHRA 2YYYA 4E5YA 1GAEO 1V8BA 1KS9A 2HKIA 3ANNA 4L4RA 3GNTA 1Z74A 3WTCA 4N54A 4XRRA 2RH8A 2VTDA 4Z9FA 2VNSA 5B37A 2D5AA 3TOXA 3STHA 1OOEA 3K31A 1SB8A 3VTZA 1ADFA 4L8VA 3BMNB 1Z82A 2AQ8A 4M86A 1JN0A 2X0JA 4XQGA 5U1PA 4BNIA 1SBYA 4WKGA 4YT5A 1E3WB 1GEEA 2PR2A 5COAA 1Q0LA 1DAOA 2NU7A 3UHAA 5HBRA 3WJAA 1WPQA 4KUEA 3OJFA 3WFJA 4EBFA 4WLOA 2D4AA 4PRKA 1ADCA 4I5FA 1U7TA 1BW9B 3VKUA 4R4JA 3WR5A 3WQRA 1PJCA 2OOSA 3IOYA 4NHEA 2C29D 3OQ6A 1E6EA 4U0KA 2ZIZA 1QMGA 1YQGA 3OEYA 3SJUA 1C1XA 4RF2A 3NGLA 1FDSA 3VKVA 3OJLA 1CRWG 3DFZA 4HY3A 4DIFA 4Z0HO 2E6UX 4YB8A 3VH4A 1EK5A 3C3XA 3LC1O 2A4KA 4W9NA 2VTEA 3FF4A 1Y6JA 2IRWA 1WDLA 3GMSA 1Y81A 5AXBA 3G0OA 4BO8A 5A4DA 1I8TA 3LVFO 2X5OA 3IAHA 3SEFA 3U4HA 3WG9A 3NRCA 4BV9A 4MKRA 3Q2IA 1XR3A 3IS3A 4LMPA 4CV3A 3CINA 1ZEJA 1Y8QA 1BVUA 2D2IA 3LQFA 3MOIA 3WQSB 3MWEB 4BNVA 3VOSA 1DRUA 2IDZA 3BMOA 4ESOA 2PKQO 4R5HA 3OF2A 2FR1A 4MJLA 2D3TA 3K5PA 3ZWPA 3AY6A 2O7QA 1YDWA 5A9TA 2I3GA 1PWZA 1R16A 4GPD1 3WIDA 5TQVA 3MWDB 5IG2A 1GZ6A 3GMDA 4D46A 3LF2A 1EE9A 1NFFA 2JD0A 1QLHA 3RUFA 2CVQA 1MW2A 1U1IA 4OGWA 5TF4A 1WXDA 3I3OA 2QX7A 1B8UA 2ZK7A 1PR3A 2GZ3A 3AI3A 1OFGA 2PY6A 3EW7A 3GK3A 4XR9A 3RD5A 1NHWA 5L7WA 2C5AA 3VPGA 2D59A 2FR0A 2P4HX 2CF6A 3ZWXA 3WICA 2BELA 1TI7A 1K6IA 3JD1A 3NDRA 3FN4A 2VT3A 2J8ZA 4LN1A 4CM1A 1YXMA 2HRZA 1W4ZA 4FLQA 4F45A 1P1HA 1JA9A 4J7CA 3WGIA 5KVQA 3QW2A 4R3NA 5JS6A 2NU6A 3JQBA 2LDXA 3IJRA 2PGLA 2Q1WA 3UERA 5IDXA 1E1NA 3JQAB 4ONEA 4UVIA 4CMAA 2GN6A 2X4GA 4BO2A 4WK6A 2ZTUA 1YBMA 4NG5A 1N1GA 3RVDA 1VKNA 3TJRA 4GAEA 1PZGA 2QZZA 3C7DB 1NQTA 4FDAA 4PLFA 4W9NC 4BO7A 4EW6A 3UF0A 3WXBA 4CMIA 1MW1A 2VYND 2Q2QA 4CV1A 3AFMA 1VSVA 2GDZA 3B1JA 2HQ1A 4UUNA 3E48A 4OIMA 5I9LA 3RC7A 1DFGA 3ADPA 5DCUA 3RROA 5DOZA 1NR7A 4BNMA 3K9QO 3P7MA 4NK4A 1R4MA 3DOJA 3M2TA 4Q9NA 2P5YA 4CLRA 1WMBA 2CDCA 1I32A 4GX2A 4J43A 1N7GA 3G17A 3GGPA 1BTOA 1ZO8A 4DXHA 2DTEA 2UUPA 3ADOA 4GGPA 1F17A 4W7HA 2I66A 2FPIA 4INAA 4PG8A 2CVZA 3O4RA 2BFAA 4II2A 1O6ZA 2I99A 2C54A 2QZ9A 3D64A 1IOLA 4GBJA 1Z73A 2CVOA 5KNLA 1KVQA 2OGUA 4WEQA 5A3VA 1P1FA 1CF2O 4OAQA 3M2PA 4L76A 3VHRA 5L7TA 3BHJA 3JQ9C 4LSMA 4BNKA 3H7AA 3JD3A 5KJ1A 3UN1A 2JHGA 1ZSNA 2YV1A 4H7PA 3U5TA 4ALJA 1NQAO 3QE3A 1E3JA 2DBVO 4NJMA 1MW3A 1PJBA 3MJEA 4DYDA 4K9DA 3F1LA 1XDWA 3D5QA 2YHUA 1UZMA 2Y1EA 4YT8A 1EVIA 4NPCA 1T1RA 3FRJA 3ASVA 4E4YA 2QYTA 1O94A 3NJ4A 4RVSA 1TVEA 3HN7A 4QXMA 4WOKA 5LDGA 3R1IA 4CM8A 1E5LA 2CSUA 2YDXA 4U0JA 3WBBA 1PTJA 3KXDA 3PJFA 2W2LA 2EG9A 1ISIA 3CUKA 3QVOA 3QIVA 1U5AA 2VOJA 4E5MA 1M2WA 1GEGA 2PD4A 1HYGA 4EGFA 1UP7A 3NKLA 2P91A 1YQXA 1AHHA 4E2YA 4PG6A 5ICMA 4XB1A 1U3WA 1GV0A 2IYPA 4QEDA 2YW9A 4O59O 3FNEA 1YONA 4CLOB 3WOHA 3Q11A 3WJ7A 3W1VA 1ZVMA 2FN7A 2GASA 3EZLA 5KTKA 1YQDA 1EDZA 3Q0EA 1LXCA 3R0IA 1OZAA 3I9LA 4WLFA 5DNAA 1BMDA 3NX4A 4I08A 2B69A 1UH5A 3C1AA 1FF9A 4R1TA 4DGSA 1PL6A 4RVFA 4Y67A 1XHLA 2B83A 5EN4A 4S1VA 5L7YA 1C0PA 1X13A 1O5IA 1S7CA 4D44A 1PX0A 4N5NA 2OZPA 2G76A 4I9UA 1DIRA 5EMHA 3RC2A 4Q3BA 4DBVO 1P1JA 4L74A 3ANLA 4WEOA 3LLSA 1W6UA 2E82A 4FFLA 4A2CA 4H15A 3M6IA 4XJSA 4WASA 4IS2A 1XIVA 1Y5RA 3T4XA 4RPKA 3KUXA 3PTZA 3ANMA 1KETA 2X86A 1ZBQA 1SOVA 4QTZA 1K6JA 1M67A 3VPHA 1O95A 5EESA 2OXIA 3KHUA 3ZWWA 2X8LA 2NNLD 4FPXA 3WFIA 4XR4A 4YACA 4BS9A 4O63O 1HKUA 2FHSA 3L77A 3KLMX 4C7JA 1KVUA 2DFDA 1UZLA 2VHWA 4ZD6A 3EUWA 1K6XA 2HMUA 4FB5A 1NP3A 2C59A 4HV4A 4IIVA 3I1JA 4IM7A 3AUUA 3RBVA 1W8DA 1DC6A 4KMSA 4AVYA 4WCFA 1E6WA 4WGGA 2NU9A 1EDOA 1BWSA 1ISGA 5JDCA 4CMEA 4A5OA 1TA4A 2D5CA 4U5QA 3DHEA 3NT4A 2BI8A 4XGNA 2R00C 4EEXA 5JMPA 4ZQHA 1O8CA 4PZEA 1XELA 4CLRB 1JWAB 1RJWA 3LU1A 4OMUA 3GEGA 1GFSA 3QWFA 5B1YA 2BH9A 5EPOA 4EUHA 1TB4A 2HU2A 2BFPA 3K30A 4R3WA 1NAIA 1HSZA 3E9QA 2BFOA 4B3JA 5B4VA 4HNHA 2WM3A 4DIBA 3PHJA 2VWPA 3F1KA 3H5NA 1RM5A 4E5PA 1ADGA 5F1PA 3ZV3A 4Y98A 2RCYA 4RDHA 4YJGB 1ZZEA 4BQRA 2J3HA 4FS3A 3FCOA 2O4UX 4WCDA 3JYOA 4P4LA 4E6PA 4JP2A 1NQOA 3K2BA 4GKBA 1ZNQO 3ETDA 5JXWA 1P1IA 2NV6A 3EAGA 3SC6A 5JMWA 5L3ZA 3VZPA 5FYDA 1ZXBA 1SEPA 1L7DA 1V3VA 1ZH8A 3GZNA 4IXWA 3DBHA 1X1EA 5DBGA 3DZGA 4NK5A 4AJ2A 4YA6A 1R15A 2WJPA 1LRLA 3DBRA 1T25A 4NDNE 5COQA 4AJLA 5I7FA 4QECA 4YJFB 3CEAA 2DPGA 1YB1A 4OH1A 1I01A 5KJ6A 2B4TO 3WWYA 2GRAA 3SJ7A 2PV7A 3TNLA 3PHIA 5JDCC 3PYMA 3KYCB 3GVHA 1Q7BA 2V65A 5F1OA 3CH6A 4WECA 4XQ9A 3GVIA 4B3HA 1OC4A 4BKRA 4YR9A 4CM7A 1C3VA 5IZCC 4CQMA 4YAJA 3OQ1A 1EUZA 4KQWA 5HA5A 4ZQFA 1VL0A 5IZ4A 1P77A 4B79A 1Z75A 3WB9A 2P2SA 2FSSA 2PZKA 4B4UA 3I9MA 4L4SA 4FOSA 1K3TA 4M8SA 2HMWA 4BB6A 