5EESA

Crystal strcuture of dapb in complex with nadp+ from corynebacterium glutamicum
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
247
structure length
247
Chain Sequence
GIKVGVLGAKGRVGQTIVAAVNESDDLELVAEIGVDDDLSLLVDNGAEVVVDFTTPNAVMGNLEFCINNGISAVVGTTGFDDARLEQVRDWLEGKDNVGVLIAPNFAISAVLTMVFSKQAARFFESAEVIELHHPNKLDAPSGTAIHTAQGIAAARKEAGMDAQPDATEQALEGSRGASVDGIPVHAVRMSGMVAHEQVIFGTQGQTLTIKQDSYDRNSFAPGVLVGVRNIAQHPGLVVGLEHYLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-tetrahydrodipicolinate reductase
publication title Structural Insight into Dihydrodipicolinate Reductase from Corybebacterium glutamicum for Lysine Biosynthesis.
pubmed doi rcsb
source organism Corynebacterium glutamicum (strain atcc 13032 / dsm 20300 / jcm 1318 / lmg 3730
molecule tags Oxidoreductase
total genus 70
structure length 247
sequence length 247
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 5eesA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5eesA01
3KXDA 1Z7EA 4DIBA 2OMEA 3IAHA 3I4FA 4AVYA 3VKVA 2ILTA 1LX6A 1E7WA 3KETA 3GFBA 4UREA 3E6AA 2PR2A 3WBFA 4U0JA 3U4DA 2CMDA 1VJ0A 4GWGA 1WVGA 1YOVA 3QHAA 2JHGA 4Y9DA 5L95A 1I2CA 1I30A 2VRCD 3BYZA 1I3KA 1BDBA 3IDSA 1MG5A 8ADHA 1LNQA 4CQLA 3PDUA 3P2OA 1E3WB 3QA9A 3P7MA 3LU1A 1P1IA 5C3MA 3IOYA 1XU9A 1H6CA 1FF9A 4LVUA 4IS2A 1ZUD1 3PJEA 6ADHA 4A2CA 2W2KB 4DPLA 2X58A 1AE1A 4I1IA 1EZ4A 1KVUA 1NP3A 4EEZA 2UAGA 4HFMA 4MVJM 3CZMA 5T73A 3BXXA 3WICA 4MP3A 3WGTA 3PIIA 3DFUA 2XPCA 3NKLA 1ZJZA 1J5PA 1SZJG 1HXHA 3TPCA 3JQGB 1WZIA 4LMRA 1Z73A 3DHEA 3E9QA 3BTUA 1YQXA 3LLSA 3MJ4A 5JYFA 1B8VA 4IGFA 5BSGA 1ISGA 4AJ2A 1DEHA 3NT2A 3QP9A 1XIVA 1QRRA 2CVOA 1NFQA 3I6QA 3B20A 5JAIA 2DQ4A 2EG9A 4TRNA 3PZRA 1OC4A 1PZEA 3SJ7A 3N7UA 2NNLD 2DT5A 4FGSA 1XDWA 1DIHA 4R5HA 3D4OA 4MP8A 3K9QO 1E3SA 1MXFA 1ZBQA 2HMUA 1N1GA 1PJ3A 3Q11A 4IQ8A 3RQSA 3D5QA 3ZWPA 5CDTA 5FF9A 2P9GA 2X9GA 2NU7A 3AW9A 1CF2O 4FJ2A 4M54A 1P1FA 3QSGA 4Q3NA 2I66A 2UVDA 4CR8A 1E0DA 2P5UA 2Y0CA 3OJEA 1YDEA 4NJMB 4YT4A 1PTJA 2DPHA 3FBTA 3NYWA 3M2PA 3LT0A 3QWBA 1QG6A 4IDDA 1RM4A 4P4NA 1DIRA 3G79A 3JYPA 4NBRA 4JGBA 3WJAA 3BMOB 3IP3A 2FWMX 5DOVA 4BNZA 4M87A 1XG5A 4E2XA 2F00A 5GZ6A 4KDFA 5F5LA 1ZJYA 3KSUA 4MVJI 1HYGA 2BD0A 5KVVA 1CYDA 4XQCA 4YJDA 2D2IA 3X2EA 4XEHA 4CM3A 3OJOA 2QX7A 3N58A 2QZZA 5JAMA 2DBQA 2X0RA 2R6JA 3PTZA 1M6WA 3AY7A 2NU6A 5IFLA 2WYWA 3BMQA 4B4UA 1RWBA 2AQIA 3HB5X 5CAEA 3UH1A 1I24A 3ROMA 4EDFA 3WXBA 1V9LA 4FC7A 5TGDA 4JJIA 4MKRA 3RFXA 4WCFB 2Y1DA 4CM6A 5TIIA 4CMKA 5T6BA 2A9FA 4B4OA 2DBVO 4CM9D 1WP4A 4WNIA 2EWMA 1ZK4A 1GYPA 5DP2A 1C0PA 3DMTC 2W90A 3GEMA 3HN7A 3GY0A 4RZHA 4B79A 3GZNA 2R00A 4A27A 2HRBA 2R2GA 4JN6B 3C24A 1E1KA 3GDFA 3KVOA 5JCXA 4ALNA 3UCEA 2OOSA 5COAA 2DFVA 1XQ1A 4YBZA 1UXHA 1V35A 2FP4A 2UV8A 1U1IA 5K0ZA 3KYBA 3ZWOA 2O7SA 2RCYA 2OBNA 2B69A 1Q1NA 5DF1A 5JO0A 2RIRA 1ZEJA 2B35A 1X0VA 2B37A 1B15A 5KVCA 3E9MA 1U4OA 4CMJA 5IF3A 3MJVA 4CLOB 1V0JA 2B5VA 1MLDA 3QVWA 1K6IA 3JQ8A 3QWHA 2DC1A 4ILKA 1EEHA 4CMEC 3HG7A 2J5QA 2R00C 5AVOA 2J6IA 2Y05A 1GD1O 5DNAA 1LRKA 4GBJA 5G4KB 1H2HA 3ZCXA 4QECA 1WZEA 3WGOA 2Q2VA 1YOVB 2DUWA 3ENKA 4HUJA 1ULSA 4O59O 1PZHA 4PZDA 3R0IA 1PJTA 3ZN2A 1QP8A 2ZB4A 3ZWMA 4E5YA 1DXYA 2WTBA 3ADPA 2XOXA 4Z0HO 1T1RA 1WDKA 3CIFA 1T24A 4CMCA 1Z45A 2JCXA 3DONA 1DBVO 2C5AA 4D3DA 3Q2KA 1K0UA 4PZCA 5TLSA 3L77A 3MJEA 1FK8A 1U5AA 2AEJA 1BXGB 4OHUA 1JA9A 3H9EO 2ZATA 3NJ4A 4QO8A 3KZVA 4YEDA 3SLKA 4C4OA 3AOEC 2I3GA 4L4XA 1DJNA 4D7AA 4ZRMA 3BMOA 1R15A 2E37A 2EF1A 2XXBA 4XD2A 4L76A 1JWAB 3HDQA 4II2A 5JMWA 5JXWA 2NQ8A 1WDMA 3GHYA 3DOCA 3VH3A 3VPXA 1DHTA 1LSUA 2X5KO 3BTVA 1VPDA 2CDAA 2AW5A 2VT3A 3I9LA 3KLMX 4BO5A 1NASA 1W4ZA 1N2SA 4XX0A 2LDXA 2W4QA 1FDVA 3PIDA 3TZHA 4WEOA 3OA2A 2E82A 2CVQA 4AJJA 2FRDA 5JFOA 3TZKA 4BNTA 2O2YA 3D4NA 2AQ8A 2C7VA 1KEVA 2PD6A 3TZ6A 1LLCA 4NPCA 4FW8A 1HETA 2GYYA 4BB6A 2GF2A 3DBRB 3F5QA 3OIGA 4G5HA 3OQ1A 3JQ9C 3VVBA 3KTDA 2P68A 4B4WA 5A5FA 4B7XA 4MVJP 3DZKA 1LUAA 3WYCA 1XCBA 1F8FA 2CDBA 2BMAA 3JYOA 3OM9A 4BKOA 1LJ8A 3VHRA 2DM6A 2YW9A 2ZK7A 3BMCB 4A73A 1XGKA 4WLFA 4YB8A 1VM6A 4PLYA 2NADA 4UEKA 1PJSA 3DDNA 1GPJA 3RC2A 1JQBA 3DQPA 3VZRA 4YAJA 1YJQA 3BMQB 2PGJA 4ITUA 1F06A 2BGKA 3A1NA 4W7HA 5DP1A 3C1OA 2GRAA 4ZGWA 1ZKMA 3GVHA 4JLWA 1Q7GA 4L4SA 3JQ6A 3LVFO 1R0LA 4ESOA 3ZU5A 3PJDA 4R3WA 1GEGA 4JX8A 3G0OA 1QYWA 1NWCA 4J43A 3ZV3A 3CTMA 4AJ4A 3D7LA 4CLRB 3OJLA 4W99A 2AG8A 4NBTA 4KTTE 3M1AA 1PSDA 2VHYA 3QWAA 5A05A 4Z9FA 1EUZA 3ZV4A 1QLHA 4CMEA 4IDEA 2EGHA 3L4BC 2DPGA 4YDRA 4XDZA 4EJ0A 1E7RA 2DVMA 1ADCA 4BGEA 3C1TA 4XCVA 4UUMA 4Z0TA 3KRTA 1R4MB 1U3TA 4HX5A 4FFMA 5BNIA 2UDPA 4D0SA 5C7OO 2FMUA 3GVIA 3WFJA 4OO3A 3I23A 2CY0A 5EN4A 1FMCA 3ZWBA 3VZQA 5I7EA 5HTOA 3LT2A 3MEQA 3JQBC 1DHRA 1UP6A 3DAPA 1JDJA 2X1HA 1QKIA 2HJSA 4I9HA 3U4CA 2PH5A 2VHWA 5AOVA 3U09A 4M49A 1NM5A 1GYQA 4FOSA 2VCYA 4DQUA 1YL7A 1P77A 1R6DA 4IIUA 3JD0A 3OIFA 4IPTA 1NHWA 2AQHA 2CSUA 1K89A 3OJFA 4BQPA 4Y6SA 1I33A 3UN1A 3KO8A 1Z75A 4HV4A 4AJKA 2D4AA 3TZCA 1C0LA 1EBUA 3JQ9A 5A03A 1T2FA 4LISA 7ADHA 2BLLA 3EW7A 2B83A 1Y8QB 4BNGA 1DIGA 3WQSB 4O6VA 1SC6A 1T1SA 2NVUA 3E18A 2QHXA 3LT4A 1GQ2A 1LU9A 2X8LA 4P22A 3RC7A 5EQDA 