5E6RB

Structures of leukocyte integrin alb2: the ai domain, the headpiece, and the pocket for the internal ligand
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
459
structure length
454
Chain Sequence
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRKVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-L
publication title Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 118
structure length 454
sequence length 459
ec nomenclature
pdb deposition date 2015-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 5e6rB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 5e6rB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 5e6rB03
3T3PB 2VDRB 1JEQB 3K72A 1PD0A 4O02B 2QTVA 4BJ3A 5KYNA 3T3MB 5E6SA 3VI4B 1PT6A 1IJKA 3K71A 1U0NA 2I6QA 1MQ8B 1BHO1 2XWBF 3TXAA 4NEHB 1M1XB 1XUOA 2VDKB 4NENB 3EGXA 3EG9A 1OAKA 2NUTA 3EFOA 4C2AA 2VDQB 1ZOOA 2VC2B 3OKYB 1YUKA 3IJEB 4HQFA 4CN9A 1ZONA 4HQKA 3EH1A 4G1MB 2VDLB 3ZE0B 3AL9A 1NA5A 1RD4A 3GXBA 1M2VA 3ZDYB 3NIFB 4F1JA 1T6BY 3PPXA 5KYWA 5KYYB 1N3YA 3EH2A 2B2XA 3NIDB 3EGDB 4WJKB 5HDBB 4MMZB 4WFQA 3NIGB 1RRKA 4FWWA 1M2OA 4MMYB 2ICAA 1JV2B 1JV2A 2XGGA 4MMYA 1XDGA 3NVQA 1U0OC 3ZE2B 1RTKA 5KYUB 5HGJA 1U8CB 3TCXB 4MMZA 1JLMA 2VDOB 4MMXB 4HQLA 4IHKA 2NUPA 5KYWB 5KYYA 1L5GA 3HXQA 3V4VB 3TVYA 3VI3B 4CNBA 1M2VB 3OKWA 1SHUX 1SQ0A 2M32A 2ODPA 2NVOA 4WK0B 1L5GB 1M1UA 1FE8A 2NUPB 3BQMB 4MMXA 4GZ8A 2X5NA 1N9ZA 2NUTB 1U8CA 2I91A 5KYUA 4CN8A 3EGXB 2ADFA 4Z7OB 3ZDZB 1MQ9A 1SHTX 1M1XA 4HQOA 4IXDA 1QCYA 3K71B 3F74A 4Z7NB 4K3JB 3HXOA 1DZIA 2IUEA 1MJNA 1CK4A 4O3UB 4FX5A 3K72B 3ZE1B 3EGDA 1JEQA 3ZQKA 3F78A 3QA3E 2I6SA 5KYXA 5HJ2A 4G1MA 2O7NA 4C29A 3HI6A 1AUQA 1XDDA 3IJEA 4UM9B 3BN3A 5E6UB 3OL2B 4UM8B 1QC5A 4G1EA 3PPWA 4O3TB 1PCXA 2XWJI 1ATZA 3K6SA 2UZYB 1BHQ1 1MF7A 3EFOB 1OLZA 2WINI 3EG9B 4JDUA 2P26A 2VDMB 1Q0PA 2VDPB 4NENA 3ZDXB 5ES4B 3RAGA 5BV8A 3FCUB 3IBSA 1JEYA 4Z7QB 1LFAA 3EOAI 4WK2B 1AO3A 1RS0A 5E6SB 1YVRA 4O02A 1IDN1 2ODQA 1M10A 3EOBI 4M76B 1SSLA 4C2BA 5E6RA 2P28A 3FCSB 3PPVA 4PN7A 1IDOA 1TYEB 3V4PB 4F1KA 4UM9D 1AOXA 1FNSA 1T0PA 3TW0A 1JEYB 4JX0A 4DMUB 1V7PC 3K6SB 4XW2A 3AFCA 3E2MA 1ZOPA 3AL8B 4G1EB 4WK4B 1QC5B 4HQNA 3OL2A 3AL8A 5E6UA 1MQAA 1YVPA 3BQNB 5LN1A 3M6FA 1IJBA 3N2NA 3Q3GE 1MHPA 1UEXC 2WW8A 5KYXB 2VDNB 3PPYA 4A0QA 4IGIA 1SHYB 1CQPA 3FCSA 5E6RB 1PD1A 1DGQA
chains in the Genus database with same CATH superfamily
4GKZB 1NDGB 1DQLH 4BJ3A 5CA0F 1SCKA 2GWHA 3CZQA 3R4CA 4KSYA 6TAAA 2IELA 3HE7C 3ZU5A 5C1OA 3LCUA 2VCHA 1WFJA 3VX0A 3KZ1E 4YBQD 5KS2A 3B52X 3ODGA 1CUJA 5C0JB 2C84A 1QPKA 1XNJA 1D2HA 4LQ1A 4P8RA 4XVUC 4KUEA 2OZKA 1RFDH 3ESXA 4ZPTB 1NM4A 3IAQA 4WV3A 1Y3AA 3HBMA 1S5IH 3OWHA 4PPFA 3FT1A 1ZJ4A 1U91B 4LZKA 4R6UA 4J76A 2G67A 4F12A 1JSYA 3FO2A 5IWLA 3DAGA 4ZYYA 4X90A 3HABA 5JHLL 1A3RL 2PTHA 2NZ9C 4PB9H 3TIEA 2XYQA 1A7OL 1ZLSH 3PGKA 5IESH 3E7XA 5FXMA 2VSXA 1JH9A 3SIXA 2NQDA 3BEWB 4O2BB 2ZATA 2VXYA 3WK4A 5JT1A 3BIKB 1EA7A 2JASA 3GTVA 1H9BA 4PJHF 1WG8A 1BQ3A 1XTMA 3JQBC 4N8VA 5AT1A 1K27A 1UURA 2HZBA 3LTEA 4HAOA 4NWIA 4Y0GA 4BZ2L 1W36C 3QYCA 1XB8A 3O84A 3ZCVA 4KXWA 2P35A 5DIZA 1UF9A 2L8AA 5EIIB 4LVNA 5JSHA 2XCLA 3DL0A 3EY4A 5JRZA 4IGIA 1UDCA 2PS1A 3ZG6A 1RWOA 2ZB8A 4MQUA 2O2IA 3KVNA 3KT0A 2YIHA 3FIJA 2WG0A 4K7PX 3MINA 4FMKA 3L0CA 4MKZA 3ZZLA 2FUEA 3JV6A 3FMOB 4XOEA 2C9YA 4HKJB 3DEZA 4L51A 1CU4L 4PJ5D 4X6CF 3IDXL 3UYPB 4CSTA 2AR0A 3P9ZA 2FWPA 2JLRA 4AMXA 4QYOB 5DHXB 2J6EA 5IEJA 2VMDA 4LMBA 1Q4NX 4A0RA 1KJ2L 1VADB 1Q91A 4ACPA 5JQGA 3TTYA 1VPOL 4NHOA 5IH7A 3K8YA 3QTLA 4BINA 3OKAA 2PIAA 4AZWA 3WKMH 1WB9A 2BHUA 4YSRA 3GHBH 4GVLA 2ILLA 1XJ5A 4K81B 1EM6A 3LDAA 1FIGL 4EO4A 3ACCA 3D2TA 2XWJA 2JIBA 5FOUA 3D81A 1KCVH 1HYSD 5AVQB 1JPEA 2WIBA 1OZAA 3IKLA 1EHKB 4KXZH 1CBVL 5A7FA 5T3XL 1T1XA 4MW4A 4U9UA 3EUWA 4FT4A 1EP3B 1PDVA 3B7TA 3GIWA 4BB9A 3FOCA 4ZPJA 3M86A 4G2AA 3PC8A 4PY8J 1QH8B 5DLDA 2P8MA 1N10A 4IR7A 5C8DA 1VZ3A 4MDJA 1KDRA 5IG7A 1U0RA 3OF6D 4XH2A 3P94A 2J3KA 2WOOA 2BS9A 4DV0B 2I87A 5BN3B 4D4KA 4RL6A 3D6HA 3FSAA 4FA7B 5TVGA 1HETA 3UB4A 3A3YA 3AQIA 1Q72H 5DWDA 2FDXA 1CC3A 4RDCA 2AG0A 4JXZA 1HFWA 1G2PA 4HQQL 1N7ML 2HG5B 4MJHA 2PZAA 1U2GC 3L7JA 1E66A 3KB1A 1EUDA 4FFPA 4BCDA 2DWYA 2NY2B 2JKSA 1KAQA 3VR6H 5BWLA 1UK6A 2R2BA 4MDEA 1CQIA 5KS9E 2GO1A 2WKOA 4QRIA 4B9CA 3C8ZA 4ER7A 4OB8A 2JWGA 2OCLA 3V4FA 3D4BA 1EHLL 2DGDA 3TM4A 1OHZA 5I4IA 3IRCA 1SF3A 3UANA 3KWWB 2AI2A 1LUAA 5KZCD 4UTAA 1XWWA 4XXHA 1SVOA 1R46A 1PWXA 2ORED 2IHVA 3I9KA 3MWGA 1E4EB 4OHPA 1J5EB 4EPRA 2DMGA 1BQLH 2HV9A 3I76A 4TLAA 4CM4B 3OJ2C 2HT4C 4F60A 4UQAA 3TQRA 3QKSA 4PZYA 4AROA 1YDPA 3PGJA 2ORBL 3G5XA 2DQFA 4O9HH 5E6UB 4TS3A 1X5YA 2YWFA 1JDVA 2JKXA 1NSNL 4CKXA 2OYPA 2DYPD 1ODUA 4TYUA 1B0PA 1YCSA 1BC5A 2FPGB 3EDEA 2D54A 4M02A 5K9KB 5FHAL 2IUSA 3IBEA 4NE2A 1Y0LB 3H4FA 4RV9A 1PF7E 2WXNA 1JGLL 5TNXA 1OAUL 2EXXA 1N0VC 1U8ZA 1QK5A 4RQTA 2XWXA 2PQ6A 4JFFA 3IESA 1UZ8B 1D04A 1KY6A 3W2DH 4Y18A 1G6RA 1YA5A 4A92A 5AAWA 4G6KL 4ZEXA 2XMZA 2PVPA 4YEEA 1I4FA 3ARBC 2Y2YA 1NBCA 1E6WA 1EDYA 3C6EA 4PJEB 1WF3A 1IZ0A 3EFBA 5LLDA 4WFQA 2EJTA 2AQTA 4F93B 5AVUB 3E7FA 3I52A 