2O7GA 1T2CA 3HDYA 4DMLA 3QWIA 4DA9A 3H65A 5J23A 3ICPA 3T0YA 5BSEA 4JP3A 4WCFC 4JXKA 2CF5A 2ZB4A 4CODB 5I9MA 5TC4A 4KUGA 4NJMB 1F12A 1IZ0A 5U4QA 4BKOA 3V5NA 2BHLA 1DJQA 1SCUA 1JU9A 4XDYA 1YO6A 4BNZA 2Q99A 3GN2A 4IZIA 2RIRA 1JG9A 3WDSA 4A0SA 4XYLA 5ITWA 5TSDA 1ZK2A 2VYNA 4GX5A 5EINA 3AM4A 4CM5A 4D0SA 1KC3A 2Z1MA 2C20A 2A35A 2PH3A 2HJRA 1VM6A 3TFQA 4FFOA 4J49A 3A9WA 5I9NA 1DAPA 2VYVA 4WLUA 2B36A 5T5QA 3LT2A 1YOVB 2X7HA 1LA2A 3PWKA 5CEJA 1DOHA 4IJUA 3LDHA 4TVBA 4BO5A 2Y68A 3LC2O 4I5EA 1IPFA 2EWMA 1NR1A 1U4SA 3FWZA 1HDCA 1ZW1A 3L4SO 4UULA 3JTMA 3U4IA 3D7LA 3OH8A 2Y1FA 4CXFA 1HE5A 3DHYA 4FC7A 2VZ0A 1AHIA 1NM5A 2PTGA 3WMWA 4CQLB 1Z6ZA 3W4IA 2UVDA 2V6MA 3GZ4A 1A9ZA 2D1YA 3ZHBA 4RPGA 3RI3A 2NQTA 2Y67A 3ZWCA 1K5HA 5JNLA 3D4OA 3GC6A 3L6EA 4GL4A 4B7XA 2QG4A 4B8ZA 3R3JA 4DC1A 1F8GA 4PG5A 4TKLA 4FC6A 1PSDA 1P45A 2GSDA 4UVEA 3WTBA 2IXBA 3X2FA 2DBQA 1KEUA 1KIFA 3JQFC 2UYYA 3QLJA 4B4VA 4KWIA 1DEHA 3ZWOA 2W98A 1ZK3A 4FFPA 4LVUA 3S2GA 4N5LA 2Z1NA 4ZQBA 3R6DA 2YZ7A 5TGDA 1T24A 4E30A 3CIFA 1DIGA 3ORFA 3U0BA 2X9NA 3D1LA 1YL7A 2DUUA 2FZEA 4MIOA 1U2DA 3TPCA 5A5EA 1M6HA 3HNPA 4E21A 1DIBA 2ZB7A 1LQTA 3MOGA 4D3DA 1R37A 4RF4A 1X7DA 3PZBA 1FMCA 3DOCA 2ZYDA 4II3A 1DC3A 1NPYA 2Q2WA 4ZJUA 1GUFA 5GZ1A 1M75A 4DIOA 5CDGA 2X5JO 2GN4A 1HDRA 4I9HA 2BGMA 4TRNA 1KERA 5EQDA 3DMTC 3TSCA 3MTJA 3AU9A 2GN8A 1A9YA 3BA1A 3F6YA 5G0WA 3JQ6A 3W4JA 4OXKA 2EW8A 3ZN2A 4BIIA 2OBYA 5JCJA 2HMVA 3UXYA 3ZWBA 1DHTA 3ZU4A 2DC1A 1GQYA 4Z0TA 3AFNA 4JIGA 2I67A 4MDHA 3UVEA 4BNUA 1VJ1A 3HB4X 3NTOA 1P44A 2ZB8A 4UEOA 2CDBA 3NDIA 1OI7A 3C7AA 2PD6A 3KB6A 3L4BA 1O9BA 4BO0A 4BUCA 4D43A 2TMDA 3DXFA 3ITDA 3VVBA 1Q7GA 1QG6A 1HYHA 5MDHA 4M55A 2A9FA 5KWEA 1QYVA 1GUZA 1IPEA 3ZDFA 4FCCA 3A4VA 3PP8A 3BMQA 4EEZA 4BNYA 4RF5A 1ZK4A 3A14A 4GQAA 4ND1A 2SCUA 3GEDA 3INTA 3W6ZA 3SC4A 1FDTA 1FDWA 4MVJF 4X54A 3VPFA 2ZATA 5BR7A 2O23A 4EJ0A 4RPLA 4ILKA 1PGPA 3B1KA 3OJEA 3I23A 1RM3A 3W6UA 4BNGA 3VZSA 4FJ0A 1RWBA 1PZEA 3GVPA 5CEFA 3C24A 5CDYA 3RKRA 4CPDA 1M6WA 4YYZA 4CM4A 4CJXA 1OR7A 1VE9A 4JBGA 4CUZA 2GF2A 3RQSA 2R6JA 4Q3AA 3IL2A 5ER9A 1BGVA 2E48A 1QYCA 2PD3A 1UR5A 4Z9XA 3JCZA 3WX0A 4M54A 3JYQA 1CWUA 1DO8A 2Z95A 1YB5A 2X23A 5HS6A 1XA0A 4URFA 2DBRA 5KOIA 1M76A 1Y7TA 2BRUA 1NVMB 2EKPA 2NQ8A 3KYCA 3GDFA 4TKMA 2GN9A 4H3VA 4CMCA 2B5VA 3KSUA 3DZJA 1DRVA 5TT1A 1W0CA 2YV3A 3TWOA 4CM9A 2NADA 4CLOA 1C14A 1FDUA 1KVRA 2J6IA 2QW8A 3U49A 5ILOA 2OP0A 1B3BA 3GR6A 3GGOA 1SC5A 1ID1A 4MKZA 2PZJA 1SZJG 3CKYA 3OSUA 1CEQA 5DDIP 5IF3A 4J16A 5JAZA 4J1QA 3KSZO 4XYMA 1MV8A 2WMDA 4BL5A 2Y1DA 4AYSA 4U6QA 5JY1A 3AU8A 4RDIA 3HUDA 4Y8VA 1V35A 3PJGA 4CM6A 2HLPA 4KTVE 4BQPA 1ENYA 4E32A 1VL8A 4IPTA 5G4KB 4A7PA 2Q1SA 2YFHA 3PQDA 1HEUA 4FGWA 2XPCA 2JD2A 4YBZA 1FJHA 4N5MA 4A10A 4JBHA 4KWHA 1AE1A 4CMBA 1OBFO 4IJVA 2B4QA 4GSKA 2AW5A 4AJKA 5C5IA 1QP8A 4J91A 3HFSA 1KEWA 4WNIA 3BMCA 2W4QA 3G1UA 2YJZA 4GX1A 3RC1A 1EUCA 3PFFA 3TOZA 4EZBA 3ZWMA 1GCOA 3ZHZA 3TZKA 5A9RA 2X9VA 1NVGA 4OYRA 4ZHSA 2AEMA 2GGSA 3M1LA 3GG9A 1IZ9A 4FJ2A 3F4LA 2PK3A 1SAYA 3AY7A 5HRUA 4W7IA 4IDBA 4BO3A 2CZCA 2BLLA 2DKNA 3KO8A 1LNQA 2FWMX 1DLIA 3DAGA 4KTTE 4D45A 5CPFA 1QV7A 4BO1A 2P68A 3H2SA 2Y66A 3QWAA 3PZRA 4BNXA 2DTXA 4KZPA 5G4LA 5C37A 1V6AA 1V3TA 2GYYA 3GDOA 3LC7O 1UXIA 1L7EA 1HLPA 4K6FA 4YTEA 1J6UA 4QFCA 3ZI0A 2AA3A 2VNAA 4D41A 1FXSA 1NQ5A 4O1MA 2G82A 2EGHA 2Y0CA 3L0DA 2WWRA 5JO0A 4NBVA 1F06A 2IZZA 2RH4A 1E7RA 1MXHA 5KJFA 4AJIA 2HO5A 4MVJD 3X2EA 2GNAA 3JD0A 4RPHA 2OP1A 1GYRA 3RUAA 4P4GA 3EY4A 3RWBA 4NNJA 4GSLA 1B0AA 4A26A 1U4OA 5JSFA 2G5CA 3RFVA 3CSDA 3DMYA 2ZB3A 2NM0A 3PGJA 4QSMA 2Y1GA 2YDYA 4BVAA 4BB5A 1P31A 2X0IA 3K2EA 4NMHA 4RF3A 3JQ8B 3F9IA 2DFVA 3MJSA 3H4VA 5H81A 2AE2A 5IXSA 4HFMA 1LRKA 3ROQA 1GYPA 1ENOA 2Q2VA 3KZVA 3I4FA 5BSHA 4LCJA 3W8FA 3ZHYA 3E1KA 1GV1A 4PIVA 2JKVA 3ZH2A 4NR0A 3IKTA 2HMSA 4B8WA 2GPTA 5L95A 4LMRA 5EERA 1MGOA 3QHAA 1DC5A 1HDYA 3DTYA 3KYBA 4MIEA 5TNXA 4CMHA 2JL1A 3GFGA 3PHGA 2VT2A 1I30A 3TN7A 2JCYA 1PS9A 3U3XA 3HQ4O 4CM4B 4AJNA 1DJNA 4FOOA 3ONDA 1ZMOA 4E12A 3W4KA 3U62A 4YEDA 4GWGA 1CQJA 1A7KA 2IEBA 5F5LA 1XKQA 3AUAA 4AL4A 3AUSA 1MUUA 1Y8QB 1C1DB 1GTMA 1HSOA 4TVOA 3W8DA 3AK4A 5B4TA 3H3JA 5JBIA 3IQDB 5JAIA 4J7XA 4IDGA 1QSGA 1ZS2A 1N9GA 2WSBA 1NYTA 4HWKA 1DIAA 1C1DA 2W2KA 3D4PA 1LEHA 3HN2A 1EEHA 3O03A 2O3TA 1E3EA 1QLJA 4ZICA 3G1TA 4RLSA 4OXYA 1C0IA 1WZIA 2CY0A 3GHYA 3PHHA 2AEFA 3OHSX 1WLYA 1PJQA 3RC9A 2FSVA 4R54A 4LCEA 2AG5A 5IFLA 1GQQA 1I3KA 1Y5MA 2DPHA 2EW2A 5KCZA 3GNQA 1CQIA 1ULUA 1MC5A 5T57A 4CL3A 