4ALIA 4FDAA 3NTOA 1E7SA 2FPPA 4DUPA 4RF2A 1X15A 3MZ0A 3KUXA 1DDOA 4PLFA 3I83A 1UXGA 3FNFA 4BO8A 4J0FA 4BUCA 1LLQA 2G5CA 4XJSA 2D5CA 3H7AA 1YB1A 2ZJ0A 4IUYA 4IZIA 1CDOA 1P33A 1U7HA 3WGIA 3D0OA 4JBIA 5COBA 3AI1A 4CM4B 2Y66A 1PEDA 1KY4A 1U3VA 4TWRA 2YFQA 2IXAA 2X4GA 5HS4A 3I9NA 4FCCA 1N7GA 1VE9A 4WECA 1O9BA 3INTA 3DAFA 4CV0A 3L4BA 3AUUA 4CQMB 4BNVA 3L6EA 1T2EA 2Z5LA 3L9WA 4P38A 2GERA 1ZZEA 1DO8A 1B3RA 2FR1A 1DFIA 4D41A 1HE4A 3HHPA 3VDQA 4W9NC 4B3JA 2PKQO 1LTHR 1VI2A 3ONFA 3AUAA 4HBGA 4IJKA 3A14A 5T8KC 1JKJA 2H9IA 1X7HA 2GASA 4J16A 3NJ8A 4LN1A 2HO5A 3WDSA 5CDSA 5C7LO 1LRLA 5ER9A 4UUPA 3RU9A 2G0TA 2E4AA 2NTNA 4RF5A 4YQYA 2NTVA 4BNMA 3QQPA 3ZWYA 1JLLA 1HZZA 4L73A 5IJZA 2O4CA 1E1NA 1G0NA 3U0BA 1UH5A 2C82A 3HUDA 3LC2O 5CEJA 1T2CA 3KB6A 3S2EA 1N7HA 1D3AA 4PG7A 3GK3A 4NH4A 3E82A 5JMPA 5TT0A 3CUKA 1Y7TA 3H8VA 4E5KA 3WIDA 2VOJA 1I0ZA 3GQVA 4CV3A 4EW6A 3F46A 3TL2A 4AJEA 4EUEA 2IODA 4W6ZA 2PLAA 3Q9UA 3IKVA 5KTKA 1X14A 4PN3A 4QTZA 1MV8A 5JC1A 3X2FA 5F21A 5ADHA 4DLLA 3OF2A 2B4RO 1MP0A 1P31A 1KIFA 1LEHA 4FFRA 2GN9A 4AJIA 5CDYA 1WDLA 3WIEA 2E49A 4YJGB 5A02A 3ZNOA 1SOVA 4JQCA 3FNGA 1X1EA 3RUAA 1LSOA 5F5NA 4E21A 1V3UA 1HE5A 1X13A 4RDIA 4QUKA 3WFIA 1M6HA 1HE3A 1CERA 1IPFA 3WR5A 1HLDA 4BNLA 5HS6A 1BGVA 1GPDG 3GR6A 2HK9A 2PK3A 1PS9A 1H6BA 2ZB7A 1MXHA 4J1SA 4PFJA 4RV9A 1F0YA 4PLTA 4PG6A 4U6SA 3SXPA 2IXBA 1R4NB 3GMDA 2CF5A 3JYQA 2HJRA 4JIGA 3F5SA 3GPIA 1UUFA 2O23A 2HKIA 1YL6A 3VAZA 4AJPA 3H3JA 2ZIZA 5I9NA 5JDIA 1Q0HA 1ONPA 3HSKA 1PL7A 4QO7A 1PL6A 2HMWA 4UEJA 1IE3A 2V6MA 4OQYA 3RKUA 3QIVA 3W6UA 3NV9A 4A10A 3NUGA 2CNBA 3I1JA 4PLWA 3BMNA 4I8XA 3FNHA 3NX4A 4ND5A 5KJ1A 1Q7BA 1XQ6A 2I76A 2QG4A 4NIMA 3DB2A 2HMSA 3ZU4A 4WUVA 2BGLA 3KLPX 1E7YA 4GAEA 1ZNQO 1HKUA 5K6AA 3RAJA 2JD1A 4BGUA 5EIOA 3TOXA 1SEPA 1U8XX 2FSSA 1HL3A 1XYGA 1T4DA 1LSSA 1EDZA 1KVSA 4BV8A 1I5RA 1DAPA 1ZK2A 1NAIA 4PRLA 1L7DA 1OOEA 4Y8VA 5B1YA 1HYHA 3JQDA 2I3AA 3DZFA 4OKIA 4XB2A 4WK6A 4P4LA 3F47A 4CMIA 4LRSB 3C7AA 1UDBA 2PZJA 3Q2IA 4OOEA 1OC2A 4B7UA 1P74A 4BV9A 3PRJA 1BTOA 1IZ9A 3MWDB 2FSVA 2VWGA 4DIOA 5IXYA 5A5EA 2IDZA 4G81A 4K6CA 2WYVA 4QX6A 3DWFA 1O0SA 1EE9A 1F8GA 1GZ3A 1A5ZA 3DMYA 2XF8A 1NPDA 2HUNA 1F17A 4BIIA 2D3TA 5T8KA 2EP5A 4L75A 4QT0A 4R1SA 5TF4A 4HXYA 1AUPA 3GAFA 1IHYA 4I5DA 4R3NA 4PLZA 5TJ9A 3AWDA 5AYVA 1NAHA 1CJCA 1ZK1A 1XSEA 3AU9A 3FPLA 3DL2A 3WLFA 5JDIC 3ULKA 3LZ6A 5EJ2A 1TB4A 4Z3KA 2RHCA 3MOGA 3MTGA 4B4VA 4MJLA 4MVJA 1FXSA 2OO5A 1DLJA 4MKZA 2DTDA 2GN6A 5JAQA 4W7IA 4DMLA 3TZQA 4K1LA 5IDQA 1QYXA 1V3TA 3SX2A 2CUKA 4NBWA 4CR6A 1P1KA 5L9AA 3ROPA 1Y8RB 1E6EA 3QVXA 2VWQA 1RM3A 1SB8A 4L0QA 3KM0A 1N5DA 3MJTA 4IDCA 5I7SA 1BVRA 4XWYA 4UEOA 2DTEA 4XGIA 5IAAA 2Q49A 2GLXA 2GZ3A 4CLXA 1PJQA 4WASA 4YJHB 5A3VA 3ZV6A 3QRWA 3V2HA 3TFQA 5EL0A 4BKPA 3VVCA 5TC4A 1BXZA 3BHIA 1PU2A 4DGSA 1HDCA 3CXRA 3JQAD 4GSLA 4E30A 3SBOA 1ADBA 4IY1A 4CPDA 3FF4A 2O48X 3ABIA 1VSUA 2X9NA 4TROA 5L4NA 1ENOA 2HRZA 2YHUA 1OAAA 5G0SA 4E2YA 3UVEA 3DZIA 3B70A 3DBHB 2JHFA 2Q1TA 4ZQHA 3I9JA 5ILOA 4M89A 4E33A 4YAIA 2B4QA 3HE3A 5J23A 1SBYA 1GL3A 3OIDA 5ICMA 3GEGA 2Y68A 2VYND 4A7PA 4GGOA 3RUDA 2VTDA 1KVQA 1A7AA 1EK6A 3H65A 4DXHA 5C37A 3OQ6A 4R4JA 3WBBA 3OMLA 4W82A 2DU8A 3RROA 5JS6A 1PQUA 2Q2WA 1N1EA 2J3HA 2NVBA 3K73O 1ZXBA 2GO1A 2EEZA 5GY7A 3DC2A 2NUAA 4WLNA 2AEMA 2X86A 1T2DA 1S6YA 1MGOA 2UYYA 3A06A 3RBZA 4BOYA 4D43A 3R3SA 4Q3EA 1H2BA 4Q3BA 1U9JA 4FOOA 9LDTA 1R4MA 3DBHA 3D1LA 2WM3A 2YDXA 1XLTA 3F1KA 4CJXA 3O26A 2VN8A 3ADOA 3R3JA 3QV1A 2WEKA 1K2WA 1ZMOA 1WNTA 1WMAA 3RD5A 1DRVA 4ZHSA 2GPTA 1B26A 3FTNA 3GAZA 1S7CA 3HNPA 1CRWG 2NSDA 1HSOA 3ZHBA 1N92A 4OAQA 4KUEA 5K6AC 5I8WA 3AJRA 5GZ1A 1V8BA 1YQGA 3ANLA 1QYVA 3AY3A 1D1SA 4A0SA 1LA2A 1EFLA 3HQ4O 1ADGA 2NVWA 2P91A 3I4CA 1NR7A 4HADA 3SVTA 2ZQYA 4D3SA 3GDOA 3VPFA 4URFA 2Q22A 4RPJA 5DT9A 4Q3DA 4BO4A 2AMFA 3K2BA 1MFZA 5BNTA 1NQOA 1T2AA 2CFCA 4ROSA 4XQ9A 1EE2A 4ZRNA 3JD2A 1B14A 4EUHA 5JY1A 4W4TA 1G1AA 1M75A 4IZHA 2YV2A 4TQGA 3KSDO 4GWKA 4RLSA 5KKCA 3V1YA 5K9ZA 4E5PA 4J4BA 3JQAB 4J0EA 4CODB 2O3TA 2P9EA 3HADA 4RF3A 3JQ8B 2VNSA 3PWSA 5JSFA 2PKRA 4CLOA 2VWPA 2J5KA 2FY8A 3L0DA 4OJNA 3PHHA 1ISFA 5HA5A 2G1UA 3OECA 1JKIA 2WYUA 3AK4A 5JE8A 3LK7A 3UCFA 4RLHA 1RPNA 4J4HA 3UOGA 1L7EA 4J49A 3RBVA 1UR5A 4J91A 4YAGA 4JK3A 2PD3A 3EAGA 4YT2A 3RWBA 1LC3A 3JYNA 1IPEA 1PZFA 1Q0LA 4TRMA 2GZ2A 3WGYA 2OUIA 1RM0A 4AJHA 5MDHA 4IDAA 4KDEA 1YKFA 4IM7A 4DRYA 4J1TA 3PWKA 3TJRA 3FR8A 1PS8A 1QXSA 1U3WA 2HK8A 2YV3A 1VL8A 5L40A 4XYEA 3IC5A 2FR0A 3LDHA 1CQIA 6LDHA 3LQFA 1B3BA 1P0FA 3AOEA 2C59A 3K8ZA 3RFTA 1I3LA 2QIOA 1OBFO 4GSKA 4O63O 3ZHZA 4WLVA 2C5EA 2Y1EA 3ASVA 4OIMA 3S55A 3GMSA 2HAEA 2ZKLA 2EERA 4BMSA 1MA0A 2JAPA 1PJ2A 2ZYDA 4IDGA 4N54A 5TS3A 4LVCA 1YQDA 3IJPA 2RBEA 3B1JA 4EITA 4E2WA 4D44A 4FBGA 1P1RA 1YDWA 3ZDFA 3VH1A 3T4XA 4BGIA 1H0KA 3K6JA 4QQRA 3P5SA 4YJHA 2PGLA 5DDIP 3ZW8A 4IJWA 1KETA 2OHXA 4NMHA 2EP7A 1E6WA 3NRCA 4E0BA 2PWZA 2CZCA 2X22A 2BRUA 5KJEA 4WNCA 1KEWA 2D59A 2VNAA 3WB9A 3NT5A 1HRDA 3ZWVA 1EVZA 4EUFA 1JU9A 3D3WA 5HBRA 5THKA 4D46A 2J5RA 1E77A 4P4GA 3UXYA 3R6DA 4WKGA 4GPD1 4BO2A 1JKFA 4DC1A 2YHIB 1DRWA 3QE3A 5F1KA 3BTSA 4YRBA 3RU7A 4GVXA 2Q46A 1P1JA 5EERA 4UAGA 