5EJEA

Crystal structure of e. coli adenylate kinase g56c/t163c double mutant in complex with ap5a
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDACKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEECVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Structural basis for ligand binding to an enzyme by a conformational selection pathway.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 77
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2015-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ejeA00
3SU8A 1R4AA 5GJVC 1LNZA 4RD0A 4KYUA 4PHHA 1CR4A 1Q57A 1E2KA 1GUAA 1NKSA 1TF7A 4KAXA 4DRZA 3QI2A 2QE7A 2QMOA 2D06A 3W3ZB 2XOKA 4TLBA 2YWGA 1WXQA 1VG9B 4XD7D 1GKIA 4XVQA 3LLMA 3TNFA 2JJ2A 2CDNA 1P2SA 2ZITA 1TPZA 1KJZA 3EWAA 4C2UA 4Q4AA 1G3QA 3B6EA 3BBPA 1SVMA 1IXRC 2OBMA 2BM1A 4QXAA 4YMTA 4B33A 1RE0A 1G8GA 1UFQA 1QG2A 1R5NA 1NP6A 3KKOA 1G17A 2D74A 2V1XA 1W0KA 2ZRIA 4JVMA 4UNRA 1KDTA 1N5KA 4GMXA 1CF4A 2D3WA 4W9MC 1VG8A 2PL3A 1TQDA 3CH4B 3CW2A 2C2HA 3I32A 1AM4D 3CONA 2P6UA 2WWHA 4FIDA 1ZNWA 5DN6D 1EWQA 2P6RA 3LRPA 3KKNA 5A5GA 4GBMA 6Q21A 4TYYA 1EFRA 5EXXA 1WBBA 2QEQA 1FW6A 2AD5A 1IY2A 3FPAA 4PQRA 1TQ2A 4Q1BA 2PX3A 1Z0IA 2REXB 2FSIA 3A6PC 3LNCA 1AZTA 4I81A 3A4MA 3ZVRA 3UXMA 3WMEA 4D26A 2Q6TA 4ON9A 5D3MA 4CEIB 1HH4A 1J8MF 2R6AA 1JNYA 1SXJA 2OFXA 2AX4A 4P4UA 4F92B 3B1ZA 1S3GA 3KQNA 5CM8B 1E0KA 1LY1A 3NHBA 4B43A 4JS0A 5LB4A 1XMIA 3U7FB 4AKHA 1JQLB 1NMZA 3BAFA 3GLHB 4Q4AB 1Z0KA 1YZUA 2PH1A 4Q02A 2REOA 1FQJA 5L8VA 3AV0B 4EJSC 2H57A 4F38A 5JBQA 4DCVA 1ZVQA 2PCJA 4GNKA 1GIAA 1NG1A 2IYXA 4M1MA 1S3SA 2JA1A 2HCJB 2OLJA 2PEZA 3K0FA 1T3HA 3Q7QA 2C98A 3AKEA 5BYKA 2H1LA 3VR2A 4RZXA 3VMFA 1L7VC 3D31A 4JVSB 4IOJA 4LHYA 3W8NA 1NVUQ 4B3CA 1M2OB 2YC2C 4PZZA 3AP1A 3AVUA 2ZI3A 4GRAA 4URZR 1E9RA 5L3SA 3O8RA 3K09C 3FFAA 5IF9A 3NHAA 1N2CE 3U4QB 1T3SA 3LW7A 1LW7A 1Q20A 1GP2A 4UNPA 1EXMA 3U3OA 2OCPA 5C1BA 5CDFE 1XNJA 3ZGXA 2CJWA 3HU3A 3GJ6A 1AK2A 3KKPA 1OXVA 1X3SA 4KLNA 2AXNA 1KI7A 2GRJA 4D80A 1XX6A 1ZM7A 4E07A 2RGDA 2GAOA 3OEHD 3IO3A 1NJGA 1Z0FA 3QVUA 721PA 5DH9A 2J7PD 2OAP1 3D7MA 3R20A 4JLJA 4OQMA 4TTRA 2O0HA 4GOJA 4XSGA 4C0QC 1FOEB 3CF2A 5G41A 1DARA 3CRVA 4RD4A 3VR5A 1NJFA 3B85A 4Z8XA 4N0DA 3VKHA 2BVNA 4CF7A 5FTLA 4Z54A 1PLJA 3JVVA 4LJYA 3SHWA 1KAOA 3SR0A 1G16A 4I1OA 1IXSB 4K46A 1F2UB 4ZV4A 4ZIRA 1LVGA 4X8HA 4BFTA 3R9IA 1VHLA 2X2FA 1E1RD 2IYZA 1W2HA 5JJIA 3UG7A 3KB2A 3AF1A 2VHJA 3TJZA 1KMHA 4OL0A 1PJRA 2WAYA 1ZW6A 2ZPTX 2YJTD 2ZSFA 3P26A 4X8LA 5BWMA 2ZJZA 2ZRPA 4F4JA 4C7OA 4AYWA 5FOUA 3CF0A 3TK1A 4OJKA 