5L40A 4I5GA 4XZ3A 4IDDA 1GY8A 1N2SA 2VRBA 3UH1A 5BT9A 5AQ1A 1WNTA 1MP0A 3DFUA 3C7CB 3GT0A 5G0SA 2NTNA 1Q2XA 1QORA 2EHDA 3P2YA 4B7UA 5BNFA 1H2BA 3WBFA 3IC5A 3E9NA 1E7SA 4B4WA 3TL2A 1O0SA 3EK2A 3VVCA 1EFKA 1X1TA 2W8ZA 4XGIA 5G0VA 4EJ6A 5T8KA 4DLBA 3WQQA 2G0TA 2QYSA 1H3LA 3ZNOA 4Z6KA 1GL3A 3DBRB 5CG1A 3OMLA 4R51A 2NVUA 3OQBA 1ENZA 1WAMA 2O3UA 1JAYA 4R1UA 2A92A 1UP6A 5EQFA 2HCTA 4RQUA 1H6DA 2HK9A 5BNTA 8ADHA 3NYWA 3PYLA 4NFHA 2NACA 5F1KA 4J0EA 2WDZA 4XRGA 4GMFA 2NVUB 3RKUA 3EMKA 1ZEMA 1R0LA 4Z3DA 5K0ZA 3LF1A 3GN1A 1X14A 1DDOA 1YDEA 2BMAA 3H5RA 3IUSA 4JK3A 4JROA 4O6VA 3TQHA 4JJFA 4XEHA 3WGGA 3F46A 3S2FA 3K73O 3RSHA 5TS3A 4PLGA 1BG6A 1A27A 2DAPA 3ASUA 5AOVA 1WDMA 3ZU5A 3L6OO 1F14A 3EYWA 1GZ4A 4ZRMA 2H5LA 4D79A 4DTIA 1YL6A 1I3LA 3AY3A 4HFJA 4Q3DA 2TMGA 4UVGA 2XXBA 4J9VA 1LSUA 2NTVA 1HLDA 1D4FA 1KOLA 5L51A 2GUGA 3PLRA 3EDMA 4TSKA 5F3RA 4BMNA 1T2AA 3L9XA 1EK6A 2IXAA 1DLJA 2NWQA 4NQZA 1EFLA 1VSUA 3FTNA 1E77A 4OKNA 4I8XA 3U9LA 4J9UE 2IEDA 1XG5A 3D3WA 2VUSA 3BMOB 3UW3A 3WYBA 2VN8A 1QXSA 3FSRA 4RVGA 2PZMA 1IUKA 3AOEA 2CD9A 4M87A 3I9NA 3P19A 3S55A 1J5PA 4PG4A 3R3SA 3GNSA 4NJOA 3TZHA 4ZU3A 1RP3A 1P1KA 2WD8A 1PGJA 1JWBB 5KVVA 3KYDA 3ONEA 1U3UA 1CERA 1BXZA 1E7YA 2OMEA 4CR7A 3FWNA 1T2FA 1HRDA 4LISA 5G4KA 4DQVA 1XWFA 1XQ1A 3ZWVA 1VC2A 1F0YA 4IQGA 3DZHA 4HADA 4R41A 1E1MA 2GERA 4TRRA 2Q3EA 4MIYA 3IDSA 4BGEA 3SX2A 4J7UA 4IIUA 4JBIA 1T26A 4UREA 3WWZA 2JCXA 1E3LA 1BW9A 3EZYA 3IMFA 4G5HA 4LVCA 1HF3A 2J5RA 5JC8A 4PLCA 5CHEA 5TX7A 4OOEA 3PJDA 3C1TA 5T6BA 4R1SA 1I33A 1B3RA 1QYXA 2FMUA 4A03A 3DWFA 4XKJA 2PLAA 2WE7A 1EQ2A 2V6FA 2ILTA 3JQAD 4IS3A 1LDNA 4CR8A 1Z7BA 3BMNA 1KEPA 1KC1A 1PJ4A 1JQBA 2RHCA 2VZ8A 3OA0A 2WYWA 2PGDA 4RVHA 4YJFA 1PZFA 4ZA2A 1I5RA 5G0TA 2C2XA 1LX6A 5FF9A 4E2WA 2HK8A 1HDXA 1IHYA 4W6ZA 3OBBA 4TWRA 1Y9AA 1H93A 3HDQA 2O3JA 2XXJA 1YBAA 2ET6A 2O7SA 7ADHA 1HWYA 3BTOA 4ID9A 3PYXA 4AICA 1E7WA 5TLSA 4PLHA 4PLPA 5AXDA 1E3IA 3UOGA 4UUOA 4HP8A 2F00A 4E13A 1MLDA 3GPDG 1Y9EA 1RPNA 4FLOA 4CV0A 1DHRA 1HE3A 4E2ZA 4E2XA 2BI7A 4LW8A 3FBTA 4Z9YA 2H9IA 4XCVA 1Q1NA 1SPXA 1ADBA 3QV1A 4J3FA 3WGQA 2WE8A 5A06A 2Q1TA 2O4CA 5A05A 2F1KA 3DBLA 3DZFA 3LT0A 3BZUA 3U09A 1X15A 1MFZA 3NGXA 3QJ5A 2FY8A 4JGBA 4ZRNA 4CM9D 4WLNA 4DLLA 4AJ1A 1E92A 3HZZA 4XQCA 2P5UA 3DZIA 4Q3NA 5K9ZA 5KKCA 1NX6A 2GZ1A 2XF8A 3ICCA 4MINA 4RORA 5IAAA 1JKIA 4FLRA 1QYWA 4XGKA 3CZGA 2DTDA 2X1HA 3JQ9A 3MJTA 5FFFA 3W8EA 1QYDA 4FGSA 2B5WA 4G2NA 4MPDA 5DP1A 2Y1CA 4GVLA 4WCFB 2Q50A 1YBVA 1U28A 1GPDG 4XYEA 4OQYA 2W2KB 1NPTO 3RUIA 1TLTA 3ITKA 4UUPA 4C4OA 4AJPA 1DRWA 3HADA 1LLCA 1ZSYA 4MO2A 1EVYA 3GDGA 3VDQA 2DU8A 4NFYA 4QQRA 1KY4A 1PS8A 3UKOA 1O89A 3LYLA 5DOVA 5LC1A 1RM4A 1C1XB 1PU2A 4RVDA 4O5OA 4PFJA 4BNNA 1AN9A 4PLVA 3SLGA 4FLSA 1P0CA 1ZJYA 1TT7A 1GQ2A 5HWSA 3P5SA 4NFSA 2ZJ0A 1ZJZA 3B20A 1N7HA 1TEHA 1CDOA 1IHXA 3IJPA 5FEUA 1NFQA 2O50A 4YJDA 1P0FA 1HDOA 1X0XA 3FTPA 4GMGA 4YAKA 4IDEA 3I6QA 1ZKMA 2GO1A 3GVXA 1EMDA 1KBZA 4L4XA 4RLHA 2GCGA 2GZ2A 2Y1OA 3G3EA 4IDCA 4PVDA 3ZNPA 3O26A 4BNLA 3Q3CA 1LQUA 1LTHR 3GF4A 1H6BA 1ONNA 3MTGA 5FI3A 4ALMA 3AI2A 3T7CA 2Y0DA 3WGTA 3UFXA 5A1TA 1HDZA 4ALIA 2Q49A 4DRYA 3D4NA 4JNKA 2EP5A 2IZ0A 1WDKA 4BGUA 4P22A 4BKUA 3UCQA 1YE3A 2EJVA 2HJSA 1BVRA 2O3QA 3PGXA 3AOGA 4W99A 1X0VA 4JCOA 4CMJA 2ZQZA 3KBOA 5GMOA 3GUCA 3ZNQA 3DAFA 1ISJA 2Y05A 3QRWA 4OHUA 5AXAA 4IGEA 2ZTLA 4FSHA 3VAZA 4DPKA 3NTRA 2HUNA 1R66A 1R4NA 2IE0A 1PZHA 1QV6A 4DPLA 4AFNA 3E9MA 1ZSVA 4FFMA 1UZNA 2VQ3A 5IDYA 4R16A 5C3MA 1CIVA 2HMTA 2VOEA 3GGGA 4YRAA 1GZ3A 1YS4A 3RU9A 3FNGA 4WPGA 3AM5A 1U8FO 2HSDA 2CFCA 2EV9A 4TZKA 4KDFA 3BTSA 2E49A 2W2LD 1S46A 3ZU3A 3HFGA 4G65A 4HUJA 4C7KA 4RJTA 4E33A 4NH4A 1RYEA 2Q46A 3SBOA 1JDJA 4BO4A 2DQ4A 2YY7A 2O3RA 3GH3A 4GLOA 4QX6A 5A3JA 4R69A 5LDHA 4YAGA 4DWVA 4CMKA 5JAQA 5DCWA 5KIAA 4BMSA 4LGVA 2H1SA 3HB5X 5FWNA 3DTTA 4J2OA 1SC6A 1VRWA 4OL9A 3ZW9A 2X5KO 3F47A 3TDKA 5CAEA 3CMMA 4PCVA 4MVJH 3JQEA 2VZ9A 5EJ2A 3VH3A 4XYBA 1GDHA 4LSWA 4OQZA 3AI1A 1SMKA 1EBUA 1HXHA 2EJWA 4YWJA 5K6AA 1RYDA 1KVTA 1DPGA 3WGZA 3PWZA 3GAZA 2LDBA 4GH5A 4MOWA 3RJ9A 3IIEA 1DSSG 1QRRA 4I1IA 4QT0A 1H0KA 1J49A 4EUFA 3KVOA 6ADHA 3DMTA 3I9KA 3PQEA 4HFNA 1YRLA 3WMXA 2J5QA 3WS7A 3DO5A 3GLQA 3O8QB 2DT5A 1ZIDA 3I83A 3C8MA 4QO8A 4CUJA 3AOEC 4IDFA 3BHMA 3ZWNA 3CTMA 4FFRA 4Q3EA 3WNQA 4JN6B 4UEKA 1ZMTA 1I3NA 2B37A 5L45A 3JQDA 5IJZA 2R00A 2VYVD 1ENPA 4DYVA 5JLAA 2P4QA 1R0SA 1SB9A 3MCVA 3KRTA 4IY1A 3L4BC 4PRLA 4DREA 4B7CA 4RZHA 1LI4A 5CFZA 3TFOA 2YQ4A 9LDTA 1U5CA 2Q4BA 3O38A 