4GQAA 2IEBA 3CKYA 5MGBA 5DCUA 1FJHA 2SCUA 3OETA 4OL9A 3ONDA 4FJ0A 1ARZA 1GV1A 2NQTA 5TNXA 1AHHA 3ITKA 4UVEA 3ZHXA 2PA3A 1MG0A 3HJAA 5EQFA 1PGPA 2GNAA 4FN4A 1F12A 4CLRA 4MVJE 4ND1A 5I9MA 5BSEA 3AM3A 1BW9A 3GOHA 1LDYA 5B37A 1P3DA 4ALKA 4EJMA 3GDGA 3NT4A 4BNXA 3EVNA 5A9RA 3H5RA 2A35A 1B8PA 3FWNA 4FFLA 3IP1A 1K6XA 1YWGO 1O89A 1WWKA 5EESA 2ZQZA 3F4LA 3GA0A 4K9DA 5JDCC 4OQZA 4BO1A 1KVRA 3OEWA 1VRWA 3G1TA 3FSRA 1GCUA 2JJYA 1DFGA 1MX3A 3PDJA 4K28A 1KOLA 4ONEA 3VC7A 3RJ5A 3QY9A 2O50A 1DAOA 5F1PA 1D4FA 3LF1A 2V7PA 3GNQA 2NM0A 1VSVA 5AQ1A 4IMRA 2YYYA 1SCUA 3A4VA 2QRJA 1DC4A 3AY6A 2GCGA 2GSDA 4RVFA 3C8MA 2W2LA 2WD7B 3S2GA 2C29D 2J3KA 3V1TC 4TKMA 1GYRA 1XA0A 2G82A 1YBVA 4HWKA 1JVBA 4DIFA 4CQMD 4LCEA 2PZLA 2Z95A 2HDHA 3RKRA 3JQ7A 4BGVA 2I65A 3F1LA 4BNWA 4QXMA 4OSPA 2OL4A 1QLJA 2BGMA 3VTZA 1B0AA 4CMIB 1VKOA 1A71A 3MTJA 5ENVA 5DOZA 2EV9A 1RYDA 4HY3A 4D3FA 5CPBA 4KWHA 3DXFA 2VOEA 1XHLA 1UXJA 4ALJA 2P4HX 4H15A 4Z9XA 4BO0A 5JY6A 3G17A 1I32A 1JAYA 3PFWO 5CDGA 2FR8A 3AUSA 2JCYA 4UULA 1EBFA 4DPMA 5I8ZA 4XR9A 2FZWA 4DYVA 1B16A 4IINA 3ZH2A 4NBUA 4EGFA 4Z9YA 5AXDA 1KVTA 2Y0DA 3PWZA 3PHGA 2WSBA 3COSA 3G49A 1N9GA 1ZSVA 4PG4A 3KBOA 4PGFA 4KMSA 1UXKA 4GLOA 3U9LA 4BNIA 5B4VA 2ET6A 4CM4A 5G0VA 3CINA 1NTOA 3E1KA 1HF3A 5IZ4A 1G6KA 4J2HA 3WNVA 1GADO 2O3UA 4WPGA 3MJCA 1JW9B 2FN7A 3D3EA 4RZIA 4BB5A 1WXDA 4C7KA 1PGJA 2IRWA 5ITWA 3KSZO 3DZBA 1TT7A 1LC0A 2QYSA 4EI2A 3OA0A 2O2SA 4ZD6A 3V5NA 5EINA 3I6IA 3W4KA 1KY5A 1YRLA 2BFAA 3K5PA 3VPSA 4DLBA 1HZJA 5BNFA 1XELA 4J2OA 4D45A 1X0XA 5L7TA 1E7MA 4M55A 1YE3A 8LDHA 2VTEA 5FEUA 3GNSA 3U4HA 2BKAA 1FDUA 3O4RA 3OEYA 2O3SA 4WGGA 2DLDA 2IZ0A 3ZNQA 1ZH8A 5COQA 3WYEA 4CMGA 4CV2A 2NWQA 3AI3A 4AJOA 1G0OA 5C5IA 1E5QA 4I08A 3NDIA 3ZI0A 4CM5A 2NTJA 5JYAA 2WD8A 3CEAA 1RM5A 4PLHA 4JJFA 4ZQGA 1NX6A 2PV7A 4E3ZA 3TQHA 5DZSA 3VDRA 4R54A 1BHSA 4U5QA 1J4AA 4IIVA 3NEPX 3L4SO 3VH4A 3JD3A 1LDNA 4R5MA 3EZYA 1E92A 5LC1A 4XRGA 4LGVA 2FHSA 3TFOA 1LDBA 4N5LA 1PL8A 2UUOA 3LF2A 1YBAA 1FDTA 1ZMTA 1E3LA 1XR3A 4L4RA 4XYLA 1C1DB 1IYZA 2ZB8A 4OM8A 3O8QA 1Z74A 1YONA 1IZ0A 3DOOA 4FR5A 4AG3A 2OXIA 5CHEA 4CQMA 4DQVA 5B4TA 1MUUA 2ZYGA 4JP2A 2JFFA 1FDSA 4J7XA 3RVDA 3V2GA 1CIVA 4IBOA 4GH5A 3OQBA 1J6UA 4LSWA 4NFYA 3WGGA 4N5MA 2DAPA 3LT1A 3T7EA 1NQAO 3EVTA 5DULA 4C7JA 4CM7A 2Y1GA 1PJ4A 4RVDA 5CP8A 2I99A 1XWFA 1I2ZA 3E5RA 3DEYX 4OYRA 1DC5A 4CLHA 4DREA 2Q4BA 2PTGA 4MIYA 1P45A 4RQUA 1AXGA 1MC4A 4GMFA 1I3MA 1SPXA 3E03A 3C3XA 4X54A 3OBBA 1WLYA 4RJTA 3L07A 4FD3A 1ORRA 3FCOA 4JBGA 5IXSA 2AE1A 5AXCA 2HU2A 2P9CA 3WG9A 4BNYA 2YUTA 3PQEA 1U2GA 2DTXA 1ONOA 3KOUA 1L1FA 4E6PA 4HP8A 2BH9A 2H5LA 4HFRA 1Z82A 2GGSA 2JD0A 2D5AA 1DOHA 3BAZA 1PJBA 5IDXA 3CE6A 5TRTA 3WSWA 5L51A 1HYEA 1OFGA 3RUIA 4KZPA 3E9NA 2TMDA 2VQ3A 3M2TA 2NACA 1ZIDA 3QW2A 5TQVA 4NI5A 4RDHA 1LLDA 4M86A 3SC4A 2Z1NA 3RUCA 2O4UX 4BHTA 4XJTA 5T64A 2ZTMA 5IZCA 3PVZA 4OSOA 3PHIA 1EUDA 1ZO8A 3I52A 4Q3CA 3WJ7A 4YRAA 3DZJA 3O03A 4K6FA 2C0CA 4BNHA 1UDAA 1E3IA 1E5LA 1W0CA 1YJ8A 4BKRA 1NHGA 4E12A 4EJ6A 3GGOA 5JLAA 3WGHA 2EIHA 3O38A 4RO0A 2D1YA 2EGGA 4R16A 4Q9NA 5JYEA 2A92A 4RPGA 4I5GA 4ZA2A 2YJZA 4P8RA 2BHLA 4LSMA 2YHIA 3GNTA 3KEOA 1YS4A 1I01A 2GUGA 2JL1A 4XZ3A 4DL9A 4CQLB 2GZ1A 3TDKA 4XRRA 4PRKA 2W2LD 3A9WA 3ETEA 3H2ZA 5JPIA 1HDOA 2EW2A 1VJ1A 3TL3A 1A7KA 3NGXA 5I9LA 4FJ1A 3UW3A 2JFHA 4IXTA 2YV1A 4PG5A 3D5TA 4N18A 1VLLA 3E8XA 1EVYA 3PFFA 5DCWA 1ONNA 5T57A 5IDWA 1A72A 1P0CA 2JKVA 3ETDA 4TRJA 1Y8QA 3ETGA 3TSCA 3BMCA 3UAGA 2OGUA 2VHVA 3JD1A 3I9MA 1Y5RA 4DQXA 4E4YA 1A9YA 3SC6A 2G76A 2AHRA 4QSMA 2TMGA 3WMWA 3JQFC 4NZ9A 3A28A 3L9XA 4OGWA 4GX0A 5A4DA 4XYBA 3GG2A 4KQWA 5I7FA 1HTBA 2VYVA 2OZPA 1C14A 3ONEA 1BDMA 4NK5A 3QVTA 5T5QA 3N74A 1OZAA 2X23A 1HT0A 3HB4X 3AM4A 4NFSA 5DCYA 1R0SA 7MDHA 4TMFA 1BSVA 1M76A 4R01A 2EXXA 5DN9A 5JC8A 3HDYA 3KHUA 4EZBA 4ZN6A 5U9CA 3STHA 2AEFA 3RBXA 1O5IA 2C2XA 1A27A 2XXJA 4S1VA 1YVEI 2BFPA 3W4IA 2HMVA 4ID9A 4DA9A 1IHXA 1W73A 4YTEA 1SMKA 1C0KA 4Z6KA 1H6AA 3WOHA 1DRUA 3C85A 3GUYA 2WMDA 3B1FA 5A9SA 3ZWNA 4MKXA 4UVDA 4HKTA 1P1HA 4PLPA 3EHEA 1DFHA 3QWIA 3U62A 5KVQA 3OICA 2I67A 5A9SB 1TXGA 5DBFA 3WMXA 5JBIA 2BI8A 3OJ0A 3IQDB 2VRCA 4J1QA 1YB4A 2UUPA 2X0IA 4PLCA 1EUCA 2IE0A 1AXEA 2PKQP 3OHSX 4DWVA 5BT9A 3SJUA 1DB3A 2EW8A 1LDMA 3GVPA 1FDWA 1TT5B 4DBZA 2WWRA 4FFPA 4TZTA 2AA3A 4IDFA 5CDUA 4DVJA 4GMGA 2QW8A 4BNFA 1GR0A 4XYMA 1E3JA 3GVXA 3ZW9A 3JQGA 1GU7A 3U3XA 1IB6A 1VKNA 3ZU3A 4B8ZA 2VWHA 2V6GA 1LRJA 3I9OA 4ND2A 3INGA 2JAHA 1UDCA 4FSHA 1UZNA 4WLOA 3KYCB 2YQ5A 4YT5A 1E1MA 2VZ8A 4KQXA 3FHLA 3TWOA 4CMHA 3WNQA 4F6LA 1K6JA 4EYEA 3GN1A 1GUYA 3LC1O 3GGPA 5G2OA 5G4LA 4RVUA 3WQRA 4RORA 3GVCA 1YO6A 2BFOA 3RUHA 5L4SA 1T4BA 4J7CA 3ZU2A 4HNHA 1PIWA 5GMOA 1ZCJA 2RHRA 1D7OA 1D8AA 4NG5A 3UKOA 3ZNPA 1QYCA 1SB9A 4K26A 4YYZA 1PR9A 2CDCA 3PJFA 4MVJF 3EY4A 3PK0A 4GL4A 3B1KA 2AQKA 1ZW1A 5KOIA 4WEQA 2W8ZA 1B8UA 3RI3A 1H5QA 1EDOA 4RQTA 4B3HA 2BELA 3F6YA 4XIJA 4CUJA 2ZB3A 3DBVO 4U8GA 5TSDA 4B8WA 1EFKA 2DBZA 3P19A 1O94A 4R51A 5ENDA 5CPFA 1IUKA 3UGKA 2B5WA 2X5JO 1YH3A 2ZTVA 1IY8A 1VL0A 3VPGA 1O6ZA 4FB5A 3GF4A 1R16A 4UVIA 5KJCA 4YPOA 3WGQA 2BF7A 1WAMA 1EVJA 2G17A 3C1AA 3ZNNA 2VRBA 3MWEB 3W8DA 5IZCC 