1DLFH 3ZHZA 1AS8A 4WJG3 1TQ4A 3N2LA 2OO7A 4O6VA 1D5BA 3UROR 3EOZA 4QPPA 5IB5B 4OZFA 1OZUA 4HAFA 4HDCA 5F2EA 3C5SB 3ZO0A 5B2FA 1M6OB 2E4ZA 3ZWOA 3K72B 4UOZA 2X6AA 1U31A 1NQOA 2EEXA 4N90D 2BL4A 3PF9A 4DM4A 1Q1ZA 2E3VA 1E8ZA 3EH3B 1JAYA 5KWYC 1YKGA 3ZTJG 3MO1B 3G5VA 3ESQA 2JCBA 4MRBA 4X4YB 5AKIA 3LHSA 1T1GA 4YDKH 1Y63A 2F64A 5K6RA 3R6WA 1ADQA 3I12A 5JMRA 4BFNA 1C1DB 2R6FA 3ARDC 5FKPA 4US1R 3LA8A 4CUZA 2X87A 1FNEB 2P43B 3WFJA 1GDTA 1QX4A 4YDVA 4DP2X 4DBVO 2PCYA 5J59A 2NU7B 4ZHSA 3ZY2A 4WFJA 2YJ4A 1N9KA 4GMHA 1Q1AA 1JNHB 1ZHKB 4NHEA 5AOBA 2OUIA 2GY5A 1J0IA 2CKDA 4XPAL 1K8DA 1CJUC 1DVFB 4JX8A 4P46A 1Y8RB 4I1OA 4BNXA 2OMBA 3QR0A 1OARL 5HZGA 1QFWL 2DQUH 3T7JA 4PU2A 3UPRB 1NSTA 2OYCA 2GJ4A 4L74A 4K6FA 4KJPD 2BVNA 2NZ8A 2HJLA 5F51A 1CL7L 5T6MA 4M62L 3KLDA 4FCTA 3JWDL 4RPKA 1JFQH 1NR1A 4RPHA 5K6AC 4K7PY 3W2EA 3EZ8A 3WY2A 2LU4A 1J1IA 4NRXB 2HF8A 4YQEA 4G5ZL 1MQ9A 1QANA 2R6AA 1LF5A 4NP6A 3A32A 5GXBB 2PT7A 4QLAA 4NQDA 4JNXA 3B3QA 4A8TA 5EF1A 3BDIA 4NN5B 3VD2A 2WT9A 2K1MA 2SCUA 3T5MA 3AF3A 3M83A 4HBCH 4YJ2F 1RSZA 4K46A 3CVWA 3ECUA 4M9RA 2EYUA 4UTZA 2E49A 4HQ6A 5IJAA 5CNJA 2G9HA 1JIXA 4KVNL 2ATEA 5CIWA 2PW1A 3Q9SA 4MD4B 1BXXA 5C8JA 4YP9A 2PMDA 1J4AA 2CXGA 3LAWA 2AHRA 5IF0B 1CZ8H 1K4DA 3DKPA 2P80A 4BWVA 1BE1A 1CGSH 3IWUA 4ZMAT 2FPGA 3A4MA 5UKDA 3MCKB 4I85A 1AKJA 4AGMA 3FFCD 3AM5A 2O8BA 1ZM2A 2L04A 2IUUA 1O4WA 4HFUH 2A9VA 2ZSDA 3UTSE 3IQIX 4PW3A 4FA8A 5D5HA 5L3RA 2CDBA 1KI9A 1QIGA 1B2WH 2WIAA 3N74A 1N78A 3F3MA 3QG6B 3J8F7 1W5FA 1NZFA 2AX3A 3S99A 1SOKA 3LXAA 4FGJA 3ENEA 3EOTL 2XCMC 1ORIA 1Z28A 3NETA 4DW8A 4D7AA 3STVA 1AQNA 2WLTA 4IKIA 4KTDL 5GGRB 3MD0A 4K0KB 3QEMB 1WX1A 1BIIA 1H0HA 3MMEA 3DHPA 1IG0A 4DV7B 3AGQA 5EJEA 3ULKA 3H7BA 2X6BA 2J33A 1OGTA 3IHLA 2BVTA 1Z2NX 3OZRA 4N5MA 1PKQB 3ACDA 5CK5A 4O4HF 1KYDA 5CZXD 2J3SA 2C7UA 3RJZA 5BV8A 1KBOA 3LQAC 2HOQA 2Z58A 1FE8H 1EVLA 2ESRA 2GJPA 1VE5A 1YAZA 1MAML 4HUXA 4J3BA 4JRLA 5AYUH 3F65A 4DPAX 2ZS8A 4D44A 4UOW0 1A9OA 1CGYA 3RHWF 1UP4A 1NIPA 4OYRA 5JMOC 1D8AA 3K5WA 4GI5A 1DJMA 5BN3A 5KSVB 2BC4B 2AVNA 5JOPD 4PB0H 5HI3C 1KFEB 4L3OA 1GZUA 4O5LL 4YAJA 1EQAA 4N5NA 1PZ5A 2OTPA 3DL7A 4M0DA 5AXAA 3CZFA 3FNEA 1QH8A 1CJVC 1M73E 5IHZB 3K80A 4OIIH 2ZWZA 3Q3VA 1ROCA 3AG4B 3KZ8A 2XW6A 2G6TA 2UZ0A 1NFFA 2BSBA 1A8HA 1IN1A 4NM4H 2YH2A 3QM1A 1E65A 3O9WB 1KQGA 4MJJA 5EOTA 1SHZA 4F96A 2LKCA 2VJMA 5D4JA 5L7WA 4A10A 5T5FA 4DLRA 5JCZA 3OB0K 1S5PA 3R44A 4G0WA 2W2LD 5KAPA 1B16A 2HPAA 3WGMA 3MV8A 4RABA 3P9IA 5EU3A 4AU1A 4RFVA 4ABVA 5ACLA 4JS7A 3N1FC 1I3RA 5GS0H 4G0PA 3HE6C 2FYVA 4CM5A 5F76A 3OEED 3LVQE 2A1WH 3RJMA 3IE4A 2GNPA 2IFFH 4FFLA 3KPSE 4RACA 1RMFL 4P0DA 4L4VE 1UFOA 2X5XA 4MDIB 4Q7MB 1H8LA 1A1SA 3KCPB 4B40A 2XNAA 4F8NA 3JSXA 1JPSL 4DGVL 1FPQA 4NU5A 2QNIA 3MFFB 3AFHA 1U1DA 1S9YA 3TIDB 3KYIB 2HH9A 4N4YB 4AVHA 7ABPA 3NTUA 5AM0A 1U3YA 5HF6A 3FRPA 3DFFA 1AMNA 4U7MA 3PUJA 2XY2A 3VSTA 2DL2A 1E89A 3OPUA 3CQ9A 1TKCA 3ESDA 4HBQA 4YLEA 4WTZA 3KP1A 1O97C 4W5TA 3PQDA 3LQMA 3T0AA 3GMTA 5JI2E 4HKBB 4GOMD 4WKXA 3H2SA 2OTCA 3VDQA 2VH5R 5K9JH 3BFOA 5E8EA 1SM4A 4O2CB 1NUTA 5I18H 5KNCD 5T5FL 5BS0B 2A67A 4UQOA 4YAEA 1NYTA 2F8OA 2HRGA 4LKCB 5TE7H 1GYPA 2ZSAA 2ATKB 1NBEA 2TMGA 1OLLA 1VTKA 3ZXAC 1O95D 4EKDA 3I3OA 1L0PA 4XC1H 3D9QX 4B4VA 4DVBB 2D2IA 4D9QD 4I9UA 3FSWA 1E59A 5D87A 5IS2A 4UAUA 3UBXI 4ERSH 4M8KA 3GLUA 4PBTA 3HR8A 4KOCA 1WITA 4CJ1A 5E8JA 4TRPL 1QWHA 5H4GA 1RLIA 1OAYL 5DRXB 4QNRA 4P46C 4UT9L 4Z9XA 2IDMA 1AGBA 3LQQA 1X8JA 3LKNA 3REQB 2GEFA 3X1DA 4B43A 4JM0A 4GKZA 2A77L 1I1AB 4YXLL 1NLZA 1KMGA 2YUTA 1SBIA 4R2LA 1A2YA 2CFOA 3R23A 5JCOC 1S7RB 1FNCA 5EZOH 3UJ8A 1K8IA 1Q57A 2BGIA 5FO2A 3QKSB 4FGKA 2D7OA 3WS3B 4PJEE 5IHPA 1R66A 3QI9A 3LT2A 3FN0L 3D2UB 5IG2A 4P86A 4JQCA 3W3AD 1AD2A 5JJCA 4NAHA 4D98A 3V1TC 3ZPXA 2QLBA 4W5QA 4XBMA 4IHJA 4BB6A 2B4KA 5K1JA 1JSXA 1S8OA 1ESCA 5A02A 3NV9A 3NFSL 1Q94B 2WHRA 1H0RA 3WNLA 1C8QA 4YV0A 2XI4A 2W8CA 4OGXH 4WFED 2UUCB 5D71H 4DGQA 4Q9NA 5TQ0A 1CWVA 2J8ZA 1A9VA 4DCQA 4R96A 1WIOA 4Z0BL 5LBIA 2Q3MA 4MWBA 3VVCA 3WS7A 2VKXA 4YROA 5ALBL 3QUYD 3N58A 1FX0A 1DSFH 2XKKA 1RJLA 5KQGA 4N6NA 4ZDKA 5IFJA 1O6ZA 5IIEA 2XVGA 3VV3A 1JNYA 2AG1A 3B2UC 4CFZA 2VRQA 2HU5A 2HTFA 3I8SA 1XDTT 1UKQA 2QV7A 2HRBA 4Z0XB 2H1IA 3RHFA 4B71A 4XDYA 4ZTZB 4WU5B 2EGGA 4K05A 1B23P 4NFYA 1D4ZA 2AG6A 3FNGA 5AR1A 1N8TA 3S70A 2OV4A 4AK1A 3TLXA 1MB0A 1YJDL 3HNPA 3TW6A 2ZKXA 4OV6B 1S3IA 4HGNA 4DR4B 2FSVC 1NJSA 2FECI 3LQAL 3L7FA 5IC5A 5AL0A 3ARDB 4J1TA 1WGOA 1PQUA 1TVKB 3C45A 3FJTA 1BS2A 4IVNA 4J3OH 3C2QA 1PR3A 2GDJA 4FTVD 2A0KA 3Q10A 4K8RB 3R5SA 3T7RA 5TQ2L 2YKGA 3SZOA 1Z5NA 4PV8A 3RWBA 3K6NA 2WFLB 2HI0A 5H9WA 4H27A 3CCHA 4DKDC 3K5IA 4NYMQ 5F7YC 3IN2A 4GI3A 4UWQB 2QMOA 4JB9L 3IOCA 1IAKB 2K7QA 4UUJA 1P2VA 8AT1A 2V8BA 1Y42X 1MH9A 2UU9B 4UUBA 3TJRA 1XL6A 1IIIA 3ZTJH 1LNUB 2WP8J 2C4VA 3ROEA 2EDQA 1ACYL 2BOBA 2JEZA 3MRNB 4KGJA 3DE3X 4BFFA 3MOAH 4DMRA 1VBFA 3AT0A 4OIBA 1R9GA 3QTBA 3KHTA 1QYWA 2H1PL 4IXTA 4HD5A 5EN4A 5MENB 1I2AA 5AHKA 5AOCA 5IB2B 1HHKA 3C15C 5FWAA 4G7QB 1JZJA 4XWGL 3HJBA 1U3WA 2OMZB 2OR9L 2B5VA 4RK5A 1OP5H 4UQLA 5I8KH 1NUNB 1SDDA 4G07A 2Q5QA 3LPLA 3F6EX 4UUPA 