4WUVA 2FPPA 4IZHA 3V2HA 2WEKA 5CPBA 1GR0A 2Y99A 1LDGA 1ULSA 2PH5A 4N7RA 3H9JA 1VKOA 4TZTA 1MC4A 2UDPA 1PJSA 1JKFA 1LSJA 5JAMA 1AXGA 2VWHA 3DBVO 3GAFA 1IY8A 1R6DA 4JQCA 3HE3A 1XU7A 4CLHA 2JFFA 1HE4A 2VCYA 2X9GA 1H2HA 1I36A 3ZWYA 3MJCA 4Q39A 3RBZA 5JCJD 3NT2A 2MAOA 1YWGO 3CZEA 3IP1A 1S6YA 3P2OA 3BHIA 4OKIA 5F5NA 4PZDA 4F6CA 3ZV4A 1BHSA 4KOAA 3ZNNA 4ITUA 4CQLA 3L6DA 4XB2A 1ISHA 3FD8A 4KQXA 3ON5A 1TT5A 5B4UA 1HYEA 3BTVA 1YJ8A 2JFHA 4PLWA 3CPSA 5A04A 4HBGA 3GRPA 5JYDA 2A94A 2I65A 4YJHA 4BNWA 2C2YA 1HZZA 2YHIB 3K8ZA 1MW0A 4ALKA 3INGA 1P9LA 3DAPA 4AJHA 4CR6A 2FPGA 5EIOA 5GZ3A 4PZCA 4XIYA 3E5RA 4D42A 1YL5A 4K1LA 1PIWA 3HJAA 4PVCA 3F5QA 4E0BA 3GQVA 5A9SA 4YRDA 5A9SB 5TJHA 1VJ0A 3QSGA 4EITA 2BD0A 3PHLA 2I9PA 2YV2A 1ORRA 2H63A 4L75A 5A03A 3H9UA 3D3WB 4GI2A 4DQXA 3Q2KA 4CM3A 4NQWA 2VHVA 1UUFA 2O3SA 1JLLA 5IN5A 3E82A 2P9GA 3MEQA 5THKA 2UAGA 3JV7A 4JJGA 1V3UA 4IJKA 2C0CA 4D3FA 2AMFA 2J3IA 1XGKA 5T64A 4G81A 4YJHB 5CP8A 3PI7A 2VUTA 3JQFA 4YVFA 2JJYA 4ZVVA 1DXYA 4FIZA 3GA0A 4O0LA 3WGOA 4OOFA 2WTBA 2PNFA 4DC0A 4M49A 3U4DA 4DQUA 1G0NA 4BGVA 4XQEA 3PJEA 4CLEA 4AJ4A 1P74A 3L9WA 3PIIA 4Y6PA 4CMEC 3QWHA 2EF1A 3E03A 2WYUA 4R5MA 4YAIA 5JYEA 4GVXA 1E3WA 2OORA 2ZCUA 3DEYX 1AXEA 1ZK0A 1KVSA 1HT0A 2QQ5A 5G0UA 5T67A 1WW8A 4J1TA 2B4RO 1Y8RA 3KM0A 4DVJA 2BF7A 3WLEA 3CZRA 1A4UA 2V6BA 3UCXA 3ENKA 1D7OA 2B0JA 2ZYGA 4WLVA 5JFOA 4R68A 4EUEA 3OIFA 3RFXA 3IUPA 1EQUA 1Y1PA 1I24A 1XSEA 5HTOA 1NTOA 3PRJA 3FBGA 3FPLA 1NHGA 3DDNA 4NIMA 5HM8A 4RPJA 1OMOA 5I8ZA 1YKFA 3KEQA 1PWXA 2DVMA 4FN4A 4IINA 3F4BA 3KTDA 3A1NA 2I76A 1DFHA 1UDCA 1XEAA 4F6LA 3CMCO 4IJWA 1PEDA 3WSWA 4F46A 3DZBA 4OSPA 2EGGA 4AJEA 3KYDB 3QVXA 3VTFA 3JQBC 3NAQA 1P3DA 1YOVA 1YH3A 1PL7A 1JKJA 1NBOA 4BNFA 2GLXA 1H6CA 2X22A 4BNHA 3PFWO 3GHHA 4TROA 5DZSA 1LDMA 4ZQEA 3TZQA 5FI5A 2WYVA 3Q6IA 3TL3A 4BO9A 3I9OA 5CDSA 4CL8A 1E7MA 1E1LA 1LC0A 2VHXA 3ABIA 4Z0PA 5MGBA 2P9CA 3RU7A 3RBXA 2DLDA 1GADO 2CUKA 3GEMA 3PDJA 1N9GB 3LK7A 3U4CA 4HKTA 3C85A 2VHZA 4UVHA 4XYGA 5EL0A 1ISFA 3HDJA 1UDBA 3PEFA 1NWHA 5TT0A 2OFPA 5KKAA 4WJZA 2YQ5A 4IBOA 2Q1UA 3DONA 1NFRA 3JYLA 3KV3O 4BNTA 2BKAA 2XAAA 3D5TA 4QO7A 3ROMA 3LSYA 2VRCA 4K6CA 5JPIA 3H9EO 4B3IA 3ZV5A 2QRLA 3VH1A 1JVSA 3V1UA 1VPDA 4R9RA 1HTBA 1RM0A 4GWKA 1E7QA 3QY9A 2I3AA 4OO3A 1X7HA 1R12A 2WD7A 5CDUA 4WE3A 4YDRA 4GKVA 1J4AA 3COSA 1WVGA 3V2UA 3DQPA 3FNFA 4AG3A 5DULA 1AGNA 3CE6A 4S3MA 4J90A 3B6ZA 4RO0A 4CMIB 5JDIA 1SO8A 4E5NA 4MP8A 4RQTA 2AQIA 3BYZA 4CQMB 3HG7A 2PKRA 3OICA 1X7GA 1G5AA 4NBTA 1DB3A 4XA8A 3O9ZA 1GCUA 3PLNA 2Q45A 4YXFA 5COBA 1ARZA 4MKXA 3JQ8A 1ZXLA 1LUAA 2PZLA 3AUTA 3S1LA 3T7EA 5ICSA 3ETEA 3JYNA 3OM9A 3HSKA 5BSFA 4GLLA 3OFSA 3F5SA 3H9QA 2AEJA 3TRIA 2EERA 4FR5A 3H9GA 1VJTA 3GZNB 3UUWA 1HL3A 1T1SA 5JC1A 1PQUA 1H5QA 2NVBA 2CNBA 3DHNA 3QWBA 4DPMA 5I8WA 4Q3CA 3CZKA 4ND4A 1B26A 4E5KA 4YRBA 4YJGA 5JO9A 1T4DA 4CUKA 1E1KA 4Z3KA 2O2YA 5IN4A 5DCYA 1LJ8A 2J3KA 1T4BA 3PPIA 1MXFA 4RV9A 5IXYA 2FRDA 2Q4EA 1J0XO 1PJ3A 1EZ4A 1NPDA 3AM3A 3E5MA 3QVSA 3RJ5A 1ZUD1 1BDMA 1LDEA 3WLFA 1LU9A 2VUUA 3SLKA 4IMPA 4J2HA 4HNGA 3GG2A 5H82A 3ULKA 3LLVA 2EXXA 1KY5A 1ZK1A 3AWDA 1B14A 3Q1LA 4RCVA 3VH2A 1LLQA 1C0KA 2GD1O 4IQ8A 1LRJA 2VWQA 3UAGA 1U2GA 1UAYA 5B12A 2AE1A 4PGFA 4K28A 2Y93A 7MDHA 4R1NA 3Q9NA 3WYEA 3I6IA 2BGLA 1IL0A 3H3FA 1VI2A 5T8KC 3S2IA 1HE2A 1Z45A 1AUPA 4YCAA 1YB4A 3UCEA 2C5EA 1BXKA
chains in the Genus database with same CATH superfamily
4ZQGA 3TQRA 4DY6A 5ULLA 1XL0A 1OD6A 2HJGA 4L27A 2JLWA 2E4ZA 2ORIA 5K6AC 2C04A 4QPEA 1USUA 3QVWA 3CLHA 4MAMA 1KARA 3ZVMA 2V0GA 1F60A 3V1MA 2I91A 5BY2A 1IN1A 2DR0A 2ZOSA 1EXDA 1ABFA 2W4MA 1PFWA 2FXVA 1SOMA 1VFNA 1NJGA 1OCEA 3DAYA 3DKVA 2HX1A 4MEJA 4MTLA 3KWMA 4YQZA 3CNLA 4HAXA 4CIXA 3C87A 4DDMA 3Q9UA 1Q0SA 4D7AA 4OLBA 4XD7A 1QO0A 1WWKA 3E70C 2OENG 1FYDA 4JP8A 4RD3A 1XVTA 2FSFA 3Q7PA 3R5SA 4KAAA 3F6EX 3MJ4A 1Z83A 4KEAA 2WWGA 1H1LB 1DNPA 3B52X 3NMUF 1QDEA 1W0JD 4F8YA 4LF8B 4DCVA 1JA0A 4QYMA 1ECCA 1WXEA 2O5CA 2HTEA 1VE1A 1Q17A 3E18A 2VTVA 3N0TA 2ODQA 3CRQA 3UJ7A 4Z1MD 4G5YA 4LXIA 3RSSA 3T3HA 1T43A 3B8EA 1O94D 4OB8A 4DM7A 3DBHB 5IK2D 1K0UA 1MJGM 3LECA 4TZ6A 4DW8A 5HJ7A 1A9TA 3ZW8A 3QUBA 2A7XA 3HDHA 1AUOA 4Q9IA 4B35A 1ESNA 5H3LA 2RGDA 3AW9A 1Y8RB 3LT1A 3JX9A 4G9BA 1WMSA 1Y98A 3UBMA 2HT6A 3VDRA 3R44A 1ID8A 3MMZA 3H4TA 2WPDA 1J7JA 4LVNA 4B1FA 3GT4A 1MIOB 5INTA 2ZRGA 1IRIA 5L3SA 3K05A 5AHXA 1I80A 4IQ0A 3PXCX 1W85A 2WIFA 5JZVA 1PQWA 1UJBA 4O2BF 4AJ9A 2VG8A 1LBTA 3E35A 4QTUB 1LLDA 3QE9Y 2VEOA 2A0KA 2CXXA 2Q7DA 