1ZEMA 2W98A 4H7PA 4HFNA 3CSDA 4WCDA 3TN7A 1DC6A 4PVCA 3PLNA 4INAA 1K5HA 3WTCA 3WWYA 4TSKA 2HSDA 1H6DA 1XU7A 3C7DB 5KNLA 1QMGA 2IZZA 1UXIA 4TVBA 4U0KA 2QQ5A 5HRUA 3TRIA 3RUFA 1K3TA 2OORA 4J9VA 4MDHA 3PYMA 5KJ6A 2Y1CA 1KEUA 3OH8A 4AJLA 2AG5A 1C0IA 4UVGA 3BZUA 4Y6RA 1PS0A 1YBMA 2IYOA 3ASUA 4GKBA 4CMAA 3DFZA 2QYTA 5U4QA 1PWZA 4FIZA 1IL0A 4M1QA 5H83A 5A1TA 3VPHA 4ZJUA 4CM9A 3PHLA 4BMVA 3VTFA 1QV7A 4DLAA 4KUGA 1GFSA 2JFGA 3W4JA 5L45A 4RGBA 3VOSA 1BMDA 1D1TA 3DZGA 5JAZA 1PQPA 4YT8A 1U2DA 4R9SA 2YDYA 4XIYA 3AM5A 2RH8A 2Q1UA 4JCOA 1GDHA 3HDJA 2GR9A 4NJOA 4DPKA 1ISMA 4PLVA 4TVOA 3ROQA 1C1XA 2FPIA 3IMFA 3HN2A 1EVIA 3TNLA 1NXQA 2FZEA 5T67A 1UZMA 4NBVA 1QSGA 4RPHA 2XAAA 2CF6A 2GN4A 4UUNA 4GX1A 2PNFA 5LDGA 3WS7A 4KUHA 2ZJ1A 4G65A 2RAFA 4QFDA 1RKXA 1PQWA 1UAYA 3NDJA 1ISIA 4R68A 3WTBA 3ZHYA 2VHZA 1GQYA 2HCTA 4YQZA 4MIEA 1JN0A 4D79A 1LBEA 3EUWA 4KTVE 1YL5A 4QFCA 2Y1FA 3H9QA 1WPQA 3OFSA 1ZSNA 3ICCA 4XA8A 2H1SA 3ZWAA 4IDBA 4TRRA 3KEQA 3S8MA 3QLJA 2O7QA 4YAKA 2JCVA 4WOJA 3O8QB 1JAXA 1J0XO 4DC0A 1C1DA 1RYEA 1VC2A 4GX2A 3S2FA 1YGYA 3HDHA 4RF4A 1NQTA 1GCOA 1RJWA 2H63A 3V1UA 1NR1A 1IOLA 2ZCUA 4FPXA 1ID1A 2HMTA 3M1LA 4Z3DA 4PIVA 4J3FA 3PLRA 4J1NA 2DBRA 3U5TA 4N7RA 1CWUA 5KIAA 2Q1SA 2NU9A 4IQ0A 3RC1A 2A4KA 1MFPA 4RVSA 4UVHA 2GDZA 1UZLA 3H9UA 2B36A 2C07A 1I10A 1CQJA 3KYCA 1O95A 3U49A 1PGOA 4OH1A 1GTMA 4G2NA 4ZU3A 4TZKA 3DMTA 4PVDA 2FPGA 3I9KA 1EMDA 4ND3A 2CD9A 4BO7A 5IN4A 1PJLA 1GEEA 3AFMA 1ENYA 3T4EA 2WD7A 3HWRA 3JTMA 4R1NA 4BNUA 4ZQFA 3NGLA 5FFFA 4NR0A 4BMNA 4ZICA 4NHEA 1X7GA 4N5NA 2WJPA 2QRLA 5G0TA 3G1UA 1PGQA 2EKPA 4NK4A 1N9GB 1UJMA 4GLLA 4F45A 4YR9A 5L7YA 3ZZNA 4BNNA 3RJ9A 3JQFA 3LLVA 3GZNB 3GFGA 5AXAA 4H3VA 3IJRA 3UCXA 3GEDA 2O3QA 4WLUA 2VUTA 4U6QA 5HWSA 2Y67A 1LXCA 4J4TA 1H94A 1ML3A 3NTQA 1TA4A 5DBIA 3JQAA 1KC3A 1QV6A 3BIOA 4EEXA 4ZQBA 1R37A 5U1PA 1H93A 2DFDA 1BW9B 2Q2QA 1NPTO 3H3FA 1DIAA 4M8SA 5ILGA 3V8BA 5A3JA 5L4LA 1SOWA 4CM1A 1TI7A 3LYLA 5LDHA 1ZSYA 5J9GA 4JP3A 4MOWA 4B3IA 5GZ3A 3L6DA 3EZLA 1MC5A 3WGZA 5HM8A 2CVZA 2PY6A 3JYLA 2PD4A 1WMBA 3H4VA 1AGNA 5CG1A 4YWJA 3BHMA 2YQ4A 1GQQA 4MP6A 5JCJA 2VYNA 2QZ9A 2PH3A 1XEAA 4CUZA 3SLGA 1H9BA 1U8FO 3BA1A 3CZRA 3AUTA 4KWIA 4S3MA 1E6UA 2EKLA 4E5MA 3GRPA 1MB4A 3S2IA 1XKQA 5A9TA 4W9NA 3PEFA 1NNUA 4KP7A 1Y8RA 3QVSA 2O3RA 1KEPA 4BKQA 4CR7A 5KVSA 3JD4A 3DTTA 4A5OA 2Y1OA 3PYXA 4RCVA 3KYDA 3FR7A 1KC1A 4R1TA 4BNJA 1Z6ZA 4WOKA 3H9JA 4ZVVA 3PZBA 1F14A 3H5AA 3ICPA 3ZGYA 2Q99A 4NFHA 2F1KA 3TOZA 2YFHA 1I36A 5EMHA 3IS3A 3DO5A 3CMMA 3RUEA 2OFPA 5JYDA 3DR3A 4R69A 1NFRA 4L8VA 1E3EA 1E7QA 3RASA 1DJQA 2HLPA 4IJVA 1UP4A 4WJZA 1PR3A 2VUSA 3RC9A 1BWSA 4JBHA 4DBVO 2ZTLA 4YAEA 3VKUA 1C3VA 1A4IA 1R0KA 1KBZA 1U7TA 2D0IA 3UUWA 1BVUA 2V65A 4CL3A 2A94A 5I7VA 4DMMA 3W8FA 4NQZA 3IL2A 3NAQA 4JXKA 1ADFA 3FWZA 1SO8A 1NQ5A 1HDRA 3ZWCA 5DBGA 5JDCA 3GUCA 3ENNA 3H6KA 1AHIA 4IJUA 3L6OO 2AXQA 3O9ZA 2GN8A 4OXNA 2X0JA 2E6UX 3INRA 1BG6A 1DIBA 4AL4A 2H6EA 3AFNA 3EMKA 1B2LA 3I3OA 1GY8A 4D0RA 5JW6A 4E5NA 4TKLA 2DKNA 4E31A 4NU5A 4OOFA 3RSHA 5CFZA 4DTIA 1YB5A 4OXKA 3MCVA 2POQX 4R41A 5A06A 3GG9A 4YACA 1X7DA 4O0LA 5C7IO 4XQGA 3FI9A 3PHJA 1ENPA 4AJ1A 3IUSA 3E48A 1HLPA 4BS9A 1LSJA 3I5MA 4MVJG 2OBYA 2PFGA 3F3SA 1GUFA 3EK2A 1TEHA 5IG2A 2Q50A 4I9NA 4Y67A 1M67A 3JQEA 2PZMA 1JTVA 1Q2XA 4F3YA 1SNYA 1NYTA 3VZPA 1TT5A 4AICA 1UAGA 3WWZA 4QEDA 3EDMA 2C20A 1HE2A 1R4NA 1T26A 3EC7A 1HDXA 4EBFA 4CM8A 4PZEA 3ORFA 3K31A 3W6ZA 1NFFA 1CEQA 3VH2A 4F46A 3DHNA 5M6DA 4XKJA 4RL6A 3PJGA 1P44A 1A4UA 1Q7CA 3FD8A 3RCBA 4FQ8A 3Q0EA 4BO9A 2PZKA 3VZSA 1BXKA 5KJFA 3GPDG 3G3EA 4BKUA 1LI4A 4GKVA 2IZ1A 2X9VA 4RPKA 5IDYA 3P2YA 2QRKA 4AFNA 3BHJA 4E32A 2B0JA 3Q9NA 1U28A 4LW8A 3FRJA 1LQTA 3RFVA 5IN5A 3QVOA 4XGNA 2WE7A 2HK7A 1Z7BA 3AI2A 3E5MA 5F1OA 2X6TA 1EQ2A 3MJSA 1QORA 4OMUA 5BSFA 5JNLA 4YXFA 4ALLA 2GD1O 2IEDA 2VT2A 5KKAA 3AOGA 4I9UA 1ZVMA 1DSSG 3MOIA 3PQDA 3GC6A 3ZWWA 1Y9EA 5H81A 5KWEA 4FS3A 4YJFB 1NVMB 4XR4A 2Q1WA 1M2WA 2YZ7A 4CM8B 3OSUA 3H9GA 3CH6A 5L7WA 1N8KA 2J3JA 4XGKA 1PJCA 2Y93A 3FNEA 2P5YA 4JNKA 4YVFA 3NTRA 4MVJH 4R1UA 4NJMA 2ZCVA 3KYDB 1DC3A 2LDBA 3ZV5A 5L3ZA 3R1IA 4CL8A 3GHHA 3PI7A 4FGWA 1CETA 4U7WA 1KS9A 3IIEA 4BO6A 3UICA 1V6AA 1SEVA 4PG8A 3DBRA 4FFOA 2HQ1A 4O1MA 1PGNA 3GRKA 4O5OA 5G0UA 3JV7A 4CMBA 3Q3CA 1GV0A 2Y99A 2C7GA 1QR6A 4J7UA 3PPIA 5AXBA 4IXWA 4LRTB 1A9ZA 1PX0A 5TX7A 4RVHA 2WE8A 5B4UA 3QWFA 5FWNA 1AN9A 4AJNA 3CMCO 3SEFA 4IS3A 3DZHA 4HNGA 1SAYA 1R12A 4OXYA 1HDGO 4MO2A 1V3VA 4ZQEA 3PYLA 3H2SA 3WSVA 3K96A 4FC6A 1J49A 4L74A 3F4BA 4II3A 3UF0A 2I9PA 5B12A 5JCJD 3PP8A 5BR7A 3S1LA 3FPCA 3DTYA 1WW8A 5ITVA 1OMOA 2FOIA 4Q3AA 1JVSA 4JJGA 3DAGA 3HFSA 4MPDA 1JWBB 1T25A 3AU8A 5FI3A 4OKNA 5CG2A 4E13A 4HFJA 3ZWXA 2Q4EA 1U5CA 1ZXLA 3ITDA 1W8DA 5EPOA 1GZ4A 1EQUA 2J3IA 3D3WB 2O3JA 3T7CA 3UHAA 1BXGA 2C2YA 2DUUA 1U4SA 2B4TO 4MIOA 3JSAA 4XB1A 1DLIA 1PZGA 1LLUA 1E3WA 2NU8A 4Y6PA 1ZK0A 4YRDA 4CUKA 1U3UA 1LDEA 4I5FA 2JD2A 3GT0A 5ER6A 4BNKA 4PCVA 5FYDA 2V6BA 1NWHA 1IULA 4YCAA 4I5EA 4KOAA 1DPGA 2C54A 3QJ5A 3GLQA 1P9LA 2NLOA 1R66A 2X5OA 1OI7A 1Q0QA 3ON5A 3M6IA 3GGGA 2I6TA 3PQFA 1KYQA 4BL5A 1QYDA 1I2BA 3OP4A 3WQQA 2OP1A 2VHXA 3K92A 3W8EA 2Q3EA 4MVJD 