1QNIA 1ZQ9A 5J1SC 3MRCB 2BM9A 4ONFL 2YIMA 3QF4B 1I8MB 3GSQB 5LGJB 1MEOA 3IBFA 3USES 2GK2A 4N65A 5JW4R 3BF8A 2LU7A 5HDQH 3ML9A 5ALWA 3Q3CA 3MV7E 1XT6A 3AHHA 2P67A 5AP9A 3WBKA 1JR4A 1RZRD 2Z7ZA 2CF6A 1V47A 221PA 3BT0A 3FFAA 4MQBA 5F3BA 3SQOL 2WLLB 2OWEA 3SE8H 4LSRH 3K5HA 4JQOA 2I0FA 1T4MA 3L8YA 3B1XA 3JASA 5MENA 1A50B 1YEWA 5F64A 3AK4A 1UASA 2LTAA 1FX1A 5BUZA 2Q86A 3MSPA 2BR4A 5FFLA 3H9SE 4JXXA 3SEAA 1XJ0A 1GR7A 3REVA 5IROC 4LKXA 1HHJA 2PKQP 4F2MA 5LDGA 4BS9A 3BGWA 1PLGH 1UC4B 4Z3OA 4AS1A 1CO1A 1ENOA 1OB0A 1K5HA 3CLSD 3KYCB 3DYIA 2HW8A 3O38A 4YAUA 5TTRA 4P81A 2UZ1A 2AI3A 1FYDA 2VDPH 3HUJB 1DQPA 3EG5A 3QRLA 1QPBA 4FHBD 3D33A 1JG7A 4Y2DB 4GP9A 4FKKA 1U8YA 2GBAA 4H26A 1XX9C 2XUOA 1XTRA 3ED1A 2AV7A 1XKLA 1X7XB 5B1IA 3DFMA 1YHZA 4YP5A 4WOJA 1Y6KR 5I19H 4JO4L 1U33A 2G4CA 4ISVB 1OXVA 1VGVA 1M3IA 2A6KB 1Q0EA 5HQTA 4G43B 2DQKA 2IEYA 3AYXB 1CY7A 4QOHA 1I1NA 2CXOA 3P4OB 4I14A 2R9HC 3LDUA 1V9CA 3FQWA 5ICXB 3ZXXA 2VDJA 1NNLA 3D0OA 2OFFA 5IUJC 1K3TA 2FI1A 5M2QA 1N5AB 1LBQA 1E6CA 3AINA 1SXZA 5E5LA 4HUQB 3QYMA 1ZNQO 3TJHC 3D8HA 3CZNA 1GDHA 2QY9A 2G1PA 4UQ2A 1RK0B 2L69A 4WWHA 5FYJE 1XDGA 1FX0B 2H6OA 1GEGA 1IM3D 1T4CB 3UG3A 4JFPB 4YDLB 3H5RA 4OQFA 3VJ6A 1JK9A 4JK0D 2AABL 3D05A 2VZ9A 2RCSH 1OQXA 1JJIA 4HEMA 3UP1A 4B3DA 1N4AA 2ZYGA 3CNOA 4CMEC 4M5YL 1QP0A 3QXJA 1NKRA 4ISVA 4IIQA 3DJYA 2GXQA 4L7VA 3PXHA 4E0RB 1Y1LA 1K7SN 2E7LC 3LQ4A 4JT2A 2FX8L 3ZGNA 4P3CH 1FNHA 3RX9A 2NV0A 3F1KA 3KPSA 2MNJB 3V4UH 2Y93A 3J7AC 5FBKA 2XTMA 2ZE6A 3QEAZ 4U3JB 8PAZA 4EUFA 1II8B 2DWDA 5B8CA 4HGOA 3KSBC 3GZNB 5CT9A 1XTUA 4GUPB 4B4WA 1JQBA 2QX7A 1FS5A 2X8LA 1EX0A 1FVXA 3WYNA 3RVRA 2W0LA 1JG6A 3TP4A 2ANCA 4PN3A 1SCIA 4MYWB 2VPZA 4NO0B 1RIVL 4G8JA 4JB8A 1NV8A 3GH3A 2NP7A 4OU3A 5AM4A 2P24A 4YBLB 5C0CB 2UKDA 1M8KA 3QE9Y 1XTBA 1M75A 4OU5A 3DX3A 1UOVA 3LRSB 3LKNB 5ENWA 5LNDA 2Q3AA 1XRQA 3VD9A 4R8RA 4YHBA 2CV0A 3AUAA 4X8HA 4F2MB 5TMEA 4HMQA 2BFVL 4HQKA 4PJCE 1QO0D 1ESDA 4DY4A 4RW0A 5DRNB 4R71A 3VGEA 1Y6NR 3DVQX 1GYAA 3I6ZA 1RUMH 2ZXWB 4NT6A 4PGBA 1M2OB 1ZXQA 4U1MB 2A58A 3IKCB 1NQBA 1MABB 5KBMA 1CIUA 3BAEH 1I7LA 4XXWC 2XQYG 1IMHC 3RIFF 2WXMA 4ONOA 1JZ3A 5BURA 1UPTA 3Q2LA 2NNCA 3WAGA 3AZUA 4P54A 4YIQB 3L8HA 4ND8B 4QJ5A 5FV7A 4H7FA 1C1HA 2FSVA 1T5XA 1SJEB 4N2LA 3SGJA 2RHEA 3WIDA 4YSCA 2DWEB 4NWUL 1TCVA 1RFDL 1BZOA 3X2SA 4YTEA 3U4CA 1L9NA 1HAUA 4YCAA 2G3YA 4HVAA 1PZ3A 2GZHA 4NCKA 3GSQA 5LGJA 1N2CE 2XUWA 2HBQA 2MSEB 2AJUH 2PQMA 5JLZB 4G5RA 1DEEB 3UO8B 1DZ3A 3OC6A 4M0UA 4RO0A 1HL9A 4FQ2H 4JM2C 3Q3JB 5JHLH 2RJOA 1V7NH 3JQ8B 3HMKA 1FFCA 3RP1A 3TIXB 1A7OH 4YNYB 3UAFA 3SJVE 1MQAA 4L1KA 5LKNA 4ND3A 3BFWA 1SXCA 1GPBA 3IDQA 3JQBA 5C18A 2RONA 2OQRA 3OQ3B 2ZQZA 4PV1C 3QZWG 4YT2A 3G6JE 2RC6A 1Q0XH 5BCAA 2QUAA 4DNQA 4YCSA 2Y3NA 2JJ8A 4U1KA 3FT4A 3PRHA 3EFEA 4Z77A 1JEJA 4XO4A 3M89A 4LVNC 4A6XA 2F3SA 3BZ5A 2J6WA 4BZ2H 1Y18A 2RB4A 1OFUX 2IAND 3D8BA 4Z4EA 2BZ0A 4UU8A 1FVDB 1GZVA 1NCWH 1V1JA 1BW9B 2ZI7A 4HK0A 3HWWA 4EA9A 1KKLA 3UCQA 3R77A 5ENDA 4LPTA 3TTSA 2YC1B 2QKSA 1KSFX 1HDEA 4M53A 4JPVH 1CUYA 4A23A 5JMWA 1H2EA 1LP9E 4JM2B 1F56A 1AQHA 3DHVA 5AVXA 3V7NA 5HTOA 1JVLA 2B6HA 4M8IA 3KLLA 3O3MB 3ZDXE 1MCOL 2HJSA 1D5IH 1LK3H 4HWOA 3WO3B 5DEIA 2YEZB 1WP4A 3FB8A 5G5DA 3QUBA 1E9PB 5F78A 2NADA 3ZHNA 1K88A 4KQ2A 4Y2VA 3UMSA 1ETHA 4HWBH 2ZW9A 3H9ZA 4GMTH 5FCUL 5D1ZI 4CNIA 1IHYA 3MUJA 4EABA 1VPOH 1XYGA 1G7QB 4G5AA 3WKML 4QUOA 1LK7A 3A31A 3MW8A 3OLZA 4QC2A 4U0JA 5K0NA 3QELB 3W81A 1XA3A 4XN5A 3K4HA 4LSZA 4AUEA 3FVTA 1GS7A 1YDMA 5IKCB 4B6EA 1KTLB 2PCFB 2ZJ8A 4KRYA 3UV6A 1XGUA 1XO8A 1FQ9C 3PR1A 3HB0A 1ZMBA 4BUGA 4WMLA 2DZEA 2XA8H 5HDBE 1CUCA 5JXEA 1XTZA 5JS1A 4JUBA 1ADQL 4CVZA 3TIVA 1QGAA 3REWA 1TE2A 4G0XA 1PZAA 5FUBA 2E6UX 4I55B 3HC0A 2UVFA 3K92A 3KKOA 5AW4B 2WSIA 1EGJL 2VPPA 1CXIA 1IYZA 2FF7A 1U8LB 4X1YA 2F43B 4M87A 1UPFA 2P62A 3GEMA 4D9JA 3EDKA 1E4KC 1B8PA 1I75A 3GMRB 2QN7A 1KLFA 4D0DA 1Q72L 3VU9B 4CVNA 2XDWA 2QYSA 3UJTL 4B34A 1G7IB 4YPJA 2GCOA 4WAUA 2BERA 4TTGA 3LVFO 2LU3A 1VFBA 1QMUA 1DANU 1YZLA 2M32A 2EO1A 3TYXA 1SC9A 3KLAB 3VM5A 3NBYC 4P93A 2X6RA 2JAXA 4CJXA 1NW7A 1H3EA 2I8AA 4FTDA 2ZSUA 4LRUA 1RWXA 4QVKA 2ES4A 3VGPA 4M8UA 3V9AA 4R2XA 2VC2H 2OGUA 1UVQB 4KACA 1I51A 1MFAH 1EFCA 1JZQA 4PE5B 3IO3A 1R5VB 2O4UX 1MGOA 4F33B 4JLKA 1BU8A 3HPJB 2MSPA 2IHKA 2YV4A 3WEXB 1SQ6A 2C04A 4XM0A 2VL4A 3P2KA 4DL9A 4KWIA 3QX7A 3FUCA 4MULA 4G81A 4CXMA 5I73C 1QKJA 2HCRA 3ETCA 3BN3B 2CV2A 1YF3A 1CDIA 3R5HA 2A1IA 3KWUA 1VE7A 5C8JB 1C8BA 1S01A 1EHXA 3STZB 1SQ0A 4D57A 2Y77A 5H80A 4LJRA 2ORBH 1ML4A 4WXYB 5IF3A 2YD9A 2FMXA 3B2XA 1MHHB 5HYEA 1P6WA 1G18A 3JVUA 2OFPA 4PJBE 4HI0E 3E38A 2VC2B 2XGSA 4M9UA 2SCUB 3MRVA 1PLJA 1IGYA 3RHZA 5KSBF 5CKGA 1XD0A 2AI1A 1K6IA 5FHAH 4R7TA 4WOKA 3WGOA 5ALGA 1EJ2A 3EJQA 2NY3B 3DOEA 3GBLA 3N1PC 4RGOH 2AN5A 4WGFA 5FYJH 4MMYA 4WUUE 1XVAA 4H7EA 2UZXA 4NOKA 4QTIL 4RADA 4NJMA 1CZHA 5E8EB 5A2LH 4GIOA 1ESMA 4BFXA 3ANSA 3E84A 3LE8A 3H3KA 4UNRA 1F97A 1EINA 3O9WD 1MN4A 4H1LB 1VHDA 2OGTA 1TT6A 4X9IA 3GSNH 5LYJB 2V9ZA 2LVEA 5GJCA 4J1SA 3C48A 4Q3OA 4RD0A 1X3SA 2QR0A 4OQ1A 2WMPA 1CR2A 1O96A 2JLUA 1QC5A 4LMRA 1WQ4A 3CF4G 4CKWA 4HJSA 