1DU4A 3EAFA 4N3GA 1ODJA 2H16A 3DUWA 4IUYA 4QUKA 1LV7A 2ZIXB 3GZJA 1Z7EA 3JWPA 1KQGA 4Q37A 1PHPA 1UJCA 3HXOA 3SR0A 1W52X 4X7MA 4BKPA 2GAFA 4GYJA 3GVCA 4LHSA 1BEEA 2YR0A 3A28A 3KLPX 4F21A 1EJ2A 4N0EA 4URWR 4M1MA 3WGVA 3ND5A 1D1TA 2JGRA 3NJ8A 1O94C 4LJSA 4QQKA 4R1OA 2PT7A 3EN0A 2Q1YA 4C7VA 2D8AA 1H0SA 4FLFA 3WGHA 1VMEA 2E37A 4G24A 2B78A 4HAIA 3D8UA 3O91A 3VKFA 1LPNA 3D3EA 3HB7A 4H1HA 5BWBA 2QUHA 5C7LO 1QJCA 1YSCA 4J29A 2JA1A 4B8YA 3E3LA 1J2JA 3PV0A 1GPWB 4P38A 3CUVA 3JWHA 1IZ8A 2H7XA 3HP7A 3ONNA 4PHCA 3VR0A 3EF1A 3QXHA 5IHXA 4N4AA 1NDQA 5HKLA 5J4VA 1DX4A 2PH1A 1EB8A 3ML1A 1ESEA 4HH1A 4O4HB 3DR5A 2GOYA 2XUZA 4QA9A 5IMSA 4RXUA 1E0DA 3IPAA 5JSHA 1PL8A 4IDAA 4RTJA 3SLRA 5GWXA 4KITB 6LDHA 2EKLA 1HDGO 1HO3A 4W1RA 2ZQ5A 1GFZA 1N8KA 1T5OA 3GOHA 1C7ZA 1MBZA 3NEAA 4FGKA 1YJQA 2IHNA 2Q3CA 3DE0X 2JAXA 4LRTB 2NV0A 1I7DA 2BDUA 5FUWA 1FX1A 4HTAA 4MVJP 4WZBE 5PNTA 3RUDA 1XKLA 1QVVA 4OYLA 4XD2A 3ICEA 3CUWA 2FQXA 3LT4A 4P6VF 1E94E 3WJ1A 4NPAA 5ITZB 3KOZA 2ROQA 3H0CA 2HY7A 2QORA 3ENVA 1Y3DE 1VGVA 3QXXA 4HXYA 5CDHA 1TL7C 2JBAB 2PKEA 1SQGA 3DFKA 3K9CA 3SIPA 2QD4A 3OPYI 1T2NA 1Z33A 4HWPA 4JLOA 4JLWA 4PC7A 2ODPA 4X61A 2G40A 4Y6QA 1U3FA 2AXQA 4CQJA 2CKDA 4DLKA 5P21A 4LYHA 3EUEA 1NBEA 2XMGA 2CFSA 4CEIA 2VHEA 1F3LA 1I3MA 5I7VA 2DUMA 5F7OA 1FS5A 5KVCA 1MEJA 1G2OA 4IH4A 3INRA 3GY0A 3PXXA 2B25A 3O1JC 5TGZA 2IHKA 1QHEA 3NYRA 3ZGXA 2VYCA 4DZTA 1WP4A 3ZHCA 5JAHA 3KVYA 4Y9DA 1QLWA 3JD4A 1SVIA 4MVJM 4BMYA 3C15C 3GLSA 1DTWB 1IQ0A 1I10A 1NVTA 1XYVA 3H1PA 1L5OA 4D26A 2FWAA 4IXTA 3BCRA 3H0EA 3IIKA 2QIOA 1B8VA 1MFPA 2IU3A 4J4HA 4YCMA 1P4HA 1Z28A 1UBJS 3RRXA 4XM2A 2O7RA 3EZGA 2BUAA 2NU8B 2CJYA 3ZTTA 2NTJA 4J1SA 5H9WA 4KQ9A 3IR7A 4BRUA 1JSCA 4LRYA 2Q07A 4ZT3A 2R44A 4UBLA 4EB6A 5L4LA 4QWMA 3CHOA 3UMMA 4ZWNA 5JCOA 5F3WB 1EB9A 5JT1A 5JE8A 3FR8A 1XLVA 4I5DA 5KX5F 4C2TA 1FNMA 1BH2A 3ZUGA 1E3SA 5I9IA 3ZDCA 1XZHA 2YFYA 4OFXA 5HMLA 2PKWA 3P0HA 3I92A 3B51X 3B2PA 2I6UA 3M1AA 2BUBA 3LRPA 4X41A 3CZMA 4QFDA 3CUTA 5JDIC 4TUYF 3ITNA 1A4IA 4S1OA 2H00A 4KBFA 4YQYA 8LDHA 1EAMA 1D6JA 2AD5A 2UUOA 3UB4A 4YAEA 3UXEA 4C9BA 3PC8A 3DB2A 3CNNA 4CF6A 2MYPA 2RBEA 4HOYA 5G2OA 5D1NA 2GJ9A 3W2TA 3LQ4A 4GC5A 1T9GR 2GR9A 3AKCA 1NRJB 4KN6A 1XEWX 1FP2A 3GCGA 1FPQA 1I3OA 4H0CA 2VDPB 4U6SA 4PSVA 3ZQ4A 3QPBA 4IICA 5JSZA 2BFMA 3FLEA 5D5PA 5JTTA 3SDSA 4GZ5A 4XI9A 3LSTA 1TXGA 3KCNA 1HLFA 4HF7A 4EJFA 1AV6A 4Y30A 3MB5A 2NZVG 1OGIA 3A06A 3IOCA 1UFVA 4PSCA 1NJ2A 5LZ4A 4BLTA 1P61B 1EI9A 3UJ3X 2XKJE 5DGXA 1FNSA 1D2NA 4UNSA 3S68A 5E7JA 4FQ8A 3FIUA 4AROA 2FEAA 2G6BA 1CUBA 2V7PA 1ZFNA 2ZVJA 4RIIA 2B0CA 3GB9A 2VAVA 1OBHA 1Z17A 4BBPA 2FOXA 1BSVA 1RQNA 2A5JA 3MWEA 1I94B 5BV1A 1DJMA 1YZTA 4Z3OA 3MVEA 1QOZA 1UBMS 2FF7A 2QT1A 2GPAA 3T5MA 3PSHA 5C4MA 4KKVA 4EKDA 4N6GA 1PGNA 4M89A 3ZDAA 4N12A 4KW7A 3TGPA 4N40A 4FHZA 4QO8A 4IMRA 2O2ZA 3EVNA 3EISA 3GRKA 1VQ1A 3THSA 1PQPA 2PYZA 1XNHA 2JHFA 3V1TC 3WK6A 1UXJA 4JMLA 1XKXA 3KEOA 3ZZTA 2MAPA 4DR4B 4L0MA 5JSZB 3GAAA 4MR7B 5HUQA 1EFDN 1L7QA 3PGVA 3GARA 4L3OA 3UXHA 2FW8A 3CUUA 1SG6A 1WV0A 5E9QA 4OMCA 5CB8A 1MA0A 1NVBA 4RFSA 4ZCTA 2HCBA 1SQ0A 2HDNB 2ZTVA 3QELA 4J8PA 4MH0R 3WFZA 4BQFA 2ZJAA 5B6PA 5E1MA 4DLSA 1RCTE 2XQFA 3GBVA 4ZCSA 4WZAE 1YZUA 2NLOA 3G7SA 3SE0A 3KSAC 1XTUA 4HVTA 4YONB 4MVJA 1XQWA 4NXMB 2RIPA 2YXBA 1M7GA 4I3HA 5LP6C 1ECJA 2HK7A 3W7VA 2JDIA 3HHPA 4XIFA 3JSAA 1LSOA 2XT9A 3CEPB 1GNPA 2WWXA 4WH0A 5JNRA 4K3UA 4OXNA 1F4PA 5PGMA 4A6PA 5BMVB 1A4XA 5JZMA 4D25A 4HX5A 1V9LA 3R77A 4IIHA 4UTPA 2HF8A 3EXEB 2NMVA 1DBIA 4AY3A 1X3WA 2J31A 2ZTMA 3EXAA 5AW8A 5DGHA 3SOPA 3CHRA 2RG1A 4FWBA 4KQGA 1W34A 5L53A 2HK6A 2X8JB 3DE3X 3I1FA 5E1OA 2WM8A 3MGBA 3B7PA 2E4AA 4M8NE 2C2KA 1PNTA 1EK0A 3SXPA 3AR4A 2NYRA 3U48A 4OI2A 4P4NA 1B7GO 1K89A 2OFWA 4REQA 3FYUC 3PFCA 1WZUA 2PSSA 1IOVA 1IEXA 2YFQA 3KSRA 2C0PA 3FX2A 3JYPA 3IEKA 1OFIA 1DT3A 3RASA 5JHHB 3JZMA 2WKSA 1ONOA 1ZIPA 4REOA 4B80A 1KSHA 2ODAA 3C5CA 3FU6A 1MDBA 2W71A 4KR3A 3TUZC 4V0SA 4LCBA 4ALLA 4LZNA 5KO2A 4S24A 3UJAA 3CJTA 1FFXB 1Z68A 4D4KA 1RQGA 4ZV4A 2GUWA 1TW3A 3PPXA 4X44A 2SKDA 5IH7A 4R0MA 1FS4A 2NT4A 3H2ZA 1XDSA 1H2FA 3OE5A 1JSZA 3TD9A 3C1OA 5CLFA 1VP9A 2VS1A 5C35A 1Z0JA 3SYMA 3WLKX 5ITVA 4K26A 4X66B 1SVWA 4UUMA 4YUZA 5KVSA 2G0AA 3UMYA 1GU7A 4OK5A 2DM6A 1BDBA 1BU5A 3CPEA 4RBNA 3Q87B 3ZCUA 4CMGA 1ZPDA 1XMPA 2MMCA 2V54A 3O4GA 4ZK2A 2XRYA 4XNBA 1TQDA 5CT6A 2NP6A 5I4BA 2FZWA 1D2CA 4F86A 4MKGA 4FZJA 4ZDWA 2OCYC 2L17A 2P5TB 1SU4A 1NLUA 3N74A 1RHKA 3PHBE 4YJ3B 3V2GA 2MJLA 1YI0A 3ND9A 4QPCA 