1HSZA 2ZYAA 4RVGA 3KV3O 2J8ZA 4IQGA 2YY7A 3FN4A 3HZZA 4A26A 4BQRA 4Q39A 3ANMA 1H9AA 3CPSA 2BFMA 4GGPA 1O8CA 4IGEA 4Y98A 5ES3A 3JCZA 1W6UA 1C1XB 2X7HA 3D64A 4GX5A 2V6FA 4GVLA 3GN2A 1Y5MA 1ENZA 4L9RA 4D42A 4PLGA 5LCXA 2Q45A 4J9UE 2AE2A 1GAEO 2OP0A 1I8TA 1PWXA 5KCZA 3K30A 9LDBA 1UP7A 3BTOA 2RH4A 1X1TA 2EJVA 3EGOA 3PGJA 1Y9AA 3GZ4A 3RIHA 3HFGA 4LCJA 5ICSA 2EKQA 3WLEA 2I5PO 4R9RA 2IYPA 4CLDA 2Y0EA 1EK5A 1HEUA 2ZTUA 1ISJA 4WCFC 2E48A 4YA6A 4LMPA 4A03A 3IUPA 3W1VA 3F9IA 1Y1PA 3JQ7B 1I3NA 4H16A 5FI5A 5BSHA 1GUZA 4Z0PA 3IKTA 1LQUA 4FFNA 1LDGA 2NVUB 4UUOA 3Q6IA 1NPYA 1NVTA 1NVGA 3LC7O 4XQEA 2W2KA 2Z1MA 2D8AA 2WDZA 3ROKA 2PGDA 1HDYA 2P2SA 4LK3A 1TLTA 2NV6A 1YXMA 2VUUA 3DBLB 4WLEA 1GZ6A 3ANNA 3FBGA 4NNJA 4RPLA 5THQA 4DYDA 5BQFA 1TVEA 5G0WA 4CV1A 4XYGA 1ZK3A 5H82A 3DBLA 3C7CB 4YJGA 1BRMA 3H5NA 5F3RA 3U4IA 3JQBA 3V2UA 2BI7A 3GH3A 2EJWA 5CEFA 3JQCA 3LSYA 4XDYA 3FTPA 4YJFA 4J90A 4NDNE 4BO3A 4BVAA 4ALMA 5A04A 1VL6A 2EHDA 3PGXA 4B7CA 5G4KA 4GI2A 4E2ZA 3BMNB 1ZFNA 2X0NA 1NBOA 2P4QA 3UFXA 4JROA 3B6ZA 2VZ0A 2VZ9A 3DHYA 4MINA 4NU6A 1E1LA 1B7GO 1HDZA 3DOJA 3NDRA 1Y6JA 1Y81A 1KERA 4F6CA 2VYVD 3WYBA 4IMPA 4CLEA 1ISHA 5TT1A 1ULUA 3PXXA 5TJHA 1VJTA 3WX0A 5CEEA 4WE3A 3ST7A 5JO9A 3D4PA 3TF5A 4J6FA 3K2EA 3EYWA 1HWYA 1M66A 3Q1LA 5L53A 4WCFA 4ND4A
chains in the Genus database with same CATH superfamily
3PUIA 3KKQA 3EA4A 4LRUA 1Y9ZA 4DIBA 1ZOOA 2ATXA 3SS9X 3R7FA 2OMEA 3D02A 3NWBA 4AVYA 3I4FA 1K66A 1TM2A 2JK1A 3IJ5A 5TMBA 3RABA 3AZOA 3KETA 3ZTWA 3JS5A 4HWRA 3HKCB 3WBFA 3KYIB 2FSIA 4M1ZA 2REOA 4U0JA 3U4DA 3K9FC 3L0OA 1VJ0A 4TS4A 4CKCA 3B3GA 1XWIA 3PC6A 3V8MA 1MOQA 3QPBA 3TXXA 1T15A 2Q0SA 1LK0A 3GLVA 3CKLA 4ZTUB 1XUOA 4DUZB 3TMKA 3SKVA 5L95A 4RADA 2WU3A 4Y2QA 2BTQA 1BX1A 4JC4A 3B5JA 3SJBA 3VNBA 1BDBA 5IYZA 1D0IA 1MG5A 1RAFA 1T2VA 3ME5A 1EGQA 1LNQA 2FG7C 2KLHA 3OLVA 5JZVA 2UYQA 1E89A 2NZXA 4Y1GA 1ZN8A 1QO7A 3TSOA 2I7VA 4Q16A 3P7MA 2H4YA 3QFRA 4BP3A 1F48A 3M6UA 1H6CA 1FF9A 1E2GA 4WNAA 2G28A 2PGIA 4PZ0A 2H8GA 4ISCA 3PGA1 4WL0A 1Y42X 1ZZGA 4QPPA 4OY3A 2PX3A 4WGFA 4IRUB 2QV7A 1KQFA 1A2QA 3U16A 3P96A 1G9SA 3IDFA 2Z43A 4FFVA 4HAWA 5AKZA 2IF0A 4EEZA 4K40A 5LBIA 2G70A 3DE3X 5HFJA 1K08A 4IYRA 1FMFA 3ZIUA 1CS0B 2I54A 1CFZA 4G25A 4O4JA 1ZJZA 1QGZA 4XB6B 3TPCA 5A2GA 2MYTA 2WJGA 1GSIA 3CJRA 1WZIA 4UDYX 4JS0A 4LMRA 3C5WP 4P7FA 1QU2A 3MJ4A 4XPIA 1B8VA 1IHPA 5BSGA 4AJ2A 3OQIA 1DEHA 4JZYA 1GP2A 2XUJA 4FBMA 4XARA 3NT2A 3G88A 2XMPA 5M34A 3OX4A 1BDHA 1R8YA 1JA0A 1SELA 3FWPA 1FU7A 4R7TA 4AYWA 2CLIB 4CCWA 4QNNA 4DLZA 3AL0C 2J6BA 3ETNA 2H4FA 1WDTA 2QT9A 4TL8A 2BDUA 4TRNA 1AMUA 1GITA 3EC1A 3FAKA 3SJ7A 3GT7A 1T3ZA 2C04A 1MO3A 1JR3D 5KYVA 4R5HA 4HAYA 1MXFA 1ZBQA 2VDWA 2LIVA 2DY0A 2F64A 5E9QA 3KVNA 1H69A 5LZ5A 3RQSA 4IRXA 4U5XA 1XRNA 4H9GA 3ZGOA 5KU7A 2QRMA 1TKCA 2P9GA 3QV2A 1EIWA 4D3YA 1CF2O 4GR9A 4KXUA 4OYLA 5DBEX 4QWWA 3FSEA 3CRNA 3TQSA 2I66A 3B9QA 2PYDA 4JBWA 5AW1A 3EQ6A 2XE7A 5LYJA 3L7JA 4X90A 1RP7A 3BCRA 1S8AA 2CHVA 2JATA 1YQUA 2QL6A 1XXLA 1S9HA 1J2JA 2DECA 3GLHA 4KIWA 3VKWA 1AURA 2OHHA 3IO3A 4XW2A 4DSNA 2WKQA 3LT0A 4XVCA 3PWTA 1T2NA 5LYJB 1QOPB 1DINA 2GZAA 2DRIA 3MS2A 4WV3A 3JYPA 1AKYA 5KTNA 1Z6YA 1N8SA 3WJAA 1HUQA 3IP3A 2NSHA 4Z7JA 1XPRA 5DOVA 3WGLA 4BNZA 1TTPB 1VXRA 2QPTA 3JSXA 3K1AB 5GJCA 4BBPA 5GZ6A 3K0AA 5F5LA 4DQLA 4AMVA 3KSUA 1PYGA 4CG3A 5H9WA 8OHMA 1I2DA 2FMKA 5NLLA 4NARA 1JG7A 2KM1A 4KFCA 4NXMB 1QU3A 1H2WA 2IJGX 3X2EA 2QJRA 1IBMB 4XEHA 3H1GA 1EX7A 3ZY2A 2TYSB 3MWJA 1LWOA 4R81A 2QX7A 2AV6A 4W5HA 2ODEA 2FQQA 2NO7A 4WK0B 1DG1G 2AMLA 6Q21A 5C5CA 2BRUC 4DJ5X 2ENUA 3MCWA 1T9GR 3PTZA 5ARDA 4N6NA 3C98A 3G6WA 4B4UA 2AQIA 1T3LA 2OV8A 4Q7JB 3BDVA 1VKHA 2OBFA 1VSBA 4ZOAA 3DZ2B 1KJQA 1KYZA 5AK3A 5CAEA 3PHBE 3B51X 3LW7A 2C61A 1TGYA 4BLRA 2I87A 4Y0VA 4EDFA 3WXBA 1V9LA 2K87A 3GJ7A 4FC7A 3RFXA 1C4XA 2PRJA 3NIGB 3I53A 3VU9B 2ZJ8A 2Y1DA 4CG2A 3ZVMA 5T6BA 5BV8A 3V7NA 2EKZA 5FAKA 1VL2A 3F78A 2M98A 4WNIA 421PA 1BXRA 2P9JA 1RHJA 1N2IA 4PO3X 3BFJA 4X66B 3DMTC 1BYIA 1QDUA 4B79A 4HL6A 2OO7A 4NY1A 1JG2A 3C24A 5J63A 5ITZA 4OHKA 4ALNA 2NXNA 3DKVA 1L7RA 3R44A 2DFVA 3GCWA 5B6PA 2O8DB 2FP4A 2UV8A 1K0FA 5GPBA 4WERA 2B69A 1Q1NA 3E2IA 5DF1A 3ZGVA 3DLPX 2W4MA 1MW8X 1X0VA 2OT3B 3GYGA 4URXR 1PVOA 4UQLA 3JAWB 4IDHA 2O54A 2J6HA 1U4OA 1JBEA 2FFQA 1OV6A 3D8HA 3QPAA 4QVIA 2XCSB 3EHDA 4CLOB 3QBTA 1MLDA 3QWHA 1ABFA 2JFPA 1NRIA 3A1CA 3DCYA 3UMSA 1J2YA 5AVOA 2YHAA 2O2XA 2Y05A 1J20A 3KFLA 5SZKB 2MWMA 2QIPA 4GBJA 4QECA 3ZCXA 2WC1A 2AFIB 1BGXT 3TEJA 4RA9A 1W5FA 1YOVB 2FHPA 5TVOB 4US2R 2XDWA 5JRDS 3MLEA 2D5LA 3H5LA 2GKOA 1VPWA 3R6WA 4IH1A 2HIHA 2CD7A 4GLFA 3EXHA 1NOIA 1WL8A 2BVNA 2ZJOA 3NOOA 2C3MA 3PQVA 2O2CA 2Y71A 2WTBA 1PQ4A 1P3JA 1FYVA 2WHXA 4H1HA 5HE8A 5HF6A 4LPKA 5GJVC 3PQ3A 3EG9B 4M53A 2ODWA 3A1DA 5DHPA 3AP3A 1N6LA 3DONA 2G04A 1FEZA 2BMEA 4G5YA 2CLMB 5EXSA 4AKTA 4EABA 3W2TA 3RNOA 4G24A 2IH4A 4PZCA 3L77A 1E1CB 1Q7RA 1OFUX 3MJEA 4OA8A 1U5AA 5I7HA 5K3AA 1UC9A 2G9RA 2QQEA 2XUAA 5C3UA 1TO6A 1C9EA 4NQRA 1KEEB 3OQMA 3QU9A 1KIAA 4UDNA 1NQVA 1DJNA 1RLJA 3KEGA 3LI2A 3T8YA 3COYA 1OLOA 2E37A 5JNTA 4CDRA 2F6RA 1JWAB 3RVRA 3HDQA 4DV4B 1WV0A 4II2A 5TPZA 5JXWA 2N3ZA 2CNWA 1WDMA 