1R3KB 4ED9A 4MB6A 2CL7X 1NC2A 1OW0C 1N1MA 5F9WC 2IS6A 3TRIA 1WWAX 1OAAA 1JNHA 3MRSA 5EMMA 2AXEA 2HHLA 2UWEA 5CX1B 1R75A 4PFJA 4YUAA 3BMCB 3FVRA 1TB4A 4JB3A 4PLWA 3HVIA 6PFKA 3CH5A 2V6FA 4WKZA 1ZPDA 1RNLA 1W8DA 2Q4TA 3HMXA 1G20A 1VDGA 4CKWB 5DC9B 4MAZA 1ODTC 2CNOA 4E9WA 4YACA 3S8GB 2QP9X 4YUXA 2BOCA 1E6OL 1J7KA 3R7WA 2LAGB 2OP4L 2R4QA 3NTCL 1TJGH 4EVIA 3X14A 1HSBB 2LQRA 1FA9A 3KJHA 5H59A 3OKOB 1CP2A 4X6DB 3GMOB 3D2CA 4RWZA 5FO9B 3TIFA 3RSOA 3IA2A 5K0BA 3LT0A 4QRTB 4D4GA 4KUHA 3IIEA 4Z2YA 3DO5A 1Z75A 4F8PA 1OWOA 4HPYH 4DCJA 5F1IA 4NOMA 2PUTA 3HOGA 1JKFA 4WFFE 4XCVA 1OGIA 1M6HA 4Y16B 3RX7A 3I01A 4LUCA 3RH0A 5C8YA 1Q7EA 1LX7A 1NE7A 4OSOA 5DM1A 3MCWA 3VPAA 4RQUA 4JJ8A 1E43A 1JFQL 4RUKA 3C2AH 1N2EA 3BZ4A 1QGZA 2JBHA 3H84A 1A4KA 3RFZB 1GSKA 3KDMA 5KSUA 1YMHA 3I62A 2O5CA 1UZ8A 3MNVA 1WWKA 3O3DB 3A1TA 3RJOA 4DLVA 4P7BA 4HJJL 4LTDA 1GGJA 5I48A 1AH1A 2I4RA 1P7HL 1TVMA 2NTYC 1NH6A 2AV1A 5CVCA 5ADPL 4HG4J 2PY6A 3HL0A 3AABA 3LHPL 3T6WA 4YMTA 4F4CA 5LXGH 3V0WH 4WD3A 2LD4A 2YJ5A 1AGCA 4DDHA 1FXSA 1J2JA 4X99A 1NJ5A 5EZSA 3SICE 3OE4A 3OKMA 2TSBA 4WJKB 2FX2A 3QEKA 3JVGC 4BIMA 2HUPA 4DHWA 1HNFA 5M95B 2XEXA 3FBGA 4QG3A 3MACH 3HE6B 1SKBA 1W6WA 1PT7A 2PNDA 1CCWA 2VRBA 1SZPA 4MNHB 1IN7A 2EJBA 4LDCA 4GEIA 2OYKA 3IVCA 4PZUA 4RSVA 1U7PA 4BATA 10MHA 1Q9LA 3LVRE 3ZU2A 4DABA 2YHBA 3SGEH 2BP8B 2A57A 3NP9A 5FDWA 2BFEB 1NVAA 2P48B 1OT3A 3UK2A 1W30A 1UGNA 4JFED 3ZY5A 3LNIA 1CR1A 1WZNA 2DM6A 3DVGB 5C4GB 2WLZA 5G1PA 1EUDB 2JGLA 3NFPA 1MW2A 5ELMA 1J2UA 1B43A 2NO6A 1KZ7B 4HCRA 5CM1A 1P69B 3OCVA 3D0RA 2AJ8A 4X85A 4BDVA 1RWBA 1SF5A 2X4NA 3C4VA 4DSTA 1C5BH 2PPAA 4ZYWA 4EB0A 2E5WA 4O3FA 3II1A 2A6PA 3GJ5A 5FBVB 1PR1A 2VZLA 4KJXA 5G4OA 1O75A 2B2XH 2PP9A 5U4XA 4FYSA 4AULA 4A8PA 4D7PA 1GZPB 4JR9H 1NW3A 4S0HA 4POOA 1L5WA 3I8XA 1BXZA 1RRFA 5CURA 1MHPH 1OTTC 5J6HA 4CIVA 1NI3A 3RJDA 3LZ6A 1WSWA 1R6DA 5GHWH 4OSEA 2BONA 5B4VA 5KSAA 4FFZA 2GJ6A 3KYJB 2ZJSH 2BFCB 1PG0A 4PB0L 4ID9A 5JXJA 5HHOA 5E0QA 3FH8A 2X58A 2WVUA 5LLIC 3IDFA 4CMKA 1Z32X 4PV9A 4JUAA 1HY3A 2Q4BA 4V1CI 4P46B 2LGJA 1M53A 1WHTB 3V0AC 4Z3TA 2XWDA 3TAHA 3RTLA 3LM8A 2JCCA 1SXJD 2B16A 4DCSA 4GQZA 5FX3A 3ELUA 1XVSA 1OVMA 4YMIA 3DBLA 4AYID 5JIMA 3LL4A 1DVZA 3TZVC 3HG1B 2FPIA 4IMPA 3HAEH 1OILA 4BNKA 5IQ9B 2V96A 3OQ6A 2OQJB 2PMEA 1WTLA 3B3IB 3RV4A 1XHFA 2EE2A 3OLQA 3UQZA 3LZRA 4XMXA 3KOYA 3HSSA 5IM5A 3I9OA 2R9VA 1Z0UA 4FLMA 3E9TA 1GL4B 4NIYE 5BO1L 1I9IL 2FK9A 3I9AA 4JLNA 4ZD3L 3PGCA 3D8MA 1EDZA 2BIFA 4I4TF 1YAHA 3PQ3A 4KYUA 1TKWB 5EIXA 3BXGA 4M6MH 3BTVA 1O9ZA 4YE4L 1GL3A 1D1QA 4MP6A 2OK0L 3OIWA 3X43A 2QTMA 4WFGD 2QTLA 2WTBA 2DJ4A 4TMVA 3R8XA 4I5BB 5JAHA 3QVUA 5IAJA 5E6YA 1ZVVA 1CMOA 1NZJA 1XF4A 3UB2A 1E4KA 4D0RA 4DQXA 3PQYB 5AVTB 1DO2A 1V8DA 1GA1A 3AYZB 2J6BA 3IGUA 4DM7A 1Z6QA 3NK4A 3B6JA 3ZGOA 2HJGA 4JL5A 4NM8H 3DXFA 3TRFA 1B0GB 4FYJA 3T1FA 1VFMA 2VNKA 3STWA 1KZHA 2YWBA 3F74A 3V5KB 2B21A 3WGUB 1TTAA 1TYRA 3WI7A 1JWMB 1NGZB 3Q8WA 1YZGA 3GGSA 4UASA 4OLUL 5DHAA 1H05A 5HJ2A 5I18L 1EHYA 1G7HB 2JFQA 2H5JA 2LE0A 2F6RA 3GSVB 1ZWIB 1BQ4A 1E9QB 3LRSA 1KULA 3U1SH 2CSPA 1XKXA 1XRRA 3BB3A 1HYSC 5LUAA 3SKXA 1JPFA 1QG2A 3GO1L 4U1IA 4AK2A 3UAAA 1LTXA 3H53A 5IOPB 3JWHA 1JB9A 3ONNA 4F3TA 2H4XA 3ZHQA 4Z8XA 4Y2DD 1XTJA 1UT8A 4TRPH 4LG1A 4JI8B 2COQA 1RYHA 1OAYH 1HU8A 1U3ZA 3IU4H 4ZAXA 4NN5C 1E5ZA 5EU6E 5MERB 4QRDA 4CC0A 3OMZA 1VBMA 2DWOA 4BO2A 2IV8A 1ZBQA 4DQUA 1UMDB 3BC1A 4Z78A 4PJXE 2OHIA 5ALHA 3TDKA 2BSCA 2YOHA 2OV6A 2PN1A 5TEWA 1BCRB 1JU3A 3QJFA 1G94A 1HEYA 1S7SB 4TL5A 1L4KA 1BEUB 3ZMEA 3BUIA 3KBFA 1JPVA 1GJUA 5KX5B 2IQAA 1P1ZB 1DAHA 1QTIA 3V3TA 3D1LA 3D8RA 2XWTB 1ZT4B 3ILQD 4WJLA 4YJ3F 5E8RA 2VP9A 1HOXA 1Y9DA 2X15A 4JFEB 4WN9B 4B83A 4QM6A 1MQSA 3AUFA 2EZ4A 3IUBA 1Z0JA 2D7JA 1DBPA 2HPVA 4J23A 4ZYZA 4BNIA 4TM9A 3R3ZA 1DSWA 3R3YA 1T5WB 1V7ML 1WHSA 3H1PA 3ECSA 3OOJA 2AC7A 3NFSH 4BMXA 1FQWA 4LHVA 1S7WA 1PU2A 4ZUUA 4S0XA 5IXJA 1X3LA 1E9OA 1R0AL 3KB6A 3ICCA 3GMQB 3C8KB 5CZVL 1GRQA 1Z0NA 1THTA 2EIXA 2WKQA 2C7FA 4JA0A 2VHTA 5AW5A 4OHOA 4HXYA 3U30C 4UILL 5ANHA 4FHJA 2YMXH 2AR7A 1AN9A 1V9SA 4XJSA 4US2R 2VSNA 3FTQA 1P5UB 1CUFA 5AVQA 2CMHA 4OFYD 1X7WB 2O6HA 2YPLA 2EF0A 4UT7H 1FG9C 4N2DA 2ZZMA 1TKAA 2VAAA 4PRPE 4X7DC 2YOFA 1DC6A 3E8VA 4HZAA 2VL7A 4FX2A 5GWXA 3NNDA 4A8JB 1MCNA 3BVNB 2F3TA 1NTRA 3OJWA 3AQ4A 5DDHB 1S8DA 4HG4K 5AFAA 1QP1A 1D5ZB 3GSXB 4IBYA 1H93A 4LDPA 4ZCPA 5JO0A 3IHTA 5CFZA 3SN6A 2F53D 3UYPA 5DU2A 2PTTB 1T6YA 1HQ4A 1JXAA 4PJDA 1HL4A 2HLPA 4YRCA 3TIGA 4UI2A 1TKBA 1CE1H 4DZ8A 1KZ4A 3DGFC 5GS1A 1AGDA 3FFCE 5KBKA 2DPGA 3QUMH 4KQHA 4XCEA 3U36A 1AHNA 1JEQA 2I62A 1XJCA 4I1RA 3NQ41 4P4TA 1XXFC 2VM9A 3JASB 4EN2A 5J2UB 1PX8A 2V7WA 3DONA 4A55A 2W2QA 5GS2D 2X8AA 1PFWA 4I89A 1PNVA 2YD1A 5ERXA 5CPFA 1OTSC 1YRQA 1OALA 3O45B 2VXQA 4QGAA 3ROMA 3O2VH 3GS0A 2A92A 3B8HA 3DLHA 5JEDA 2AZXA 2WJVA 4DK6A 1C0LA 3KQOA 3K8QA 4DCCA 4OGAC 3K6SB 4IU3A 5A40E 2I5YH 5AI6A 4I4WB 5LD2B 1I8MA 4UM5A 4R7VA 1X19A 1KCUL 4JN2A 3D0VB 3DX4A 5IN5A 2Y5TA 4IIFA 5LKRA 4R1SA 5LB2A 4YYZA 1T20A 3Q5YA 4JAMA 1BMTA 4MS8D 1F4WH 3H2HA 1Y1UA 4V0MA 1Z2AA 1ZRMA 2XPGB 4OEHA 4HV4A 3OXRA 2QVGA 3GJXC 3GBDA 