5IUJC 5K0SA 4OHVA 2OKCA 1VL6A 4A0GA 2X0NA 1JMKC 4PPYA 2XXAB 3RUCA 1ICEA 3NT5A 1KJ9A 5CBPA 1UQTA 1I2BA 3GBPA 4I99A 4LNAA 2RKOA 5K03A 4YRGA 6GPBA 4J1NA 4NBLA 2HCJB 1U0RA 2GBPA 2KE5A 1RI4A 2PX4A 3HS3A 2P9JA 5DLEA 5DB4A 3H2BA 1PQ4A 1R2QA 3QQPA 1ONPA 3MINA 4P7JA 4Q7LA 3WLIA 1B2LA 1E0SA 5JMTA 3ESBA 2YY6A 1L7VC 2RAVA 2ZYAA 4FFNA 4IUDS 1E2DA 2FZ4A 3H1EA 4P0TA 3JYHA 1E9AA 2QWXA 5E6SA 3VMMA 4TYYA 4G0WA 1WY7A 1UT8A 5JRZA 4BKQA 3CN9A 1E1RD 4N8SA 2FP4A 4NYMQ 4QOHA 3ETCA 5DLDA 2NPFA 1JKJB 4ROSA 3HI6A 1WZNA 2CJWA 2C78A 2J32A 4KIGA 2WABA 4F3NA 1BCSB 1IULA 3HNRA 3NV9A 2OO5A 3EVAA 4A2QA 3DMPA 3LZ6A 5AKKA 4D4MA 4ZV9A 4EI2A 5KNCD 1B41A 5CIQA 3EHEA 4NBRA 1NNUA 1V71A 2KJQA 1FOEB 3RV3A 1XHEA 4R1LA 3ZPXA 3LUCA 5AO9A 5U4XA 2ZE5A 1KAEA 4ENQA 4ZJZA 2SNIE 1ZWKA 3FYUB 2I6TA 3AP1A 5MGNA 1T3GA 3DD1A 4YRNA 3ST7A 1J09A 2BKUA 2ADOA 4FZ5A 4MCHA 4N18A 1W5TA 2BV3A 4XN4A 1R4NB 4A82A 3VMFA 4DPRA 2DLCX 1WSWA 3CXRA 2GYWA 2PZFA 2H2AA 3DPSA 3R24A 5B7GA 2RHBA 3P9CA 1JAZA 5JWHA 3I45A 3IILA 5CVVA 4K6KA 2W6CX 2G08A 5DHRA 1JZTA 1JDVA 4L4RA 3GNTA 4L57A 3GYBA 4ZIRA 4MR8B 1U8YA 4W8HA 5JQGF 3KP1A 5DNCA 2LTAA 2H0QA 4HC4A 2PV0A 4HQ6A 4ZC1A 5B37A 1FTWA 1OXSC 5LZ7A 3STHA 1XZGA 1SB8A 3Q9SA 3OU2A 4LYFA 3VTZA 1KU6A 3T3MB 4BP9A 3BMNB 4QM6A 1Z82A 2AQ8A 4FOLA 4X8MA 4M86A 5CX1A 4ZVPA 1WS6A 1K7FB 1UWCA 3FJ1A 3NDBB 1ECBA 1SBYA 2P6MA 4YT5A 3M89A 5E6UB 3VYSB 4R2MA 3TZHA 2ZI4A 5UKDA 2HPZA 3IVCA 2Z2YA 2JJ1D 3FMIA 4LYEA 4KAJA 3WFJA 2PRKA 4UTZA 5JSKA 2D4AA 1ADCA 4G37A 1BW9B 3VKUA 1DI0A 2YWHA 4R4JA 1IVSA 3WR5A 2BGNA 1TVKA 3GJ8A 3IOYA 4BXOA 3QKUA 4E14A 4U0KA 1E6EA 4R2LA 4TPKA 1SBNE 3TLMA 2IXTA 3HP1A 1CX9B 3X1JA 4YYEA 3TLBA 1GDTA 3OE7D 1QMGA 1YQGA 2OWDA 1QRUA 1BGWA 1R3DA 1AKVA 5D3MB 5ITZA 5A6SA 2VJAA 1C1XA 1YMUA 4PGMA 4RF2A 1N8NA 4H27A 1FDSA 1A8PA 3FWKA 4F92B 3VYTB 2IEIA 4YHBA 2E6UX 3V4PB 3E9CA 3IBYA 5BPPA 3AI7A 2VAPA 4NE2A 1Y6JA 2IRWA 3GMSA 3FUCA 2GCNA 3OCWA 5AXBA 3VZDA 3C8HA 4H3KB 2WZFA 4X0EA 4CN8A 4QXPA 2X5OA 4Q1FA 3M4XA 2YIJA 4LHZA 3VM6A 3WG9A 5HIMA 2E4UA 3I2JA 1T4GA 4MKRA 5IYZF 1M9NA 3RNLA 1CF9A 3CINA 1JT2A 16PKA 1YAJA 1BVUA 4G97A 3LQFA 3WQSB 4BNVA 2P3SA 5DU2A 2AK2A 1P60A 4Z5XA 1HNWB 1OIVA 1YK0A 4C05A 2MSCB 2IDZA 1MO2A 2GZDA 1PWYE 3BMOA 3EBPA 1COWD 4QYIB 4WDRA 2L18A 4YGYA 3ZV7A 3OF2A 3PCRB 2FR1A 2FSIA 2LCFA 1PKEA 2ZSHA 3K5PA 4MJLA 3ZWPA 4EB8A 3U6KA 2VDVE 3HCRA 3W9SA 1CZLA 4MGHA 1J8MF 1A82A 1ZN9A 5JWOA 4FOPA 5FWAA 3W9YA 3M49A 1DBPA 1R16A 4GPD1 4ZP1A 1RLJA 1QGOA 2OB2A 1FXUA 3HCPA 1BEZA 2WTMA 2ZRKA 2P75A 4K88A 3R7FA 4DA0A 5I7UA 1CUAA 5EV7A 5T3UA 4D46A 1QGUB 1EGHA 2HJ9A 3HJHA 3LF2A 3EG9B 1J0BA 2JD0A 1QLHA 3AFGA 3PUIA 1GXSA 4I81A 3H11B 3SJBA 1MW2A 2X14A 5LLTA 2YMLA 4OGWA 1ST3A 3F71A 3C0KA 2NZUG 1QYIA 3VX3A 4HPJB 2GZ3A 3N8GA 3Q3GE 1U8EA 3K9FC 2C5AA 4RLFA 4V0ME 1CT9A 1N2CE 3DNMA 5KWIA 3ZDZB 2CF6A 3WICA 4AW9A 1PSWA 2VHQA 5DEIA 4Z7NB 1XDBA 1ISSA 2COKA 2VT3A 4RHEA 4X63A 5FR1A 1DOZA 3W2FA 4CM1A 2AMJA 1CRZA 1W4ZA 4EPXA 1L1RA 4UDYX 1D1QA 4F45A 3FU0A 4J7CA 4PXSA 2HF7A 4R3NA 5JS6A 2NU6A 1OBCA 2NO6A 3JQBA 3RT9A 2Q1WA 5EA2A 1K6MA 2VPYA 1L9XA 1YMVA 4V1CI 4R1MA 1PNOA 5IUKC 3PR2B 4ZDJA 4JY7A 1XI2A 2X4GA 4AMBA 1P8JA 1NRXA 3DT6A 2DHDA 2IPXA 3EMDA 1AK9A 1R5OA 2JVKA 4KMMA 4QHSA 3RVDA 2E3JA 3JASA 4DCPA 4OLAA 3TJRA 1VRVA 1PZGA 3C7DB 2XBUA 2B20A 5FNZA 2TRSB 3F8SA 4BO7A 2MSWA 1IZYA 2WMNB 2ZE7A 3KQPA 4PFSA 2WQ6A 5IAOA 4F5WA 2NX2A 2HL6A 5CLLA 2VYND 1X1RA 3VNAA 3OWHA 3BRWA 4CV1A 3AFMA 1KQNA 2Q5LA 2XODA 1SXQA 3WJ2A 3D2LA 4R8RA 1J5EB 4B3CA 4AKGA 2W83A 2HQ1A 2IYLD 3LOQA 3EQ6A 2ENWA 4MITA 4UUNA 2XWSA 2HCRA 3TO5A 5LMCA 1DFGA 4Q4LA 5H02A 4YAOA 3RROA 3R8CA 3TCXB 2XYRA 4YV2A 3SX4A 5B1DA 3C7TA 4MR9B 4QZVA 2WNIA 3BRSA 1TK3A 4UDXX 4HDKA 5BSMA 2AG0A 2P5YA 3O92A 4ZC8A 3IULA 5ALUA 5I9SA 3P0RA 3BICA 4JFAA 4JFRA 2V5UA 4OJKA 4QYTA 2QJ1A 2QP9X 5JBNA 4FNGA 5G02A 5G53C 1K06A 1N7GA 3CBGA 3UWOA 4DM3A 4EMUA 1CRPA 3GFTA 4I3FA 1ULAA 4PZ9A 4HH0A 1XJCA 2R47A 2DFKB 2I54A 3PDCA 5IVIA 3CF2A 4N6OA 4QBHA 3VJLA 4L16A 2QSJA 3O4RA 2BFAA 4BWFB 4M60A 2P4EA 2WA1A 3D2CA 3IKLA 4TM8A 5FWYB 4JLJA 2ORYA 2C54A 5KNLA 1O8BA 2CVOA 3LP8A 4KIFA 1D04A 2ECFA 5TVKA 3DCIA 5LQCA 5ENZA 4M1WA 1P1FA 4MI6A 5FNVA 2HFKA 3QVJA 3IDFA 3ZDDA 3EX7C 5EWMA 1VZ3A 4JOSA 3VHRA 3BHJA 5L7TA 3QOFA 1VG9B 4Y1GA 1RRFA 2YYZA 5HIIA 1PVVA 1B74A 3ZE6A 4D8TA 3QXSA 1CNMA 1ZSNA 2YV1A 2OQVA 1NQAO 2FNAA 3PCXA 4MRPA 1EXNA 4DSTA 4MWBA 4OBBA 1R6XA 5HR5A 1JR2A 1L8XA 2VP3A 3GOQA 5F2OA 4DEVA 4DYDA 4X24A 4K9DA 4U4AA 3F6PA 3D5QA 3M70A 5FO1A 3SHWA 3DVAB 