5CD1A 2A84A 4YHBA 3PFHA 3IBYA 2V4ZA 1RJ9B 2W2OA 3UJDA 4Z4CA 5P21A 1KFBB 5BN5B 2E7ZA 2ZVQX 3I92A 3V4FA 4AMUA 2AW5A 1E2FA 3I9LA 1KAOA 3W9BA 2JHCA 4HNSA 4EATA 1EAYA 2W4QA 4FGZA 4GPZA 3PIDA 4HVAA 4ZT2A 5CNKA 1VECA 3ZR4B 3TXYA 2WZQA 4TV8B 4Z5XA 5JPDA 1T6NA 3N9IA 3G2OA 1RJFA 2D7CA 2FRDA 4NJEB 1T5BA 2IXGA 2IUFA 1N3BA 4UU1A 1UANA 2XD4A 4L02A 4BNTA 3STWA 5KTSA 1AK9A 4JGGA 3VMFA 1P4RA 2XYPA 1E2BA 3RHZA 5F2KA 1UFVA 3TZ6A 4RFSB 1PP4A 3WL7A 2R66A 5TPWB 3TKAA 1JHDA 2PKCA 4B6EA 4BP8A 1HETA 4KYTA 2GF2A 3F5QA 4QELA 1H2EA 3Q1KA 4GRAA 3JQ9C 1MIHA 3KTDA 4TM8A 3R9XB 4NCJA 3DZKA 3VYTB 2GEVA 3WLHA 5BR4A 3RYFB 1F8FA 1DGQA 2CDBA 2CLSA 4BAUA 2ODNA 4PZ9A 1JHXA 4E2FA 3RTDA 3NKVA 1XL1A 1QIFA 3OT4A 3BMCB 3GMIA 3C6YA 1YDMA 1XGKA 4WLFA 3ET5A 1R88A 2XBLA 3DF7A 2BUCA 2W70A 1U0OC 1ORTA 2FR8C 4QYSA 4UEKA 1GPJA 3RC2A 3UZUA 4L2IA 3IIKA 4P33A 1YJQA 1MBZA 4ITUA 5DGIA 2I3ZA 1HO3A 1IXSB 1R0BA 1YR9A 1ZKMA 2QW1A 3C1OA 4ZGWA 1Q7GA 1CRLA 2B4YA 4HNRA 4B2YA 1OLUA 3Q12A 4ESOA 1K6EA 1MNAA 4LTDA 3PJDA 3U3OA 4R3WA 2P9FA 4GM0A 3OLZA 3ZU5A 2KBEA 3IOEA 1OCEA 4CKBA 1IBRA 4WNAB 5F2NA 1NVBA 5HNKA 3ENQA 1UQUA 3OJLA 2P30A 1BKDR 4KTTE 1PSDA 5J4VA 3PEEA 4MUXA 2H0RA 2WU0A 5A05A 4UKDA 4Z9FA 4CF4A 1TPZA 1M8PA 1Y8AA 5TB5A 3ZV4A 4D8TA 3P9KA 4KJXA 5FUQA 1NDUA 5LNK1 1NUQA 2F67A 2EGHA 3K0CA 4Q21A 5DRYA 1Z4NA 4YDRA 2Q5IA 4XDZA 4EJ0A 1E7RA 1GNTA 3K15A 2QLNA 3L7IA 2DVMA 3REFA 1VBFA 2O2IA 1T3TA 2BHRA 3C1TA 1F6BA 2GRJA 4XCVA 1CR6A 1ND5A 1GM5A 4OB8A 1R4MB 4CKWA 2I3BA 1U3TA 4ARBA 1EDDA 3MJDA 4FT2A 3N5KA 5JI2E 4BTVA 2MSNA 1FNSA 1GLGA 3GVIA 4QUAA 3WFJA 3SEAA 3I23A 1KMCA 1K1EA 2CY0A 2E87A 3SDBA 4QOEA 1FMCA 3LLCA 4G41A 3NV7A 3DA8A 5A71A 4RKEA 1V8ZA 4KHZA 2VJLA 4MV4A 3VZQA 4HNUA 5I7EA 2EDCA 2HK6A 3PRHA 5JJ5A 3ZD7A 3UATA 1EP3B 3JQBC 4MWEA 4MV7A 3DAPA 1SKYB 3ZJYA 4EYGA 1MOSA 1QKIA 5DNUA 2PH5A 1TZ2A 4WESA 3RLFA 2W6MA 1TFUA 1TPYA 4UE3S 4XWTA 3SAJA 2G4CA 2VCYA 3CF4G 4G9BA 5FUBA 3VISA 2AB0A 3DXXA 2VF8A 3NUQA 3DTNA 4HLUC 1H5UA 4TMWA 2WSMA 5F35A 4ZI2A 4HDSB 3OIFA 4IPTA 4FYYA 5BOSA 1OBOA 2P67A 1KS2A 1Y98A 2MIIA 2GZMA 2O07A 4Y6SA 4EYSA 1GGJA 4WWHA 2VHJA 1V8FA 1ZRSA 2IZ7A 4AJKA 5K4GA 4S2EA 3CR7A 5JJKA 4ITVA 3MB8A 7ADHA 4S2UA 2DJIA 3FG9A 2J4DA 3BWXA 2UVPA 3MUFA 1Y8QB 5E1DA 3V80A 3WQSB 1U0EA 1SC6A 1Q0SA 5DGTA 1TADA 5BY2A 3EIQA 2B78A 4P22A 4X1YB 2X8LA 3KKOA 4ZOBA 1YU6A 4FDAA 3NTOA 1E4EB 1E7SA 4WFIA 1FJGB 3HRKA 1VPTA 3I83A 1UXGA 1YGPA 4FMBB 4D80A 5MF6A 4PHTA 2NZVG 4X1YA 5C8DA 1JMYA 2G6TA 4KFRA 3GLHB 4J7AA 4XJSA 1Y3HA 5ALTA 2V8OA 3AF0A 4MJXA 1GVNB 4IX1A 2BMDA 4MW6A 4OGFA 5EJAA 3DPUA 3WGIA 3G0HA 3HVIA 4YAFA 3O7MA 2EDAA 2JI7A 3AI1A 3MIIA 3MGBA 4A91A 2XCRB 4P80A 1R8XA 4D96A 2WKPA 4K2AA 1ZHHA 2XTZA 4YAOA 4D8VA 2EFJA 4KITB 2W00A 4UDOA 5HRAA 1JX6A 1JIJA 4MITA 1NJ5A 2A9KA 1GGKA 1WXFA 4NYMR 5HS4A 1PFGA 3GGJA 1GUAA 1RYFA 3C16C 2VNJA 3KSBC 2XMBA 3INTA 3H5IA 1PLJA 3TD2A 3L4BA 1Q22A 1F2VA 1Y34E 1WW3A 3OSZA 4PTYA 1T2EA 2Z5LA 1SQ5A 3KEMA 3DVAA 3L9WA 3NHFA 1EIZA 1KBOA 2RJNA 4LUCA 1B3RA 4KO1S 1RR6A 4QPNA 3ESXA 3K9HA 1YJAA 4GGMX 1DFIA 2F48A 3EXIB 2C8KA 1XNQB 1HE4A 2F7SA 5MFZA 3VDQA 4W9NC 1VI2A 3ONFA 1PT8A 1GO2A 2IYWA 3L0BA 3SXUA 1YCHA 3QIAA 1CUVA 2H9IA 1OLSA 1Q1EA 1A9PA 2GASA 1L4GA 2LGJA 3NJ8A 3DT8A 2G09A 4L7VA 5CDSA 1AMNA 3HXMA 2Q21A 1LRLA 1PNOA 3JASB 4RSGA 4FB4A 5J4HA 5CFLA 1B8NA 1PUIA 1Z7YA 3RU9A 1QTQA 2E4AA 2NTNA 4F5ZA 2NTVA 3VO1A 4FGUA 3RH0A 1V7QA 4LNHA 4TUYF 1FJ2A 1BVYF 5CA1A 5EJEA 4ZCRA 1WKVA 1CUFA 3HP4A 5BUZA 2BEKA 3L7KA 5AUOB 3ZWYA 4DY6A 3HBJA 1NL3A 1SQFA 4P81A 1QG2A 2BTEA 5JZMA 3HZOA 3LKVA 5EQJB 3DQQA 1G0NA 1UBNA 2XDQB 4JEUA 2PL1A 1D6SA 5AW5A 1JU3A 1AQJA 2VJYA 1H2RS 2A6PA 5LMCA 3AUXA 3KB6A 1IG0A 1YZFA 1RC0A 4PG7A 3NBZC 1MAHA 4MRAA 3OCJA 1CJTC 3E84A 5JMPA 5SYNA 7REQA 3HS3A 2MSKA 4E5KA 3T41A 3KKEA 1DJOA 1MJNA 1Z2CA 4UU8A 3IQZA 3N2LA 3G2QA 3RS8A 4FOLA 1L4FA 1WULS 1ST2A 3AR3A 5J2UA 1GPWB 4ENVA 3F46A 5IYZB 4G5XA 3BKWA 3K5HA 3KXIA 4C4YA 3HJBA 3HCDA 4W6ZA 2PLAA 2EF0A 1NQXA 4L2IB 4LF6B 4UCFA 1Q20A 2BR5A 3UB3A 1N7JA 3GEEA 3OOSA 3PR3A 3ZTYA 4QGAA 4ED9A 2CFOA 2YC4C 3E27A 5F7ZA 1WMFA 4CIAA 1D04A 3QKTA 1F1JA 1NBHA 2CNWD 1VE3A 4F3RA 1WQ3A 2OG2A 3O8RA 1KIFA 2GN9A 1Z39A 3CRMA 4A16A 1RPJA 1RYYA 4NV0A 1RCFA 1UPUA 1XCJA 2XMQA 4Q01A 4YJGB 5A02A 5IAEA 4CU2A 5JQWA 2A59A 4JYAB 5DX8A 4R0NA 3NM4A 1ETHA 4Z86A 4GDMA 4NZMA 1EXMA 1II8B 4P54A 5F4BA 5KI6A 1CCWA 1SKYE 1VMIA 1TCVA 1XQYA 2Z09A 4QG7A 3TR6A 1HE5A 3WFIA 2CBZA 2ABWA 1CERA 1J90A 1JNXX 1Q12A 2CMHA 5KQSA 5B2FA 5HS6A 1BGVA 1XJ0A 1G5RA 2C9YA 2PK3A 2ZB7A 3R2JA 1H6BA 2YWBA 1JPUA 1N3YA 3JPWA 4J1SA 4L5JA 4PLTA 3HCPA 4NE7A 4YMIA 3RAGA 2QTCA 3ISVA 3GMDA 4CQJA 4Y3UA 3FLBA 3JYQA 1J0CA 1SCIA 5B3KA 1G4AE 5KNBA 2M6RA 5JDIA 3CG4A 1KMHB 1PL7A 3OOEA 5BOVA 4QG3A 4BJHB 5CCDA 1SHJA 3WYDA 3ZLTA 3RKUA 3W3AD 3W6UA 4A10A 5BORA 3NUGA 3I1JA 4AYXA 2NMVA 3HNRA 4AS3A 3FNHA 3H0VB 2AOTB 1X8KA 3E4DA 3VSBA 1Q7BA 3IQEA 2QG4A 2Z8ZA 2ZRKA 1R0CA 3DZ3B 1G3QA 5IVPA 4DM7A 1ZNQO 1HKUA 4KZKA 4YRLA 3W04A 3AO0B 1U8AA 4MV1A 4BWVA 4FWBA 1GTG1 2PKEA 5HOEA 4L9AA 3SS7X 2FSSA 1XYGA 1T4CA 4BE7B 1DEOA 1YS2X 4V3CA 4WKBA 1I5RA 1NAIA 3OZDA 1S2MA 2IW1A 4PRLA 2VDRB 1L7DA 4Y8VA 3QLVA 1QM5A 4XJVA 1TQ4A 5F9FA 