2BJMH 2GEBA 1MFBH 1NOIA 2COUA 3ESRA 2GESA 4QHLB 2D3TA 4R4FL 2F59A 3GX1A 3FPEA 4GMSL 8CGTA 3IBCA 3CFEB 3RSGA 5MGNA 3WR5A 1AHKA 1FGNL 3KQLA 3CVVA 4B35A 3AZQA 5DHDA 3FXIC 2NO7A 1A9XB 5AJWA 2HMYB 4W82A 1UA7A 1V45E 3GUHA 4R8MA 2GQ0A 3PLAE 5CLWA 4JCWA 3GLTA 5E6IA 1NW6A 1CR9H 2C8KA 1RYNA 1SBSH 3ZV4A 1M8JA 3AFMA 4JWTA 4P5TA 3GLFA 1PYDA 3TCKA 3BVUA 5F88B 3U5TA 4OKIA 4IQHA 4RH3A 1Q0ZA 3D4LA 1KIRA 3CCHB 5DHSA 2ZJ1A 2AF2A 1BJMA 2VO1A 2Z95A 1GNQA 3MCVA 1Y4AE 1MCWM 4JRYB 2XXMB 1ZUHA 4FDWA 3N6RA 2Q0SA 1UZGA 3UAEA 3INRA 2SKDA 1YSOA 2DWTA 1G9MH 1OO2A 1QI4A 2VTBB 1KBVA 1V10A 2VABA 1OR8A 4C4ZA 4N2CA 2A3TA 1PLGL 3WXMA 1KYOK 1IH8A 3A9RA 4U7DA 2O2EA 4RFOH 2FGKA 1C41A 1R6XA 3D18B 2GKSA 2XBMA 4YX9A 2EJCA 1GIAA 1WETA 3O6MH 1JBKA 3GI9L 4R16A 5I1CH 2V98A 1WK0A 1X7QA 1Z3GL 3MNZA 4L3CA 4E9QA 4BWWA 3K9HA 1RJYB 2HLAB 3WSQH 3UXMA 4QYAA 1NJ9B 1Y6MR 1JS1X 3ABRB 4BDSA 6CGTA 2BWIA 3ADPA 2JKZA 2ZRIA 2DIEA 2AEPL 2GVDC 1R3UA 1XDWA 3WIBA 3MODL 4R1QA 1BJTA 4J3SA 4DZZA 2D9CA 4K15A 4EKNB 2XZTA 5ALLA 4D9RD 1JMYA 3PEVA 2MU1A 3RIKA 4YLBA 4KTYA 5F4ZA 4Z9FA 1NRWA 3C60D 3B2UD 2JB6A 2YW9A 3CPJB 1I3GL 3L5XL 1XRLA 3JVVA 3T1HB 4Y8VA 2WO4A 2WY3B 2IDUA 4OY9A 1UH2A 3P0JA 5FYKH 4R97B 5I1JH 4LP8A 1BW8A 1U7HA 3CLHA 1FP2A 1HNGA 2PW2B 4M8QA 3AG6A 4UJ3A 2AAAA 1H6EA 1XR9A 2VIRB 3CN3A 2Y71A 3DAYA 4LDEB 4CG3A 4ALAL 3D4CA 5DGDA 4XSHA 3ETSA 2XUZA 4RWYL 3M4NA 1JDNA 4UM8B 2W93A 3IFPB 1CUOA 2IUYA 2D5CA 2RH8A 1BFOA 4AMZA 4OIFA 1MVLA 1RS0A 5CD9A 3D2UA 2FLVA 4WW0A 1PR0A 4LHUD 2D2XA 4E2ZA 3ENVA 1H9AA 4KRGA 4DDTA 4HAKA 1C12A 1T1WA 4QOKB 3GSRB 2OQ2A 1TM5E 3VX1A 1MAWA 3MRQB 2PGJA 1BS1A 1GHTA 1PBNA 5L2KE 2P6MA 3TNNA 1YCDA 3LX4A 3UOGA 3MUGB 2IHZA 2P9RA 2OC4A 2JH8A 4KO5A 1SK8A 2I6QA 3BE1H 1VCOA 3VTMA 4BVGA 1HTWA 1K5DA 2XWRA 3LHDA 1U2GA 5DJ2A 4EA7A 4FNLL 3ESUF 4AZ0B 2NG1A 4X6DF 1D7AA 4CM8A 2FUG6 4ZAZA 1RJDA 3HTLX 4F92B 5IUKC 3ISTA 4HXBH 4O63O 1HO3A 3QGVA 5DFWH 2NY0D 1OFIA 1N0XL 3VXKA 3FPSA 2OHGA 5EZ6B 2Y3AA 4KJWC 4LF8B 3FNRA 3MB5A 2ECOA 3DSFL 2DX7A 4I3RL 3HUEA 3VQMA 1H8HA 5DTEA 2VHXA 2FSEA 4RDIA 2F8IA 3DGGB 2Q87A 3QSGA 1VJ1A 3S4SB 1O95C 1ODFA 4OJTA 1QBBA 4Q58C 1O5IA 3NVKI 5CFNA 2R4SL 1I9CA 4Y5VB 3GPEA 1XF3A 5E4TA 2FO4B 5J12C 1WSST 1ZJ6A 4RVSA 4YHMH 1ZJJA 3ENZA 5SZHB 1F45A 3EULA 4FWBA 3WDHA 4GO1A 5F9OH 4B96A 1NMBH 2BHZA 2ZSKA 4M54A 5JFOA 4DMMA 1JG2A 4P84A 3FRPB 3H3JA 4Z7WB 2ROQA 3HLTA 2QRKA 4X4MA 1F3DJ 4J8PA 3OQIA 3KQUA 2NY6D 2QX8A 3SJUA 5D7IE 3EPRA 4XCYA 1C4KA 3M3PA 1YDEA 1XZIA 4CMMA 1AZTA 1WCBA 5SWSA 1NNEA 3O0RL 3RGHA 4WLVA 1QYGL 1PDKB 4JCLA 4P7JA 2ORIA 5F7EH 2WIIA 1B2YA 4BUHA 4ROSA 4A7SA 4IDPA 3O1IC 1KYUA 4LPCA 5F93C 3RVUD 3UEQA 2HQSA 3LY9A 2GTIA 4YXWA 5LNK6 1XIWA 5KVGL 4G5SA 1B3IA 4EUKA 4DLWA 1J07A 4C2UA 1R5NA 4LRNH 5ESAB 2XJ9A 3CBKB 1A9YA 1HE1C 2WLYA 3S9DB 3VKWA 4G42B 4PZCA 4ETWA 1IPFA 4LQLA 3EVEA 2J21A 1Q0XL 2O1SA 3L6CA 4YO7A 4X45A 1HCZA 4N49A 3PD0A 3PJFA 3U2SB 4BC0A 4E2OA 2EDOA 1WPRA 2ZB4A 2HWZL 1CR6A 2IXQB 3T5CA 3RIHA 3QNWA 1K6MA 2QZSA 2IIBA 4Z99A 1YIAA 5HOQA 3GHHA 3TLRA 1N8KA 2F8MA 1TQDA 3BAFA 1ZO8A 2QYTA 1OKKA 3L3DA 3SE7A 5D1ZA 4QU5A 4UBKA 3HEIB 4UHHA 4INZA 2BFWA 1RRVA 5JRDS 3ND6A 2IH8A 3HFMH 5D1QA 5EKTA 1KFBB 2DPHA 3LX8A 2OMXB 3TM5A 5T1LA 4ZMVA 5AW0A 3MBEB 4L6CA 4TVPL 5HTSA 1AOZA 4P32A 3ZNOA 2F4NA 5A16B 4ZQKB 3TH5A 1K4MA 4K8RD 2FMHA 2VLKB 3HC3H 4V03A 4JKOA 2YASA 1FL3B 5CGYD 4GMTL 5FCUH 2ABWA 3K1JA 3O03A 2BTOA 1TYCA 1WDAA 3BK1A 5AZEH 3VXRD 2IGFH 1CKEA 4EMZA 1OVZA 1OW3B 4ZCIA 1JCKA 2BIPA 4BDTA 2VR4A 4BKPA 3QIWD 3QXDA 4NQRA 3G6DH 5DT1L 2ONYA 2HKFH 1FZMA 2WP3T 3C3DA 2B2XA 3ZXYA 5DN6D 3KVRA 3HMXL 2YUIA 4EECA 4DLYA 1EJOL 4L1HA 4ODHL 3V2GA 3KOWA 1VL2A 4GXUM 2VUHB 4NBZB 3A22A 4LNVA 4JCCA 3FROA 2GGSA 2DUMA 3FLEA 1C30A 4TN5A 3V7MA 2ZRMA 3L84A 3RYIA 1R27A 5EU6B 4AMGA 5LQJA 2GHRA 1CFMA 3V2IA 2HYMA 3DX9B 1MCRA 4WJ5A 4B95C 5IV2B 1Z0IA 5HHVH 4HS8L 5B1HA 4HY3A 3BIXA 1J0HA 4ODWA 4UAHA 4LRSB 1JECA 5DJ8A 5IJCC 3IL2A 1EQUA 3QVAA 3QAQA 3ERXA 2CLVB 3TR5A 1DBBL 3UIZA 5DVOA 3M46A 2QZQA 1KFAL 2UZIR 4TNEA 3N2ZB 3GRWH 1IRIA 2B5OA 1DX6A 4E88A 1BJ8A 2NLJA 3BREA 3UJTH 1L7BA 3WSTA 5IT2H 2XJLA 5TPWB 4OHMA 2E82A 3MCKA 5FBHA 1JQKA 2QMEA 1MDTA 2EUWA 2ZBGA 5AI4A 4NY1A 1AFVH 4HUVB 1JBQA 4QU9A 1ABEA 3X1EA 1SELA 4ZCTA 4EMSA 4E11A 3BSSA 3HCOA 4FFMA 1CUBA 2BIQA 3FAZA 4OHXA 3EYQC 1GSIA 3EW9A 4MWEA 1B4JH 3LMJL 2J5KA 2VC2L 4MUNA 3F8WA 4WZAE 4PRIE 1RLJA 1CDCA 2W0MA 4HSAC 2WMYA 4LEIA 2NY0B 3X44A 2HD4A 4L95C 2ICEA 4PCVA 5FL3A 2Z91B 5C1MB 4X5QA 2JFFA 1UJ2A 3TXXA 4UM9A 1BF2A 4DG9A 2VDNL 1GKEA 2Q1YA 1E67A 1V3JA 4A37A 2O0LA 5AKRA 3NI2A 1N6OA 1UH3A 3OJDA 3BTOA 2VK1A 2QZ9A 4FWIB 3WGHA 3VU0A 2QTAA 1EH9A 2LCFA 1SWWA 3ZCRA 5FYLH 4JRYE 4DP8X 3SYPA 4XCQA 5FL7D 5I75B 1VECA 2X0IA 5D01A 2IUEA 4IIDA 4N90E 4DFIA 2HAZA 1Q15A 2KI6A 5DUBB 1VGQA 4AKTA 4UNUA 1LPMA 1UACL 4I1YA 3LPGA 5FYJL 5HYSG 3OMNB 1CICA 1TT7A 1LO3H 1TPZA 2FFBA 4JR0A 2CGRH 4GWGA 2FHSA 3T0VA 2YAQA 3I9V1 4OMDA 3QDJE 1W94A 3SYRA 3HCRA 3BWVA 5AAMA 4NO5B 3DMNA 1CRWG 2AXFB 1KERA 4B80A 5ICZB 3GMNA 3GSNL 1SN2A 1VZIA 4OGAD 2P2DA 4D0NA 2C4HA 3QA3A 3FGZA 1IGIH 1BVZA 3HSKA 4AI7A 1PZBA 4HCRL 3WU1A 3PRZA 1GAJA 5E2TL 4CV2A 