2I3BA 4FHFA 2Q6IA 1V6CA 2WDPA 1XZLA 1ORIA 3EVBA 2D3WA 4RHTA 4X9XA 4YT8A 2B7BA 4ZW3A 2JAWA 2QYTA 2Z3VA 3NJ4A 4RVSA 2QK4A 3HN7A 2EQ5A 4QXMA 5EVJA 1JIQA 1K4MA 1SUSA 3R1IA 3ER6A 1XAIA 1E5LA 1XNJA 2M98A 4DNFA 4DMUB 2ZSAA 1I5EA 3BBLA 5FULA 1EP3B 2IYVA 1I6MA 2BR5A 3CUKA 4NXNB 1SHKA 3OD5A 4E15A 2XUIA 1U5AA 1CJSA 4E5MA 1S96A 2Y2UA 2FW6A 1HYGA 1P2UA 3KK0A 3LA8A 5K4HA 2RJIA 5AKXA 5K4GA 2BF4A 3LK6A 4GE3A 2VSNA 2YH2A 1SZCA 4YMWA 3IQGX 5FPQA 3VYVA 1OFTA 5ICMA 2IYPA 1NJ5A 4ID3A 4TGLA 1I5OA 1GGEA 2FK8A 3FNEA 4FE7A 5BW6B 5JH7F 2DQ6A 1G6OA 4B31A 4Y7CA 5FBVB 1K8YB 3WOHA 3Q11A 3WJ7A 3BGWA 3T06B 1V3QE 1Q1GA 1ZVMA 2FN7A 2GASA 3EZLA 3M4NA 3OT5A 1KJIA 4RHYA 2ZXGA 2HREA 3UXMA 3VKWA 1XZJA 3GJ3A 2XVAA 4I4TB 4NCAA 2ZP1A 3NX4A 1V26A 2C4WA 2AOTB 4K03A 1VXRA 3C1AA 1H5UA 3OZRA 3PNYA 5LNK1 4RCYA 5C8XA 1TUBA 1PL6A 2OAEA 4DRXA 2DQMA 3HYCA 3S29A 4YMVA 1VYTA 1FNDA 2B83A 1G8FA 1NMYA 2NVOA 3FDXA 4DDKA 5HG0A 2POCA 3R5KA 2C4TA 3FUUA 5L7YA 1O5IA 3QW4B 1W6RA 3NOVA 3EVDA 4N5NA 2OZPA 2GI4A 2WJZB 2EBUA 3LPAA 1ADJA 1R6VA 4TLBA 3IQFA 5EKXA 2E82A 1O96B 1KYZA 3AR6A 3FTVA 4H15A 1S4MA 1PUXA 1IWPB 4PS1A 3WK8A 3R0JA 4DLZA 3T4XA 2OM2A 4RPKA 1X7YA 5KYTA 3PTZA 1HH4A 1KO4A 2V0CA 1ZVKA 5DM0A 2Q5OA 4I1RA 4R6WA 1VJDA 3REFA 4B32A 4LF9B 4MV0A 1RLIA 3N6RA 4QTZA 5SY9A 1VFPA 1REQA 4CCWA 3A7DA 2XMDA 1YCFA 2HA4A 6PFKA 2XCIA 4JX9A 5EESA 1VMIA 4X6UA 1FIUA 1W5BA 1EZ1A 1YE5A 3MWJA 3QOWA 5C7YA 2XAUA 2VSQA 3ZWWA 2WJHA 2X8LA 2NNLD 3WFIA 4XR4A 3Q6MA 3OFVA 4GAAA 4YACA 5A7HA 2RGEA 4P83A 3DTVA 2JKZA 3T4UA 1QQTA 1FVFA 3AZOA 2GVNA 2GPYA 2H9YA 1KVUA 3L79A 4MUNA 4B6PA 4C7JA 3AF4A 5JG7A 1MQ8B 3TMYA 2PR7A 4O4HA 4TLEA 2VHWA 5HPYB 1MX9A 3TDMA 2HMUA 2C5LA 2HMYB 1MDFA 3GIDA 4OA5A 5KSYA 4IM7A 4R40A 1RZRD 5EXPA 1YTUA 1TJPB 1YCDA 4O33A 5TF0A 4WCFA 1E6WA 3GLHA 2NU9A 1J2RA 4WVFA 1P5ZB 5JDCA 2ZXUA 4CIYA 4BFVA 3THWA 1IHPA 3RT1A 4A5OA 2DQZA 1Z0AA 4YX9A 1OZHA 4RIFA 3DHEA 4X00A 3UWMA 3I04M 2I4RA 1XCMA 2J7KA 3IX7A 3O1LA 1RU3A 2AKAB 1BOFA 2J9XB 2V9CA 5A3RA 5HJEA 1JWAB 1OH5A 3GEGA 1FRZA 3KXLA 2IUSA 1IIRA 4GZ3A 2WSSA 4EUHA 1SG7A 5K0TA 4CG3A 4C6HA 3TLJA 2WICA 2VDWB 2BFPA 3K30A 2QUZA 4R3WA 4JODA 1NAIA 4EPVA 4HEJA 3H1FA 1HSZA 4M0KA 3NEYA 2BEVA 3QE4A 1GAQA 3IPRA 4B3JA 3VGPA 4JSRA 1R6TA 1KYWA 1NIJA 1H19A 2ZIEA 3QX7A 4DIBA 3PHJA 4HNAB 5M3BA 3SZLA 5IAGA 5HM6A 5KC9A 5KQMA 1RM5A 5KYKA 2RE8A 1FRVA 3VU8A 1O6FA 1IVYA 1R5JA 4NS4A 4RDHA 4Z9AA 1Y5IA 3RRFA 3H87A 4FS3A 2CNDA 3FCOA 1SXIA 2PGXA 1Y63A 2O4UX 3STVA 4E6PA 3L04A 4CIWA 5CURA 1WMEA 4GKBA 4LA4A 4DR7B 3E3AA 2JVIA 3EAGA 5AP9A 2VQEB 1V3VA 2VUIB 4D9HA 5EJ9A 4IXWA 1BE6A 2WAXA 5BYKA 2WHRA 1CY4A 3SJAA 2FPPB 1A2BA 2WJPA 4MW6A 5COQA 2Q28A 3EZNA 1XA4A 1YHYA 2FFBA 3OCXA 4U9IS 3ZD7A 3BREA 3TSWA 4QECA 4QQFA 2WTUA 4NDZA 1XZEA 1JQKA 2OV2A 3C98A 2N46A 4JA2A 1C4XA 1I01A 3QF7A 2OBLA 2GRAA 3DDSA 3SJ7A 3VU9B 2B9VA 4LNUA 5JDCC 3VXKA 3GVHA 4URHA 2V65A 4R5XA 1OLOA 5KNDD 1OX4A 1P0PA 4WECA 4B3HA 1OC4A 3X1ZA 3MIIA 2NUAB 1T9ZA 4FR0A 1R27A 4CM7A 1C3VA 4BBJA 4CQMA 4YAJA 3FKQA 5FLXA 5HA5A 1QH9A 2D2FA 2H08A 3ABOB 3M3PA 3ONWA 1XNQB 5DTRA 4MVWA 3BE6A 1EGMB 3FPEA 2F9LA 2GTQA 2FSSA 3B3JA 2PZKA 1SBIA 1ATIA 1TM2A 3KQOA 1HY3A 1T9CA 5EGNA 3P2JA 2P4UA 3K1YA 4NBSA 3N2LA 3VHXB 4XAQA 3GMIA 4HLUC 1T2CA 2FYTA 4TKUB 3HZOA 3LYHA 3QWIA 2ZLBA 1BMFA 1FFGA 2H54A 3K0KA 3BD9A 1Q7RA 1QH0A 3H65A 3ICPA 3JZDA 4JXKA 3RJTA 2DULA 5G3ZA 1RVV1 5I5EA 2VLBA 1N6NA 2Q8PA 3PFHA 3NONA 1XD2B 2NW6A 3JXEA 4NJMB 1JLLB 4OYYA 5ALMA 5TC4A 5U4QA 4BKOA 5CCXA 2WB4A 4I19A 2BHLA 2BIFA 2FRDC 4P92A 4YRJA 3TR0A 3VQTA 4EPRA 5I8PA 3EDRA 5JZOA 4F5YA 4RJIA 1V6SA 2R4QA 1DEAA 3KJZA 2HLDA 1EHIA 2RIRA 3R7WA 2SECE 4TVKA 1G9SA 5BUSA 4OHOA 5IT4A 2J3EA 3WDSA 2IITA 2PBLA 5TSDA 1GTZA 4EIWA 4GL2A 4C2AA 5BUCA 2VJLA 3USES 3EGVA 3H1BA 5KYXA 5EY5B 3E9DA 4IEEA 3LM8A 3PQ5A 2PH3A 2HJRA 4BJHB 3TEFA 1XLUA 1YV9A 1Q6ZA 4FFOA 4YPVA 5KQGA 1QV9A 2YJ5A 2GWHA 3A9WA 3KX2A 4MYTA 5I9NA 2ZJBA 2CK3A 1Z4QA 4ZTUB 1HZZC 1XXHA 4FYYA 5CEJA 1LA2A 2DFNA 4YRKA 3L1UA 1DOHA 1VYHA 1TKAA 4IJUA 4XSVA 3U7IA 4AMYA 4DNXA 2V74B 4TZ0A 4QOIA 4ZVTA 4BO5A 2E4XA 1U4SA 3KKZA 3L4SO 1KGSA 3L7KA 4QGGA 4F4UA 2QTWB 3U4IA 5BMOA 5I51A 3I76A 4HNRA 3OH8A 4IV8A 1HE5A 4WZZA 3NALA 4PC6A 5CXUA 3DHYA 1CK4A 1AHIA 3LOPA 3AV3A 3GJRA 4EO7A 1PZMA 3W4IA 4LQ4A 3GZ4A 3ZHBA 2D1YA 3OZUA 3ONVA 3PEVA 4G84A 3SEQA 1XROA 1U94A 4FEGA 3WWDA 1CZOA 2Y67A 1K5HA 5JNLA 3D4OA 3L6EA 4YP1A 1U0JA 2HHHB 4MS4B 2RGYA 1CDEA 2GCIA 3AF6A 5BSVA 4XWOA 4TKLA 1QZXA 1ZOLA 1PSDA 1Z47A 4P31A 1U9ZA 4QULA 3W5AA 4QBIA 