1DZ3A 2Y1KA 1Z3CA 2V0CA 4X3PA 3WAKA 4JL6A 4U2DA 3KQQA 5DLYA 2QDXA 4KR0A 1Z22A 4NYIQ 1KDYA 4LRSB 2CFTA 3M6AA 4KQCA 1DUSA 4ZT4A 3TCKA 5LZ2A 4CT4B 1RCTE 3K0SA 1H85A 3Q2IA 1NQUA 4M1SA 4TL9A 4WZZA 4OOEA 1T34A 4X60A 4Y2UA 2Q29A 3QEMA 1TUGA 4EQZA 2ONCA 4UUBA 4UUAA 5CH3A 2QNIA 2IC5A 3HGTA 2DE0X 3MWDB 1FB5A 1WB4A 1WM1A 1LWNA 1N8NA 3OT5A 4MYRA 4WXHA 1K7XB 1K7YA 3MMZA 1A88A 3E2PA 1TC2A 5DFAA 3VR6A 3MA0A 1HOTA 2PS1A 2VSFA 1ONSA 4HLNA 1C7JA 3JALB 5LPNA 2IHVA 4LXXA 4QBFA 2WYVA 4H7HA 3MHTA 1O0SA 2XA1A 2Y6VA 1F8GA 2IQIA 4OHCA 3PE4A 5ELXA 2K6GA 4ENUA 5JS1A 1XO1A 2YZKA 3J7TA 4D81A 4BXOB 3NCTA 3V3TA 4DSTA 1SKMA 4WCVA 4AF8A 4KJZA 1W4AA 3FDJA 2YNMC 3LDGA 2PUAA 1AUPA 1BCRB 3LDAA 2FFHA 2Z08A 3H16A 2AFHE 2CHUA 5AYVA 1NAHA 1CJCA 1E6LA 1PFWA 2Q4TA 3AU9A 4J8PA 5EOVA 2AUMA 3DL2A 1NULA 4O2LA 2O0MA 3DFFA 1AX9A 1J56A 1BXRB 1X70A 5E9JA 4X6XA 1TB4A 3BICA 3OZFA 5AVXA 1BU8A 5CYPA 1P61B 1FL9A 2AG0A 2HO4A 3JVUA 3L8HA 4P2BA 2FPWA 3R6GA 2ZYHA 3ZIAA 5BRJA 1E5TA 5IKMA 3W2HA 1FVOA 5JAQA 1XRSB 3QTTA 4W7IA 4HATA 4PFJA 3U6BA 5JATA 4KNYA 1Z4LA 2JIRA 1H2AS 2H9YA 2HWWA 4I1VA 1ABEA 2BM8A 2ZUDA 1NMZA 4JLJA 4IVNA 2CUZA 5UKDA 3ROPA 5LQRA 5TR9A 2RARA 1RM3A 2EWVA 1SB8A 1NRJB 2DLCX 1L4UA 2I80A 4RUKA 4HN9A 3QF4B 2IV7A 5I7SA 3WE7A 2HI0A 3DDZX 3QYPA 3SIXA 2WRZA 4F93B 1LV8A 2XWBF 4QATA 1V95A 2PCJA 4WY8A 1K8RA 1CYEA 2MCFA 5E4JA 2GLXA 1W4RA 3MJHA 3AFOA 1PJQA 3OUZA 4WBNA 3A7EA 4RIEA 2R5NA 3ANTA 5A3VA 4UC0A 3ZV6A 3KPVA 4Q47A 2H2FA 5HW0A 3OZXA 5CLLA 5EL0A 1YDGA 2A9RA 2OCPA 2VF5X 1EWYA 5E6SA 4BKPA 4CIXA 1QHXA 2I7TA 3NBYC 3BHIA 4KWCA 1E0SA 2G5PA 1HDCA 3DOIA 5TEVA 5BWBA 1L5KA 3WB1A 2CMGA 3L8CA 3H86A 4GSLA 3NPMA 1SVSA 4IY1A 1OU4A 3SBOA 5C4MA 2BEVB 3FF4A 3ABIA 2AMVA 4MUKA 3VNSA 3O4GA 1ENOA 2QN1A 2ZRHA 3QUQA 4QTUB 2YHUA 4EA8A 4MJ3A 2E4UA 1P2SA 1X80B 3KKKA 1L3BA 3REQA 1CIPA 5ICFA 3UVEA 3DZIA 4FDTA 2G9VA 1I3CA 2DYKA 2WWWA 4D82A 1KEZA 4WXPA 4LKOA 5ILOA 3FB1A 2HMAA 3BH6A 4E33A 2B4QA 1NXXA 3OIDA 1C2TA 1IC6A 1XC7A 4II7A 4P9NA 1QRAA 5DW0A 3MAJA 2JA2A 1A7AA 1ADJA 2ZRFA 2QM8A 3DJYA 4MR7A 4NX2A 4TYWA 2IOFA 3D8TA 4RZUA 4ENTA 5C1DA 1G7TA 2MU1A 4R4JA 5HIMA 3OMLA 1NI4A 1VFNA 1HT2E 4MV3A 2NPIA 4Z4EA 2Q2WA 4POOA 4A8TA 3QOFA 4I19A 2EEZA 1YI8A 5FUYA 3SIRA 4TWAA 3DC2A 4RIGA 5AM1A 2NUAA 2YXEA 3IIMA 4ICIA 4B6FA 3LIIA 5CLJA 1OY1A 5JADA 3WLIA 1ESEA 4EH1A 4EVQA 3P4UA 3T3OA 1H2BA 5B6IA 9LDTA 4O2RA 3GAMA 4XLLA 1Z88A 3D1LA 2WM3A 2OCGA 3DBHA 1H3FA 2V3CC 3O26A 1GN9A 4AG6A 3ADOA 2GBLA 3EISA 1GRRA 3R3JA 4R3UC 2XQVA 1BS9A 4FNOA 5G3YA 4BN0A 3HJRA 3RD5A 4JXXA 4QVGA 3ZHSA 1B26A 3GAZA 5G53C 1U2QA 2ZXEA 2WFMA 1G5PA 1RRFA 3NEAA 1YRHA 1THGA 4B9EA 1JT2A 4EFLA 4KUEA 1TW2A 2JRLA 5I8WA 3P5BA 3WYAA 2RJOA 3CIOA 1V8BA 4L08A 1RKVA 4AZ3B 4A0SA 5AD1A 1NUPA 4ME6A 4MGIR 5IANA 4JV5B 2WHEA 5JWRA 3HQ4O 3IPAA 4OXRA 3W79A 1ISSA 4I6EA 1EWRA 1WE2A 4NTZA 1PQYA 1RACA 4UAVA 1AXRA 4F6RA 3REGA 3UT6A 4EECA 4L0CA 2B1JA 4D3SA 3GDOA 5E9WA 1QJ4A 1SK9A 4TYMA 5C80A 5DT9A 3DW3X 1FFBA 1C9DB 4F5EA 1MFZA 5BNTA 3U4QA 3DMRA 3M5WA 4ROSA 4EUHA 1G1AA 1QK5A 4NS1A 2WF5A 4IZHA 3CNEA 2LNDA 3WGNA 4B32A 1WOYA 3T5DA 2YWFA 3KZNA 2H48A 3CVOA 4G86A 2AFIA 4GWKA 4IRMA 4TQGA 5DYWA 4DV2B 2C9MA 4E5PA 4J4BA 4J0EA 2O8FA 1ZN2A 2O3TA 2P9EA 3EIUA 2QN2A 4O8CA 1S3FA 2G8NA 2J32A 2O14A 2QD5A 2PKRA 2ST1A 3SOZA 3UB2A 4Z7QB 5A3QA 2NT3A 4CLOA 4BRSA 2ROQA 2QTWB 4A1FA 2GYUA 2GM4A 4MCHA 4OJNA 2WWGA 3MWYW 3TOSA 1PJAA 3TW3A 4DCPA 4R7ZA 1JKIA 2EZUA 2B99A 2EWWA 3LL7A 4WVFA 4RLHA 3KQNA 4G0WA 4GE0A 4MUJA 1KP2A 1UR5A 1U80A 1YBFA 3QUAA 2RGRA 2AZXA 4WZAB 5HF5A 5BSTA 7AT1A 2ZWIA 2HIMA 1DOAA 3WGYA 3KQKA 5A62A 1SM4A 3F4KA 2RDMA 1HE1C 2O2ZA 4TTAA 4WOBA 2NTYC 5J40A 1M1ZA 4AJHA 3SZMA 4IDAA 1F0NA 1YKFA 1NOJA 2IXTA 2X4LA 2Q6KA 4J1TA 1NVXQ 5AI8A 3ORRA 2ZJ3A 3S0JA 2FKNA 3PWKA 2YTZA 4E1AA 4WINA 2ZI3A 2YIDA 4NESA 2ZIWB 4JEMA 3NH6A 3KXPA 2HK8A 2YV3A 3RANA 5HZGA 2PWYA 1IPHA 3GIWA 4XYEA 4RTPA 3IC5A 2FR0A 1H0SA 1WRBA 3KELA 3PI6A 3Q8WA 5F9HA 1CQIA 5EIFA 3WLSA 4LJ4A 4L5YA 4RWEA 5EKDA 1EK2A 3P9YA 4LXGA 3M9LA 4H1UA 1IRIA 3RFTA 1E5XA 1I3LA 2CNOA 3D7NA 4MYCA 4GSKA 3V9AA 5IVHA 3ZHZA 4BQIA 4HB4A 4WLVA 2Y1EA 2NUAB 4M9CA 4ATNA 5BQPA 1CQPA 4YY3B 3F73A 2EERA 2VJMB 4DCUA 1MA0A 1YTUA 1GPYA 4N54A 5CVCA 1YQDA 2RBEA 4BQQA 1FZTA 3CW9A 2QR5A 4U4AA 2W6NA 4KKXB 4E2WA 4Q82A 4EITA 1SVOA 4D44A 1LQ2A 3O73A 3GX1A 2R3SA 3DDCA 3RS3A 2FF7A 3WB2A 3KXKA 3PF8A 5ALHA 4BGIA 1QIGA 1V7ZA 4QHYA 1C7EA 3P5SA 4JYPA 1JLLB 3WGKA 3ZZ1A 2CHQA 2XBMA 3SHTA 4ANFA 3O3NB 2AI1A 2WA2A 2V7EA 2CW5A 3FLEA 3CUWA 2AK2A 2H4WA 2G5TA 2W6PA 2Y9PB 3UJ8A 4EGCB 5E3JA 5E0KB 4BVBA 3D3NA 1JIKA 3O84A 3PGVA 4QU8A 1PWYE 3AESB 3WV5A 5CDFA 4NEGA 5BWNA 2HF2A 3W0LB 1HRDA 2GJ8A 2QG6A 3TCNA 3D3WA 3IAFA 4X94A 5HBRA 1XTIA 1GZVA 1BFUA 2PQMA 4P7JA 5THKA 3ZD9A 4D46A 4P4GA 2FVYA 2Z9CA 4GZ3A 4RK1A 4HYEA 1W85B 3A3NA 2I7DA 4OFXA 4F84A 3J7AC 2JHPA 2R8YA 2YHIB 3K8QA 4P98A 3TKYA 4D4HA 5I4IA 3RM3A 5C31A 1RWPA 5CNMA 2XB9A 2YNMD 1CJSA 3QGMA 4GQAA 3HA7A 4QXRA 3CKYA 3NBAA 3OKPA 4L3VA 2VJPA 1FJHA 1NW9B 3OETA 2C3YA 4OL9A 2WABA 1GV1A 3K2QA 5TNXA 4GOKA 5AJVB 1EX9A 3ITKA 2PQ0A 4FEYA 2PA3A 3CE9A 2P4UA 4R2XA 3ZHXA 3ZVLA 4AXXA 4DHEA 1U2TA 4GOJA 1KJZA 2W4IA 2ZSBA 3D8NA 2ODTX 