5D1XD 5CBKA 1UWXK 3FB7A 5JPMB 4JD5A 2PZBA 5I1EL 3K2BA 2E4TA 3KPRB 1X7HA 1IAIL 3IMVA 5E56A 4EW6A 1QGED 1YV9A 5DM60 1CLYH 3D06A 2K6WA 3V8MA 3PDIA 5K45A 4EL0A 2HLDA 3LUCA 3QAZB 1YS6A 2PXCA 1XDBA 4AECA 3MRFB 2PX8A 3N2IA 5A0TA 5T3XD 2ALWA 1G0OA 2NSYA 2GK7A 4EJSA 2JIZA 3MHPA 1R33A 1OCRB 2Q49A 4Z51A 3LIZL 2A1TR 3SC2A 2JCWA 1C7QA 2ESVD 1J1PL 1ZD1A 3K1DA 4BMCA 4NQEA 4MROA 3UPUA 1DT5A 5DEGA 3FO1A 1SVBA 1KS2A 1WD5A 4IBOA 5C1DA 2ZYRA 1MQKL 1Q50A 3H8WA 1M0TA 4RISH 4LJAA 1MJUL 3LXXA 1VKXB 2B36A 2I26N 2PR2A 4JVOA 2P26A 1VESA 1UL1X 1XQVA 4HL6A 2VBGA 3GSNA 4LAQL 1BQEA 2O8FB 2B4TO 2OXGB 3MCLH 4D1YA 2OENG 4S0TD 1N9PA 3OTTA 3GINA 3QWNA 4MXWL 1MW9X 1VOTA 5C8ZA 3TVMD 1HQDA 1Y5LA 2QORA 2XRAL 4MTCA 5DYGA 2C0PA 4LDQA 4MVCA 1D7OA 1CUSA 3ZVNA 3DXAA 3JV4B 1LEKB 4JVPA 3ULVE 4Q3KA 2CBPA 1PR2A 3DMMA 1E2KA 1W0CA 1R88A 2P45B 2VNSA 4BGUA 4G8IA 4E9VA 5HDOA 1E1KA 2C96A 3I9JA 2DQJH 4OP1A 3UA3A 4LLWA 4F1JA 5EU6D 2FK7A 2FHCA 4WOBA 2IIPA 2H0RA 3PVZA 4V1DE 1XCLA 2J88H 4CM4A 1OF2A 4HXAL 3PRKE 3OQOA 4PJGB 2H4YA 5G55A 5ADPH 2CU9A 4GPTA 4FNQA 3SE9L 5HHME 2X5NA 3BVVA 2O0MA 2TRSB 4P4KA 2A99A 3AR2A 5FI0B 4FDLA 3FOBA 3DHYA 3CWQA 5I8EA 4OIMA 1ZIDA 5JQ6H 5GJSH 1YZVA 5ICYA 5D70H 3PLYA 1E2IA 1DQRA 4MWFB 3MACL 5KWIA 4YMHA 1XLTC 4GRMB 4HC1A 3LG2A 3P2DA 2VAPA 3EF0A 3GJ6A 1LKZA 1HEUA 3MILA 3Q8FA 3UMVA 1O5PA 2Z30A 4PU0A 5K01A 4TKUA 1C8PA 5A4AA 3MYJB 1KLUA 3V4PH 3BQNB 2I6XA 4F11A 1SU8A 2PD4A 2VGLM 3TFBA 2BJWA 4Z3HA 4NB7A 4QRPB 1P9OA 1GT6A 3QG7H 4TUYB 5JNUA 3HYRA 1GA2A 1K0FA 4XSGA 4DESA 5LMCA 3DE4X 1OLUA 3R0IA 4G01B 4GJTB 2JQZA 3FLMA 1DZ0A 3GXNA 4LZWA 4XT1C 1VEOA 2FZ5A 3VI3F 1TF2A 2JI3A 2NR6D 3QLUC 1W8NA 1CN4A 1JZGA 1H3GA 1XL0A 1ZZGA 4MX8A 2MQ0A 4J8RA 3RWFA 5IEBA 3EH2A 4UZGA 4U02A 2GCNA 1JWBB 3IMRA 3G9UA 2XVZA 1QGDA 3DB1A 3QBDA 1TENA 4IMRA 4G26A 3B43A 5DK0A 1USWA 1UM6H 2H3EA 3ZDYE 4IEIA 3L1JA 1UFKA 3FWHA 5AICA 2D7QA 2REXB 4GSXA 1RXIA 2BDEA 3TZQA 1YI1A 2XX0A 4IDGA 3P96A 2ZWOA 4P1ZA 1C1EL 2VBCA 1X4XA 5KU1A 3QDGB 3WYEA 3E9CA 5GIOE 1ONNA 2D2CC 2QSVA 1JYNA 3E4DA 2BIIA 3QIUB 3D09A 2FP4A 1BDIA 3GLZA 2YS4A 4NJAH 5JAQA 3HHPA 1HXYB 2VLKE 4QKQA 3JWGA 2WU1A 2AQ2A 1O5TA 3MNWB 2O06A 2FATH 1YB5A 2H1VA 4K5QA 3LSOB 4KO3S 3OKEB 1WCV1 3FSZA 4OM0L 2YGNA 1KH2A 2VXVL 4W81A 2PT5A 1PK9A 3BW9A 5KC9A 2G28A 3QNXA 1KWKA 1QTYT 1V7ZA 2OCXA 2RH9B 1NMAH 1T4BA 3TV8A 3JCZA 2CO2A 3ETGA 5DJDA 4WA8A 3FFOA 1BX2A 1WPCA 4MS3A 1QLHA 3MLWH 5KZCB 4Y1FA 5LQKA 3SPVA 2GEJA 4D8VA 4XJXA 2HFEB 3GLVA 1XGRA 1QPZA 3SKOA 3OJFA 1CZKA 3TI7A 5DULA 3O8BA 1MF2H 1GSOA 1PX2A 1QTPA 2Y6TE 3QZWB 5A4MS 2X5JO 4NNXA 2EC9U 4KQKA 2GXSA 3F6IA 4EBBA 2R1YA 3SBWA 3Q1LA 5CCJA 1CW2B 1KTJA 3Q7EA 1BMFD 2YYYA 4LHYA 3UGQA 2OYRA 5FQNA 4MW1A 4FEGA 2ZXBA 3M1YA 2OGWA 2VXSH 1F3OA 3TRHA 3S37L 1GPDG 4CQLB 3PT5A 5IZCA 3DXAD 2QMYA 1P1BA 1US8B 1A82A 4MAYD 2BFAA 4GPAA 3KGRA 4RU1A 3ZGXA 1ZLUH 2IDJA 4PJHB 4R2HA 3MXVL 3PWPA 4A26A 1DN0B 3IDGB 3QEUA 1FL5A 1SYSB 1BDYA 2DBLL 3UZVB 4HFMA 3IHWA 1S9WB 1VLLA 2VJNA 2IS1A 2PRSA 2R8ZA 5GRWA 5DGCA 4GFTB 3JUYA 4NC2B 3WQRA 3C24A 5DNAA 2YRWA 4ALNA 4JDEA 4UB0H 3SE3C 1NBMD 3LVBA 2HLEB 4I4TA 2D5BA 3KYOB 1QUNB 2J6IA 3DK2A 3ZDDA 4PTUA 4FNTA 4BPRA 5E0FA 1G8YA 2CGZA 1C9JA 3VC7A 2ZP9A 4N1EA 1V37A 4ITRC 3P40A 2QJRA 3OX8B 4EFKA 4D9MA 1TK3A 4LKOA 1VAHA 4IGBA 2W2XA 3TB6A 1K3ZA 1E9EA 3OPYI 1YIDA 4YHIB 5JNRA 3RTCA 4FWTA 2O3TA 2E6JA 3K1ZA 2DZDA 4ACTA 2WMNB 2LW7A 2QZ5A 1ILSA 2QSTA 3C6LD 2JEYA 3OC5A 1E5BA 3HI4A 3TZKA 4I9GA 5KX5F 4F72A 3C60B 2XUHA 2ZR0A 2O3SA 3KIPA 3NHZA 3Q8EA 1R00A 1OVGA 2BE9A 4BFTA 3EFDH 2R0ZL 2FLMA 4PLHA 1G7JA 1EKXA 1SN5A 4N4AA 3CVUA 2JF0A 1RYDA 2X6TA 3GGPA 2G1UA 3BJLA 1PL0A 1OCWH 3L2NA 5H9VA 2PKCA 3MIIA 1WQ1R 2UZPA 2QROA 3R7DA 1AOXA 1MOEA 3CEMA 5T1JA 5CHNA 3G9AB 1J1XL 2XU9A 1YH3A 3EDQA 2VJXA 3CM0A 4EYQA 3T5AA 5T5NG 3L7IA 4YC2C 3TBYB 4P0PB 3ET9F 5BV7L 2C7VA 5HSFA 1G6VK 3UJCA 2GPTA 4MV7A 4V0QA 5ALXA 2P11A 4OD2B 3TPFA 4DLPA 4J4TA 4KXNA 3VWKD 4D9FA 3KG2A 1R0AH 1W7AA 4RE5A 4BQBA 1H8OA 4PCTA 4Y88A 2EYRB 4PTTB 4X62B 1T9HA 2Q2EB 1FQKA 5C6PB 2NO4A 4M43L 2GABA 4HZ1A 3SBQA 3NJKA 3TCXA 1GPUA 2YXWA 3G7UA 2VDOH 4UT6L 1JKJB 3T61A 4QECA 3I6IA 5TDOA 3G9VA 4LFHG 3CKLA 2HCTA 1WT5A 4GQIA 1YN7A 5DGHA 4C7OB 4PJBA 4RZ3A 2PKYX 1QVZA 1A9BA 3M34A 2J1WA 4K9EC 5BJTB 3TLJA 4KX8A 3VI4A 4ZOLA 4OCXL 3CCCA 5ALZA 2GUYA 2KLBA 2NMVA 3D5EA 3SKMB 3GEBA 4EZIA 2D59A 2V3DA 1QKZH 2O5NA 3ITEA 1I1CA 5EO1A 3RUAA 4NZPA 4IU2B 2CO7B 2WDZA 1O0VA 1EFXA 3QU4A 3FN9A 3KB8A 2K7FA 4KKLC 3B82A 3WRXA 4JPKL 2FR1A 4F21A 1P0FA 5BSUA 1FS4A 1TQ2A 3ZWAA 4CIBA 1NNSA 2JXMB 5CIQA 3FB5A 2F3UA 3LKQB 4HEA6 2VISA 3FQRB 4F5ZA 5G40A 4QYIA 1XRJA 4YJHB 4NLHA 2KL6A 4ZTBA 2NXWA 2VRAA 1COBA 3A6KA 1T1ZA 4GLFA 5BQ7A 2FIKB 4GGOA 3D59A 1F12A 3B6EA 5FBLB 4R26L 3EG9A 4D02A 2GARA 43C9A 3DBXA 2MCFA 5JWRA 4TSKA 4LZOA 2Y92A 1SIOA 3MSXA 4BWGA 2R27A 2QENA 7FABH 4J4PC 2A5GA 2D1FA 4LF4B 3DOIA 3I92A 3SXUA 2X4TA 4WKNA 3F7VB 1OY3B 1KCUH 3LL7A 3M1IA 4YHZH 1KOAA 1RLMA 1QFXA 5JD5A 1J7VR 3OJEA 4IP0A 4FQCL 2J73A 5IMMA 2X0KA 1V5GA 2IH3A 3DFKA 4HV8A 2BJML 3RWEA 3E5RA 4H1WA 2KI5A 4YUEL 5DJ6A 4WY7L 5M3BA 1NDMB 2ZGVA 4RKQA 3TPUB 4G0MA 4GYJA 2RDMA 