4J2TA 3X2FA 2Z04A 4HATA 3CX6A 5FI1B 4YAUA 1ZYUA 4B4VA 1EFRD 3ZWOA 1VKZA 1GZ7A 1ZK3A 2GK6A 1TKBA 4INJA 4KB5A 4LVUA 5G3YA 4L4ZA 2Z1NA 2YZ7A 5TGDA 3RRZA 3PVSA 4Q9HA 3F9CA 2I71A 5JBQA 1YL7A 1E98A 3RHTA 5BV7A 4UAJA 2JZNA 1M6HA 2HSEA 2EG5A 4B6JA 2ZB7A 2GRJA 3TEMA 2F59A 2ZR7A 1C9YA 2HSJA 1Q83A 2L19A 4G1CA 2BFDA 5CCBA 1KEEA 4II3A 4ZYZA 2VBIA 4EB0A 2NT3A 2QW1A 3TAHA 4AQ7A 5TY0A 4ZJUA 1A0OA 2GEFA 4L85A 3NORA 1UWVA 2ZYWX 2G25A 1QG2A 4TRNA 2ONCA 4P80A 3AU9A 5G0WA 1A9YA 3BA1A 1D4OA 3F6YA 3MCTA 3ZN2A 4BIIA 1QZTA 4OXQA 2HA6A 2PFSA 3IDZA 5JCJA 4M8LA 1K5PA 2PH7A 1UOEA 1QGUA 3D02A 1JSXA 4KXQA 4QBGB 5K05A 4FONA 3F97A 1MIHA 4P3PA 4FXPA 2NSJA 2CDBA 1N9ZA 2PD6A 3KB6A 3L4BA 4LHVA 3LKBA 3G9XA 2CFIA 4D81A 2JFXA 4EJ2A 4G4IA 4BUCA 2H7CA 3W6OA 4F38A 1DBQA 2C88A 2X41A 4NCNA 1JX6A 1MB0A 2X4DA 3UYKA 5KZMB 3QEOA 5MDHA 2E89A 3AFIA 3IH5A 2AYYA 2A9FA 2JZOA 3M6LA 4DBLC 5KWEA 3ND8A 2CT8A 1HDEA 4TS4A 4D5GA 3ZDFA 4FCCA 3BQNB 3EGXA 4UHJA 2W37A 2H4WA 4RF5A 1ZK4A 1GPNA 2LWIA 2ZWIA 4G3XA 4LDPA 1EFHA 4B6OA 2YIMA 3LLUA 3WSTA 4M21A 3RVOA 1TCAA 5EIBD 4N65A 2VK2A 4EHDA 2UZ1A 4EX7A 3U16A 1PG2A 2QUAA 4OLFA 3RUPA 1PGPA 3IMEA 3I37X 2JLUA 3GBSA 4U8HA 5CGQB 3I23A 1UOPA 1TJNA 4I5IA 2DFTA 3VZSA 2XSZD 1RWBA 2EWVA 2NUTB 2WSMA 3GVPA 2VF7A 3FUNA 4TL9A 5SZKB 3RKRA 4RGQA 4FI3C 4CM4A 4IKPA 3KQQA 2LVBA 3OTHA 2WJVA 3CY6A 3CZ4A 1T5HX 3OZCA 4EM6A 2Z08A 1AVTA 2OC9A 2WWFA 4G07A 1N9KA 4BLUA 5ER9A 2E48A 2D0DA 1KO7A 2CL5A 1D6NA 2PD3A 2FCRA 2EX1A 4YLGA 1UR5A 2AJCA 1U2DC 1TU3A 3JCZA 1QHHB 4ACBA 4ZGGA 4M54A 3T6KA 3JYQA 1U8AA 3HGTA 5EP4A 2XGGA 1NBME 3OIYA 2AFHB 1XA0A 4URFA 3G89A 3QYFA 4ANFA 1Y7TA 2OFFA 4TKMA 3EWAA 3H4IA 3C6BA 4RULA 2ZXEA 2KM1A 3KSUA 1V7ZA 3TWOA 2QL7A 1XX6A 4UBOA 3Q7EA 2CEKA 4W6QA 1VLZA 5F2KA 1C14A 1FDUA 5GGYA 2C77A 4MRMB 1SUWA 4UDNA 2OP0A 2IELA 3SX0A 1ES9A 4BFXA 4YHHB 4JOBA 3LIPA 3GR6A 3EGEA 3E7XA 4QXAA 2WT4A 3LLMA 5F12A 1R88A 1SC5A 4HD8A 2J5XA 3JVDA 4HDNB 4C0JA 5IJAA 1HMYA 3OSUA 4HZGA 4JH0A 1EVEA 1JNXX 1CEQA 1ICIA 5FLKA 4ED9A 4HAVA 1EZZA 2M1ZA 3LRTA 1Y1RA 2PL3A 5JAZA 1TVCA 4JR0A 4WD3A 5EE5B 4KOEC 3TTSA 4RMGA 2WMDA 3N7TA 1KZ9A 2P9BA 3ZW7A 4BL5A 1N2ZA 3OG9A 3PGA1 3AU8A 3TKLA 2QTBA 3HUDA 2V7WA 4ZPXA 1TFUA 1RWWA 4CM6A 4UPVA 2WJAA 3KZCA 1OYWA 4OB6A 4EY5A 2O8EB 4E32A 2PS3A 4UAVA 1VL8A 2HEGA 5I5GA 2YFHA 3E1SA 1D2EA 1O6CA 1IK6A 1A95A 3PQDA 2IYFA 4K6MA 3MMPA 2XPCA 4EFLA 5LQJA 1FJHA 5EJFA 3LHSA 3CE9A 4NEGA 2WC1A 3AZQA 5J40A 4A10A 3JRXA 3B7TA 1AE1A 5E0OA 4IJVA 2W70A 4PEVA 4Z53A 4KAFA 4B3MB 3LG2A 4L5CA 4MYUA 4ZI7A 5BOSB 2GA8A 4OF4A 1IWBB 1DBWA 2XWQA 2SCUB 5GQSA 3G2MA 2AW5A 5IAKA 4CTKA 4AJKA 3ZY5A 4YMGA 3A3OA 5BVHA 4EG1A 4H7IA 3BMCA 2W4QA 1N2CA 1XHFA 2YJZA 3G1UA 1DKNA 1UBKS 4HN4B 4YC7A 3F2IA 5G1OA 1EEXB 1MEOA 2IW1A 2QR2A 3KHKA 3MPOA 4UHHA 3TOZA 3ZWMA 6NULA 1D6SA 3O1IC 4P7FA 2H1OA 2QRVB 3INYA 1NW8A 2X9VA 1XZKA 3OHMA 4I8IA 3K20A 4OYRA 4LJLA 4N5IX 5IJWA 2GGSA 3M1LA 1FU7A 3GG9A 5TPZA 2C4VA 1JLRA 2RFLA 4YRFA 4G2TA 3FMGA 4PFKA 3C39A 4W7IA 4IDBA 4ZX3A 4AM8A 4EELA 4ZW7A 1PKXA 2FWMX 1DLIA 5EJGA 3DAGA 3SR4A 5E3HA 3HJFA 4D45A 3OEHD 1OI2A 4RS4A 4BO1A 2Q3HA 1YJCA 4BCCA 4AO8A 1OILA 5C37A 2QVGA 4GDFA 1GL7A 4B9AA 3LO8A 4BXOB 4K6FA 4YTEA 5AKIA 3DJFA 5ALDA 1J6UA 3STXA 3R0ZA 3CF4A 1F6WA 2H1LA 4NY1A 2YS7A 1YZYA 2D1QA 1FXSA 1U2GC 4ENPA 1K88A 5LQUA 5KWJA 3JR7A 5CYFA 1F06A 4XO4A 3R5FA 2IDMA 1F1BA 1MXHA 3V4SA 2ORVA 3DD5A 5ALWA 4MPPA 1B0UA 4AJIA 3KSBC 3T7KA 2Q8NA 5CA0A 3X2EA 3QG1A 2FZVA 3JD0A 2BM1A 3TLCA 3AEZA 5AVZA 4P4GA 1JIXA 1APBA 3HW2A 4ERXA 1B0AA 4A26A 3ZYZA 3PE4A 2G9ZA 1W36B 2MT9A 4X2UA 4KL8S 1CZRA 2OLKA 3H2YA 4MCIA 2RBGA 3UKDA 2OV1A 3WLPA 2GN1A 2XRZA 1WOMA 2ZB3A 3CLUD 1OH8A 1PL0A 3VJRA 3BSYA 4OATA 2CLFB 3H9CA 1SBCA 3KWLA 2YDYA 4J0KA 2AJTA 4QGAA 4TXJA 1D07A 2H18A 3BDAA 3K2EA 2TMKA 2GX6A 4QGBA 3EWIA 4DZRA 3LWNA 3FOWA 5H3HA 3K9NA 3EUFA 4EA9A 4GOMD 4WBNF 3GPLA 4QOFA 4W9MC 5F98A 4QUDA 4IR7A 1I4TD 1TGYA 2FMIA 2PAAA 3ROQA 4V0KA 1ZXXA 1ENOA 2XEXA 5BSHA 1T4CA 3DL4A 3BXEA 5JI3E 2GN0A 3I01M 1TZ2A 2J07A 2NYUA 3Q98A 4NR0A 4PIVA 3ZH2A 4Y0NA 2HMSA 4B8WA 1E32A 4HBZA 1R6UA 1MGOA 3T35A 1WCXA 3AETA 4EA6A 1SPBS 5EMMA 1HT2E 2PFKA 3DTYA 4NAUA 4RMIA 1USKA 4E08A 2O0MA 3MOSA 1GGHA 2HADA 3HRHA 4YP5A 1W8IA 5TNXA 3PHGA 4CMHA 1H66A 3LFHA 3WLOA 3U2QA 2X1MA 4FOOA 5FUMA 3UJPA 2A9VA 1T8SA 1X1SA 3W4KA 4MQUA 2P8SA 4GWGA 1IQRA 1CQJA 1YJBA 3G0GA 1DEXA 3FOFC 1ZY2A 1XKQA 2V6IA 3AUAA 2V1XA 4ZQTA 2B8EA 1LPPA 1MAWA 3AUSA 3Q44A 2BZGA 2ZZNA 2WMOB 3SZOA 4PTZA 2C92A 3W8DA 3S8EA 4JR2A 4G5XA 4D80A