1S4QA 1SUDA 2W6ZA 3HA2A 4AO6A 3H6GA 4A0RA 5CXUA 4CLRA 2IPMA 3G0IA 2C57A 1M7BA 1BW9A 1TW3A 1NJFA 1EXNA 3GOHA 4PS1A 5B37A 4RTRA 3BCSA 1I1NA 3GDGA 4G26A 1XLWA 1P2GA 4BNXA 3BF7A 3QI7A 1IN7A 1VE6A 4D26A 1BJRE 4YIKA 4Q37A 2OPHA 3NBMA 3FWNA 3ONNA 1YWGO 1SCDA 2QXUA 3V34A 1TU0A 1TAGA 1GCIA 3LOUA 4M36A 4E08A 3OEWA 1DFGA 1MX3A 4GQIA 4QOSA 1I94B 5JYBA 1HNXB 1WU8A 4NBKA 4NOKA 1O4VA 4ZMBA 1PLKA 4AZWA 3QY9A 4ABTA 5CLQA 1DAOA 3QYFA 5F1PA 5FR1A 1XRQA 1D4FA 3H19A 4B44A 2QBYB 2NM0A 2FN3A 4HK4A 4WD3A 4IMRA 1GTVA 4E3WA 1YZKA 4WJKB 4U3JB 1GPNA 3V00A 2YYYA 4N49A 4R7GA 1SCUA 2IIPA 2QRJA 1T91A 2JGAA 3GBPA 5CTJA 1ATIA 2D00A 3L4EA 2GSDA 3S8YA 1BQ3A 1J8FA 1XLTC 4U3JA 3S2GA 2WMYA 1C7QA 1G16A 1SCBA 2J59A 2EAUA 3OWOA 4W63A 1XA0A 1SFRA 1JYEA 1XJ5A 2RKOA 3AJDA 1U5BA 4P0QB 1YBVA 3ZVKA 3G5LA 2VCHA 2QSUA 3VTAA 5JALA 2HTFA 3CNNA 1BHQ1 1FC0A 1NW6A 2FJ0A 2I65A 4IIJA 2PLFA 3F3KA 5CR9A 1E79D 4BGVA 2OL4A 3EGXA 4UW9A 5JUWA 1OFHA 2G9ZA 2BGMA 4OQ4A 1B6GA 3VTZA 5FWAA 1VKOA 4OLHA 5ABPA 2OYSA 3IXLA 4P3PA 4DZTA 2EV9A 2I7XA 5DYYA 5FLXA 4ZEOA 2NSJA 1AZTA 4W6QA 4AECA 4YUZA 1HFJA 3B3JA 3DXFA 3M5CA 2RGWA 4GMKA 4H15A 4Z9XA 5LVAA 5JY6A 1I32A 1JAYA 2WM2A 1IN8A 1P6UA 4GNKA 2O59A 1HMPA 2FR8A 2OORC 1E6MA 2R8PA 3ZKWA 1EBFA 5IXJA 1C30A 1X1CA 3GFFA 3RK1A 4OP1A 5KPDA 2PGNA 2ZSIA 4Y9RA 4LBZA 4Z9YA 1EDBA 5AXDA 1OI3A 4HNAB 1TJ3A 1KVTA 2IW3A 3A11A 3BWCA 4R1OA 4F8YA 1P9OA 2PZEA 1KJWA 4BEJA 5J2TA 2WFZA 3COSA 2IOHA 8ATCA 4HGNA 1K06A 3SNHA 4ZAZA 2GH1A 4KMSA 1UXKA 2ACWA 4JSYA 3U9LA 1ZDMA 4ZAXA 2ET6A 4BJ3A 3CINA 1NTOA 4HAIA 4WXEA 2EIXA 1OA1A 1X77A 4C2BA 1F7UA 3T1VA 2Y77A 1EVLA 1GADO 1PT7A 4N3BA 4YROA 4JUCA 2ZBGA 1W0JA 3MJCA 3LY8A 3VR4D 1YE8A 3QFHA 1AZSC 1L5ZA 4RZIA 4BB5A 1QFJA 1DIOB 3OZGA 1KAMA 1KHHA 3DZBA 1TT7A 2DJ5A 1U6KA 3LRPA 4M0FA 4Q4AA 4EI2A 2OZVA 3K0HA 2H7VA 3GFTA 121PA 1FDOA 1HQDA 5JU6A 16PKA 3BUSA 1E9BA 3I6IA 1KY5A 3OD1A 3W4KA 3K5PA 2GZDA 3LD9A 2YBEA 1HZJA 1IK6A 3ND7A 4GXNA 1STOA 1DTWA 1OWPA 1QVZA 1D2RA 2WJZB 4EY8A 4MK4A 1ZIYA 4CDNA 2WHQA 3E35A 3SHOA 4OCZA 1E7MA 8LDHA 5JZ9A 4KX3A 2VTEA 2YOGA 5FEUA 3TAHA 2R1ZA 3JZIA 3U4HA 1DC8A 1V47A 1K97A 2C4HA 2ZWAA 3MQ2A 1DBIA 3IPLA 2WPDD 4WGGA 1O08A 1GGNA 4ZODA 1U8UA 1J09A 3RRZA 4GUAA 1VIMA 1FRQA 3MBOA 3WYEA 1Y3BE 3O4JA 4AJOA 2CC2A 1RMQA 4WK4B 5C5IA 4G0QA 1DBPA 3AFIA 3CNBA 3WK9A 2HPZA 3B1XA 1XMJA 3MPUA 4I9FA 4NYMQ 2OCDA 3K9NA 2QU8A 2Z56A 3DO8A 4JJFA 1JJIA 1ECGA 2KYRA 2E21A 3FZEA 4E3ZA 3TQHA 2DH6A 3KKPA 3GL9A 4DLVA 1UKZA 5I5GA 4R54A 5LKRA 1CZNA 4FONA 3TBHA 3VH4A 3L4SO 2V7UA 1H4QA 2ZDHA 3L01A 3IXMA 4ZCLA 1Z08A 4DNFA 3O7WA 1SXJA 1IBKB 4Y2SA 2QYOA 4N5LA 1PL8A 1AQYA 3GLIE 2BW0A 2PVSA 3LF2A 1W1IA 1ZMTA 3HVUA 4BZXA 4DABA 4WDRA 5L8VA 2NGRA 4L4RA 3Q7TA 3JATB 4RIFA 3PQ8A 1C1DB 3JAWA 4JA0A 3U39A 4CHGA 1WCIA 2HJGA 1FFYA 3M3HA 3VDXA 1E4OA 4MAAA 4Q7LA 2PZBA 2V5VA 1EE1A 4DQVA 3CZ9A 3W3ZB 2V9PA 1N4AA 4AP9A 3PL1A 4JSRA 4MMYB 5BW6B 1I14A 3ZY6A 1IOVA 1C3OB 4DEVA 1WUKS 3HXOA 1CIVA 1NSTA 2AYYA 5KMGA 2HCFA 1T8RA 3BFPA 3P9SA 1QHHA 2BMFA 2ZRLA 3GFQA 3QKWA 4O4IF 4X3OA 2XEDA 1NQAO 4FNAA 3PC8C 2WLTA 5LLSA 2VYQA 3LAWA 4TYQA 4PXAA 1OLSB 1XWFA 1M2OA 3QKIA 3E5RA 2X8JB 3DEYX 3OOHA 3LZCA 2VZEA 4OYRA 3VPCA 3T5PA 3NFYA 1A8SA 2LTAA 2QM0A 3B5EA 4TL6A 4UHBA 3ZCQA 3WISA 3LV8A 4OK6A 2VHQA 3COPA 1EESA 3OCVA 4RQUA 3RV3A 3EPJA 3OI7A 1I3MA 4X8MA 3ZI7A 4C06A 3WMRA 3T7AA 2CZQA 1RYBA 3OKAA 4OFWA 1UMDA 4REQB 3EXEB 1GL7A 3S68A 3W34A 4HGPA 1UPFA 3WGUA 2XOKD 4BB9A 5IXSA 4JQOA 2HU2A 3C3DA 3MTBA 2XCOA 2QE7A 5LD2C 4B3CA 2YUTA 3L0PA 1U2GA 3QVJA 1L5HA 3IKLA 2J33A 2VLBA 5LBTA 1YA8A 1D6NA 3QKRB 1UPXA 4ARUA 2HXYA 1TO2E 2H5LA 5TPWA 3DDWA 2JD0A 3O92A 5JD4A 5EGSA 2D5AA 2VHUA 3F6PA 4HUTA 5B3JA 1PJBA 3D0QA 3PNBA 5L51A 4IGAA 4OQQA 3RUIA 4IO0A 5CVEA 1X1AA 1LD3A 4G67A 4X8OA 2VQ3A 3C8DA 3WNDA 1OZHA 5B7NA 4KVAA 4P4UA 3QW2A 4QIHA 4UQOA 4IFBA 4NI5A 5D3MB 5TQVA 1H4SA 4M86A 1MN6A 3HR4A 3MJFA 3WWDA 1TF7A 4EG4A 2BZ0A 5JFTA 2AVDA 2OYRA 3O8DA 2AW3A 3LQRA 2WAXA 4PIPA 5LMZA 4M38A 4YRPA 4F4FA 1JZSA 5IZCA 2WLSA 1PHRA 3AHDA 1GVHA 3PHIA 5BV1A 1UXOA 4G3XA 1X9IA 5DISB 3P2IA 3CLTD 5FBHA 3A4LA 5CVDA 4CMEC 1LB1B 1O58A 2GPSA 4K6FA 4X71A 3GZTB 4BNHA 4EEKA 1UDAA 1EUCB 1QBGA 1W0CA 2IP4A 1KDOA 2HF8A 3I0ZA 4IILA 1XTKA 2BFFA 3GGOA 2EX4A 3WGHA 4CTNA 3FTFA 2FFBA 4CKEA 1B4DA 3WMGA 4RO0A 3BWVA 3JRXA 3D54D 2L19A 2WJ4A 3VZCA 1OJ7A 4ZA2A 2B1RA 2PMKA 3LBIA 3AETB 4JYZA 4P8RA 3A6ZA 3UQYS 4TTIA 3W9SA 3QUBA 3CEHA 4D97A 5AK5A 1YS4A 2GEDA 1C41A 3K20A 2ZS9A 1WBJB 3I72A 4CQLB 5BSVA 3F7TA 1RQRA 2PZ8A 1W30A 1X8XA 3D8SA 2I62A 3SGLA 4N3NA 4BTLA 1BU5A 1X1BA 4TT3D 4ZP1A 2XSZA 3E1SA 4K9OA 4EFDA 5BURA 2EW2A 5FOVA 5EIAA 3FZQA 2RIPA 4TQAA 3RHFA 3FYUB 3L0IB 4MRVA 1X1DA 3AL3A 3NGXA 4R8LA 5AKKA 5I9LA 1T35A 5JXJA 1QPZA 2G08A 2OVBA 2FUG1 4AK9A 2VXYA 1CF4A 5DWQA 1JFVA 4UTOA 1J0BA 4X1KA 5EP3A 1JHUA 1MRNA 5TMPA 3BWDD 2B8WA 3E8XA 3NETA 4XDGA 3F6BX 1X7YB 3PFFA 4KAAA 4LWZA 4D1YA 3ZWAA 3G02A 5KDOA 3DYBA 1P0CA 1E1QD 2JKVA 3RS2A 3LCRA 3ETGA 4L78A 4X91A 3RGWS 4DQXA 2P2LA 4P36A 3CISA 3G2NA 5TQJA 4TLDA 3SC6A 4G4SP 2TMGA 3WMWA 3P52A 4NZ9A 1M2KA 2P4SA 4NAUA 4OGWA 4B17A 1ZOPA 1FUYB 5A4DA 3CLUD 4XYBA 5IJ0B 1PR0A 4N4AA 3ILYA 3QFCA 5DSZA 3R7WB