5FYDA 1WEJH 5CGZA 3PG2A 3SQNA 3KBOA 4UCWA 2EIMB 1W73A 3RE1A 2DUUA 2QVXX 1RR6A 3H9GA 3RUFA 2XBZA 3QXCA 5DNEA 2UXFA 1DVXA 4N26A 4YRKA 3EO0A 3F3KA 3BCRA 3RIMA 3ZT7A 1IT9L 1BMQA 2OBNA 4NXSA 1GFWA 1DUIA 5C4IA 4CIXA 3IT1A 3QFCA 3C74A 3APDA 3FI9A 3FKSD 3LC2O 1S2GA 3TNMA 5L4NA 5K05A 3LYRA 5AESA 3LRMA 4UDUB 1UDBA 3MV11 3F7MA 3W9EB 1U6AH 2X1WL 1BAGA 3U83A 1MOSA 3KEOA 1HLGA 2K6GA 4XARA 1VRWA 3RL2B 4UNSA 2G9NA 1COWA 5DMJB 2UZIH 2JELH 3AXLB 1Z88A 5HJ3A 5C0CE 1GIGL 1NBZA 2HJHA 4C83A 1PYWB 2ONKA 3MRMB 1DDIA 3BYYA 3M4YA 3NPAA 4YHHB 5FX2A 5D5MF 5E9NA 1RHMA 2P5WE 5JYEA 5T3ZD 2OZNA 5I1CL 3L1OH 3CXDH 1DVYA 3BKYH 1SXJB 3V52H 2WLIA 5HHPA 3M3DA 5HJEA 3BJ91 5KVDE 1S3GA 3KM2A 2HFGH 3QJRB 4JSTA 5HKBA 3L92A 2KZ1B 3K9NA 2O57A 2AEPH 3WY9A 4WW2A 2YXVA 3D0LA 1C1YA 5BRJA 3WSVA 5LXTF 4WV1C 1QBGA 1SUHA 2NCMA 1QFJA 1YJ5A 3V46A 1V3TA 3I9LA 2YD8A 3V8QA 5FUOH 3ZE6A 4Y2QA 3C08H 3IT3A 4G1BA 1E0OB 4I1UA 5SWSE 1OU0A 2YHIB 1MFDL 3FU6A 1MAHA 4LNUA 4DA0A 3T6QC 1BECA 3RPKA 4JFYB 4PSUA 1LU9A 3K8OE 1NGWA 2OV1A 4M8NE 4LJ7A 3QK7A 3NUKA 1HWGB 2GILA 4QJ3B 3GHEH 1BA3A 3ESMA 3I04A 3IV9A 4X6EB 3ZDZF 3AREB 4I19A 4BTLA 4YBQC 5DS8B 2W6QA 1V2HE 4RWYH 5EIAA 1ZUD1 4AT6A 4WA7A 1RAHA 5IF9A 4G9DB 5CEYB 3LRHA 1SD2A 3WN5A 1RVFH 4QHKJ 1FA4A 2IJ0C 4QWWC 1VBKA 1RPUA 6PCYA 1WCXA 2QSJA 5J40A 3F64A 4BRUA 4MNQA 2WC7A 2Y22A 3FDZA 1FLTX 2VLJE 1P4SA 2RCYA 3LRPA 1G3MA 1K9TA 4EW1A 1N3YA 2J31A 1XMIA 2W6JA 3OV6A 4DQOL 4ADJA 3M7FB 5BV7C 5F1PA 2AW5A 2WPNA 3DWIA 5I71C 3QEQD 4IRZH 3LTNC 5KQSA 3EUFA 3ME5A 2XNKA 2D3WA 2YPKB 1LO4L 4C59B 4WTZG 2GBLA 1YR2A 2X2JA 1JNXX 1L7XA 3N8DA 2CZCA 1WXEA 4JI3B 4BC1A 3VE0A 1FNSH 1UXWB 3BE1L 2ZWYA 4PJAF 2Y1OA 2NXCA 4AZTA 3ARBA 3BM5A 3QPKA 2IA5A 1BVRA 3HZYA 4TSFD 3C0KA 4FJ6A 1OZHA 1FV1A 1W0WB 3WNZA 3NESA 2WHYA 1KWGA 4PLPA 2IV3A 1H2AS 5DNYB 5ETUA 1OQAA 3FU8A 3FMGH 5DHFA 2R1VB 3OFJA 1NONA 4I88A 4OI4A 4OZIF 1C08A 3GP3A 1N1GA 3MR9B 3ROTA 3AVYA 4I3RH 1SD5A 4QUIA 1WOYA 5HDWA 1LDEA 4MS8C 4WO0A 2J3LA 1GDDA 3GLHE 1V7PC 3M6UA 2GEDA 4G5YA 4MOWA 4F15B 1BQHG 3PHCA 4X6BA 3VFTB 5BUAA 2QD3A 1GR1A 1BZ9B 3Q13A 4JGNA 1L9MA 4MD0A 5C53B 4BMPB 3S88L 4FSDA 4H20L 4CJ0A 2XMRA 5IY5B 1LO0L 1B3BA 4YHML 1AUXA 3ZU8A 3U7EB 1KEPA 2WAAA 2G30A 2WVVA 3DO3A 3FQYA 2C78A 2M1ZA 2DMBA 3MREB 1ZD4A 3WV0A 1W5SA 3SAJA 2NZ1A 2OQVA 2HSDA 1RURH 4ELKA 2GZ3A 5F96H 5H4HA 4FR0A 5A2KH 4MEAA 3U7HB 4Y3UA 2ZOUA 3IPCA 4NJ9H 1JBJA 1I6KA 3HG5A 1RZJL 3TBSB 3RRBA 1DEAA 3L0BA 2RHMA 1LPSA 3HVHA 1QRNE 3GKWH 5A06A 2NRDA 2BEJA 2A0YA 3UPTA 2WINA 3C43A 3QUKB 5JASA 5DD0L 5F7EL 4NC0B 1A7JA 3CFUA 4LBZA 3QXUA 3X13B 2NW3B 3PQEA 2OG1A 4QOKE 2WZBA 4F38A 2OSYA 4QD3A 3K3PA 5KVGH 1N5KA 2YX1A 4YRRA 4Q21A 4X95A 1KE2A 1EAOA 5HGHA 1NJGA 2VDUE 3N6XA 4C9BA 1M34B 2H8KA 3NOXA 1NC4D 3ZKXB 3MWYW 5GONA 3I2HA 1ZA3B 4GI2A 1A9EB 5JNLA 3NBUA 3TQCA 4U5XA 3MLSH 3IGAA 2FGWH 4N3GA 3SJZA 1CV2A 4AYFA 2BCJQ 3OLXA 2AJXL 1JR3A 3PA8A 4RGNC 3ZR6A 1Y0BA 3W11C 2X22A 4UZSA 3WB1A 3T2OA 1WG3A 1CPYA 3HJUA 4E41B 1ZVSA 3E1SA 3UO1L 2WQRA 1JIJA 4MDYA 1GG9A 3HR4A 4ODXB 3GJ3A 4MUBA 1AV6A 4ARAA 1GTJ1 2H1SA 5BN4B 3SCZA 4AZ8B 4J4PD 3CMMA 4LJ6A 4WI3A 1D3CA 2SNIE 5KJRL 1W0JA 2FUG1 1AD9B 1VKJA 2ICES 3HC3L 3G5ZB 2CC2A 3BP4B 5I71B 1XO1A 1UR5A 2AIRA 1BLNA 3N44B 3TD9A 1C9DB 3CMCO 4FW8A 1ENYA 3VX3A 3A4AA 1AC0A 2YNMC 1PJLA 2NX2A 3U16A 2O5XH 5JZ7D 2J1KA 2MCPH 2O07A 3G6DL 4D0CB 4F9GA 2P90A 3ZQKA 2CUIA 4K7PL 4FLEA 4EDXB 3KNZA 4PQFA 3EAKA 2BNQB 4ODHH 1M2JA 2I2WA 4EGSA 5IJ9B 1TPXC 5IP5A 2QR3A 3G5WA 2F1EA 1SVCP 4G1UC 3EOAI 5LXVA 3KVPA 3EOBI 4DCVA 1BYIA 3S3PA 4WY5A 5JD4A 3UABA 5GJVC 3W4KA 5F3WB 3L9RB 3KYNA 3ZZSA 1X5HA 5IQOA 2Y1CA 1Y6GA 4W5NA 1XZLA 4FCWA 3EASA 3X1XA 2PJUA 1T4WA 3MRGA 2E7CA 3FYSA 3DYOA 5EOQL 3GRWL 3ROLB 3KEDA 3EO1A 3S5JA 5DO9A 3CIAA 4BIIA 4XMKH 3V4ZA 1PF3A 3ARSA 3M45A 3VJKA 3L4VA 3PWNB 3UOAB 1M56B 2B98A 4JI6B 3E4CA 3RDTB 1QRTA 5HVGB 4QQNA 1U0EA 2M6RA 4DF9A 2HCBA 2K6YA 2EDBA 1J8HE 3ZHFA 3EUUA 1RWMA 2Q28A 2ZREA 1KIQA 4X6CB 3MRKA 2BF4A 5G4KA 4MYRA 4PWYA 4L5FH 4JPIA 2WWXA 2PO5A 2F53A 2F9MA 3PHHA 4M98A 2H2AA 2HHAA 1WCQA 4QWWD 2VQ1B 2A74A 2OW6A 1N64H 1H66A 4G3YL 3DL4A 1CFVH 4DGYL 4D46A 4M5ZH 2W6OA 3RYFA 4FZEH 1MT3A 1R15A 1JNLL 5CR8A 2ZWSA 2NY5L 1OHQA 5IR1B 1E4HA 4R54A 3ZRSA 1EFRA 5ACMA 3HJAA 2XUJA 1Q9OB 4AH2A 4BKLB 2IHUA 4FC7A 4HJUA 3R4VA 3EJZD 4DQAA 1Y1RA 3NBQA 4Q8BA 1E1DA 4G24A 2XDYA 4ZYKA 3U44A 4Q89A 3F6CA 1WISA 4XVJL 1C3OA 3V32A 4JJGA 2WK1A 4HC1L 5CCHE 5KUTA 1P61B 1UACH 4YSPA 1NJ1A 5ADVA 3JQQA 4C4KO 7PCYA 3IBGA 4H5SA 4JGJA 1ODJA 4ZW7A 5HYJD 1YZHA 4K9NA 1Z36A 3H42H 4NOFA 4OT1L 1XC7A 4DMGA 1I7QB 4B3BA 1KVSA 4YPVA 2CRIA 2XN9D 4BQ8A 3L8MA 3V10A 4K9JA 2XDQA 3VPXA 1SPBS 1DQQA 2DD8L 2GN2A 2GM9A 4NBVA 4EMBA 3E3AA 1CD8A 4PHCA 2OI9B 1P29A 4LZJA 4IL5A 4BBPA 2BNRB 3WFIA 4EH1A 2XLBA 5FW7A 2F5BH 1U1EA 3T4YA 3QCTL 3LA6A 2DRUA 4ZEWA 3S6JA 4V1CA 5CA0B 4IOKA 1WVMA 2OCCB 3U13A 2FQ1A 4HDIA 3W38A 4RA9A 4XPTH 2XRFA 1RJGA 3AVUA 3PIIA 3DDFA 2JHFA 4TTSA 5FYKD 4DOHB 1UKZA 2HDNB 4EI2A 2GI4A 2Z0UA 3BFVA 5IXYA 2VXTH 3KQHA 2UYQA 4DKXA 1O6VA 3WO1A 3WJJC 3LVTA 1JLKA 1HNWB 2I07B 5EA0H 3WHXB 1KAHA 4B0PA 1RZIB 3MZ0A 4M6AA 4KJYA 1NHWA 4KU4A 2OR3A 4PWZA 3GZOA 3TPKA 2B37A 1UKCA 4P0QB 1OZTG 1OPRA 4BN0A 4DEYA 5MP6H 4IM7A 1VGRA 2V54A 4HGWA 5DQDH 1TM4E 1N2XA 5BOSB 2VH1A 1P75A 2F15A 3UHPA 4MGHA 2FFJA 2RTTA 3T3NA 3PY9A 5C0RH 2A9FA 4O0LA 3NEYA 3P0HA 3D07A 2QKIC 1JE6A 3JU3A 1ZSNA 5F2FA 3PJRA 2SKCA 4LAQH 2HNAA 4UEOA 3LAFA 2BMKB 4D9RE 1DDHA 6CHYA 4L16A 2AMVA 4PGCA 3VCLB 3E22B 3M5DA 2XTJD 3CSPA 5CBPA 3L3HB 1J9GA 1YZNA 3G0IA 4HLEA 4B09A 1I8KA 1BQSA 3GP5A 3SEZA 4S1OA 2FTAA 4KHTH 3I6SA 4GDFA 1MW3A 3VDBA 3TMAA 3L0SA 2HQBA 3KU1A 2DQDL 4GR4A 3ARFC 4YRGA 4B6JA 4DYVA 2WGNB 1R0ZA 5IVDA 1JGEB 2V2WA 3DVAB 3E3OA 3OTIA 1NKVA 4ZFOA 2P7HA 1CD0A 4D0BA 3OM8A 4RMHA 3LUPA 2Q4OA 1OGAB 1DQIA 2JJTA 4A67A 4TROA 7TAAA 4MA3A 4NLAA 1PLBA 2VP5A 2QRMA 4N9GA 4KW7A 4EJSC 4EKYA 5LVAA 5DMKA 5EPUA 3N59A 2ERCA 3MLTB 1ZH8A 4I9NA 3R3HA 2I22A 4MVJM 1CRLA 4EB6B 1YZYA 3OKKB 2X1VA 3LKSA 1EGMB 3UF0A 4S1WA 5CP3A 2EP5A 3ID6C 1WZMA 2AG5A 4ZUVA 4JWKA 5AJHA 4ETQB 2Z92A 1XELA 1W5BA 2ZDGA 4RQBA 4CDGC 2X1MA 1WWCA 2GZ2A 3KV3O 2EEAA 4CSSA 4HPJB 4UBIA 1V8HA 3E2HC 3E3QE 1E0SA 1NAHA 4RTJA 4ODUA 3HADA 5TFSH 4MPDA 1FW8A 1J9TA 1ZMXA 1RUKL 2V7NA 1FVOA 3K9WA 4H7JA 4DG5A 5G02A 4HX1A 1Z73A 4L08A 3MQIA 3VXSB 2IUFA 2XG5B 4FNAA 3RL1B 2D62A 5T1DL 2FJHA 3S35L 1MN6A 4RV4A 5EUQB 1KGWA 3NSDA 3DTVA 5AZ2L 3EZLA 5H4YA 2PMWB 3KJ4C 2MPAL 3ZRFC 3LPAA 2PXXA 3GQBB 4JM2D 4N2BA 4FYRA 2BP7B 1ZRSA 3GUVA 2HY7A 4GUAA 3CF0A 5JYMA 3Q6IA 4PF1A 5J9PA 3EOAB 4Q3AA 2VF4X 3F71A 4B5LA 2NTFB 2B9EA 3QXHA 1UM6L 3PXUA 4H9GA 4JFHE 1VKOA 2PMKA 5L4JA 1J8MF 3UGUA 1CFTA 5FBQB 5AD0A 2QE7D 4G8AC 2WN3A 5IRCD 4OD0A 1KYXA 1EB9A 4F57H 4OLZH 1NGSA 2BP7A 1PZNA 1SXHA 5C5CA 1CXFA 4D8UA 4IV8A 4M48L 1L7VC 4OKVB 5ENVA 2Q0XA 2YJGA 3SDAB 1GPOL 4LTMA 3A6JA 5EXSA 2W83A 4ECAA 3DZIA 3TV3H 5AI8A 3ALPA 1VCMA 2D4DA 5JXAH 1E4YA 4NLLA 4X97A 3IALA 3GEGA 3CW8X 1ACCA 1IY0A 1QAQA 4YHKH 4ZVOA 4KZPA 4EZEA 4TF4A 3X3GH 2OBGA 1VFAB 1AT1A 3OHPA 4TQ9A 1ZN7A 3HW7A 4GUDA 4JFTA 2D7NA 2O1AA 4FI3C 3I85A 3BL8A 3LW7A 4LOIA 4DP4X 2QX6A 3VYNA 1G5GA 1G1OA 3BAJA 1SCAA 3DVNA 1QHPA 3D39D 4HEPA 2AFRA 2OZ4L 2C97A 4H35A 4U05A 4G3XA 3GB7B 3UPDA 1XF2B 1D5MA 4P4GA 2VYQA 2OBLA 3EBPA 2I6SA 4Z1PA 3VO8A 3A36A 1Y3IA 3ORQA 2HCJB 2QF7A 3FLBA 3PXEA 4P2CG 4P2BA 4LC0A 3GEEA 2WNXA 1ONOA 5KTEH 3IP5A 1UD5A 2GB2A 1FFDA 1WBYB 1UATA 3DEIA 3UUFA 5C9KA 5ADOH 4AQDA 2F1OA 2NNFA 2VLRB 3T34A 3BVPA 1OAZH 2XB6A 5C07A 5FL7A 4DPLA 3V5HA 2PZEA 3PP4H 4B44A 1GVHA 4Y9GA 4EL5A 1IRAY 4ZFOB 1TMCB 4NL4H 2E1RA 2IH9A 4JC4A 2PJZA 2Y07H 1C5CL 1OWWA 4QFDA 4CVUA 5CEXA 1SJ9A 4DZTA 4U7SA 4X0KA 1E90A 2AFIA 3LYHA 1P19A 2N1BA 5E8PB 3HC4L 1JHUA 2R84A 3P3YA 3CSFA 2R8PA 2BSED 3OR7B 2WCGA 2CDGB 3H0KA 2ZJOA 2R47A 2M1KA 4YDQA 4L4VD 1DUZB 2ZIXA 1XZCA 4C76A 5D1ZD 3HYNA 3L0PA 3PKZA 3PIDA 4LHZA 3DYVA 2NY3D 4RXMA 3DW1X 3RG1C 1G7SA 4NZRL 4G7YL 3FF1A 3LS5L 5ABPA 4JNCA 2HLNA 3N3EA 1S9XB 5L9DH 5TE4L 3R20A 4MRRA 4N39A 1MV8A 3MWDA 4IBWA 2RJ3A 3K2MC 3G1TA 2KS0A 3LN5B 5EN2B 1MUJA 2H52A 4LNRB 4BXOA 3SEQA 4K5LA 2X2IA 2RHGB 5C3IA 4PSVA 1PY4A 1ZIYA 2WINI 1FF5A 3HBLA 1FCCA 2XQVA 1FLDA 1QDEA 4BVAA 1FGVH 2KLRA 4M7LT 3R7BA 3K9GA 2NR6C 1SA0B 3GNTA 2VJAA 3VVLA 4JYZA 2II6A 3JQOB 5CXQA 1UP6A 4PJXB 5FM5O 1VC2A 2A84A 2O05A 3O74A 3THWB 3EFDL 2KLTA 1AGFB 3VXPB 1JIIA 1KDTA 4BSWB 4ZAKA 2H2SC 1RIUL 1ZGLP 2ADJA 4Q4HA 1PJAA 3PVSA 4N7MA 3P3SA 3MXWL 1CUDA 4UYPA 1A2QA 2WYIA 4HZIA 1Z5PA 1W5AA 3G79A 2GAZA 2Q5BA 1ISGA 3LX5A 1M72A 3FGPA 4Z7UA 3EGDB 4IOIA 1E3TA 1G1MA 4LJYA 3D6TB 3ND5A 4MHSA 3OD1A 5ARDA 2WUGA 1KQPA 3SPCA 4R5VA 5ITBL 4N0EA 3RUCA 3U4BH 2F3PA 4YDLC 4JXJA 2DBZA 4EZKA 5I17B 2DPKA 5JRJA 4GZLA 4ND7A 1JDBB 1FNGA 2EIZA 3KVQA 4G80B 3TZLA 1AXEA 5LNEA 4X71A 2WA2A 5F7OA 4ITUA 4Q6KA 3KQWA 5I7WA 3LU1A 1Z47A 4JC0A 4KKPA 1QLFA 1MCEA 3A05A 1QE0A 3L6BA 4HS4A 3ZMRA 1Y6RA 3RUGB 5A2FA 2A83A 2D0HA 5BSTA 5IVKA 1KIUB 2I8LA 3IIIA 1VCAA 4WAFA 3P0VH 1OM3H 5HPMA 1DAKA 3ETBF 2WSDA 4WK2B 2OXIA 3WJJA 1RACA 1EHCA 1YRBA 4AYXA 1RLUA 1JHVA 1H4TA 3A06A 2E27H 5ISMA 1DIRA 4ZMSA 3WS6C 5AW9A 4W4OC 3T8MA 2PLAA 3CIQA 3AW9A 1KG0A 8LDHA 3AVEA 1BFVH 1L1FA 2FBJH 3HR5A 1EQ2A 4ND2A 4O8ZA 4H1UA 4KGLA 4E1VA 1WSAA 2E9BA 2ZG6A 2ZSVB 1OPGH 2BZSA 1KEVA 1THCA 1WMFA 3MQ4A 2WTAA 1NMQA 1AQDA 4OJQA 3VR4H 1R19A 1CLEA 3T0EB 3U17A 3QKIA 5LZ2A 5B1SA 2CALA 3FNQA 4FZVA 3DTNA 4P9HL 4MLZA 4YR9A 1WWBX 4UUMA 1RWKA 4LE0A 5EMYA 1MI5D 1Q1JL 2ODWA 4E6EA 5H8DA 4PYOA 5BSGA 3EFHA 3VRLF 2BS8A 4IX1A 4DRXB 4JFZL 1D7FA 1BXUA 3BILA 2D4HA 1RQ5A 1FRVA 1SKYB 1U0BB 1E2VA 2GBPA 4K7FB 1JR6A 5IK3B 3UK7A 1H2WA 1EHIA 2HKHL 4TSAL 4I1VA 1BKDR 2ZOWA 1ZHLA 1FRZA 5ERGB 1UM8A 1DZIA 1AD0A 2FMKA 3ILVA 4LYHA 3MJ8A 4WFHE 3ADKA 1F4AA 7FABL 2GAAA 2VLRD 1A7UA 2UUDH 4XOIA 5HUJA 1VA9A 2I9LA 4MVJI 3MV01 1X15A 2OD7A 4DNOA 4JDUA 2FPWA 2C7QA 3CZEA 1T5HX 4JKLA 2C2YA 2PPVA 5IANA 4XNZC 5A3IC 5G2OA 4ZICA 3MX0A 3PWVA 4KMQA 3GFFA 3MB8A 3ZSTA 1OV8A 4OCWH 3PV6A 1P3JA 3L43A 2D0IA 2C8NA 2V7GA 3DEYX 4R8SA 2XXAA 3P9YA 3EJJX 4IGKA 4MYTA 3B5GA 3UVEA 2CXTA 1ECBA 2DBJA 2JFUA 3WYCA 3HY4A 1HMPA 3UAWA 1G16A 1QVOA 3VRJA 5EC2B 1SUCA 1YDGA 3O8OA 4AF6A 3UAXA 5D6OA 1QAMA 1HLPA 2Y24A 2ILVA 1GOGA 1IGML 2VZ0A 1CJSA 4XVTL 3LT1A 1KMQA 3GCGA 2HT4D 1ECLA