5DI9A 4URVR 1N5IA 2WZQA 4JYBA 2CCKA 3THWB 1XCMA 4HZUB 4ZPXA 2BCJQ 1XEXA 2J46A 3QKSB 5C4GB 3QXHA 4K81B 1NVWQ 2IS4A 2CE2X 2G1JA 1RC8A 2VSFA 2YWHA 4YMUA 2GA8A 5J4KA 3AKDA 4WVFA 5LD2B 4CEHB 1N6LA 5FUXA 5EJEA 4YMVA 1VG1A 3NEYA 1MV5A 2QP3A 4KVAA 2NO0A 1QDEA 3LWNA 3U44A 5FOSA 5B57C 2VRWA 2H7VA 4AY2A 3SEAA 1OFIA 1W7AA 4BUJA 1TQ4A 1QHYA 2RGGA 4P4SA 2EFDB 3SJCA 1G8FA 2X19A 2XSZA 4AYXA 3BFKA 2GBLA 3AVOA 4DKXA 5TMPA 5TV2A 4HB4A 4TTQA 2CCJA 2JCSA 1BOFA 2FX3A 1E79A 4D0LB 1MH1A 1GRQA 1R0WA 1ZAKA 4F4CA 2ZRHA 5JHHB 2W6ID 5DYGA 4FCTA 2BV3A 3FGNA 4CGZA 3TVTA 2XXAB 1YRBA 1IXZA 1F2TA 4IVPA 2J9RA 2ZS9A 4CEJA 1OKKA 1GL7A 1ETUA 4B2IA 4GMDA 3DEFA 5KTYA 1XTSA 2AR7A 3V4RA 1TQ6A 3EPJA 1XB2A 2MMCA 4RJLA 4M1SA 4YDSA 4D0GA 4US2R 2OE2A 2ZJBA 3NXSA 4QKQA 2GXAA 1G6HA 2BBSA 2WIBA 1ZC4A 2FFAA 4M9XA 4NKRA 4QNMA 4LJ4A 2ZREA 3UATA 4ZI3A 2WVJA 3KL4A 4QBFA 2OSBA 4HLQB 4Q7LA 1CJKC 2PZGA 4BLSA 3RWMB 1Q1ZA 2C77A 3SS8A 1VHTA 1S1MA 3FMOB 1LS1A 1Z0JA 5J5CA 5A4JA 2K5UA 4UNSA 2VP9A 4PSAA 5G3ZA 5L3QA 3QXJA 3QENA 1SULA 2NGRA 1W49A 5CYPA 5KSPA 4A2QA 3AF0A 3M6AA 5JRJA 3GJ8A 2QROA 3ASZA 2R44A 3LFUA 2QGZA 4LYJA 1UPTA 2ZEJA 5CITA 1N0VC 1DOAA 4EIWA 4M1OA 2DWOA 3MG9A 1XEWX 2YNMA 3O8BA 4QGFA 2J0UB 1DAEA 1Z6AA 5BN4A 2VA8A 5FTNA 3N70A 4Z1MD 2D7DA 2O8CA 3RSOA 2ZR7A 1YR7A 5KOYA 1PV4A 3CNOA 1HT1E 1Z0AA 3B9PA 3TLXA 3SZRA 4NYIQ 3L2OB 3A8TA 1RYFA 1EGAA 4PAOA 4V0MA 4R7ZA 3LBIA 1KK3A 3W6PA 4QM7A 1TEXA 4LK2A 1XD2B 2FE4A 1DO2A 3QKRA 3F5FA 4ARZA 4KU4A 1CJTC 1NN3A 4TTPA 2OM2A 1BH2A 1Z22A 2KBEA 5JCPA 1T4GA 4PQYA 4BPBA 2EYUA 3Q5EA 1JXMA 1RJ9A 1YU9A 4JT2A 3I3SR 3ZJYA 2P3SA 1G7RA 4C0JA 4KSCA 2W58A 5KPDA 4C0SA 1QG4A 1E1QD 4HAWA 2F3TA 2F9MA 5JEDA 3EC2A 3GJXC 1KZ7B 2V7QD 2PMDA 4BFUA 2IYLD 5KYKA 1Z6XA 3X2SA 2R65A 3G5UA 4QGGA 4JKIA 3BE4A 1T91A 2A9KA 2F1JA 2WJYA 2FZ4A 1B0UA 4Q03A 2WSSD 4MKHA 4R2HA 4V0KA 2Z5FA 5IHPA 3TIFA 3NBZC 1YR6A 2G83A 2CL7X 1FUKA 4KSBA 521PA 2KBFA 1ZUHA 3A1UA 1OXXK 5F2EA 3GEHA 4JBYA 4BWYA 2CHQA 2UVQA 1ZIPA 4QM6A 4Q9KA 4KV9A 3TGPA 4QGAA 2EFGA 1G291 1K6MA 3HU1A 4Q1EA 3NH9A 3WNCA 2IUSA 3PUYA 1G8PA 1Z3IX 2GKSA 4OHVA 2J0SA 1AGPA 2ZANA 1SZPA 4PTLA 3U7EB 4PO8A 4MRSA 5HCIA 2VBCA 2N46A 1EK0A 3WRXC 3H86A 1X86B 4B73A 2JLZA 2OCAA 4JSYA 3IHWA 4OQLA 1FZQA 4PX9A 2XNDA 2IXGA 4E22A 1T0JB 2QG6A 2REBA 2XTMA 3OEEA 4H1UA 1EFHA 2WOJA 2YVUA 4BQSA 2J3EA 1RJ9B 2NO6A 1J90A 3GLFE 1CIPA 2A2ZA 2D4HA 3EA0A 4B3GA 2QBYA 3JZMA 2BMEA 4HB3A 5G3YA 1AN0A 3T1VA 1XTRA 1X8LA 3BWDD 1ZRHA 1ZM2A 2RHDA 1N0UA 1U90A 2DFKB 2GEVA 3E70C 4S2EA 3KKMA 2QORA 3K9GA 3QKRB 4HAVA 3PFIA 2ZJOA 4HUQA 3RAPR 1E9CA 4C7OB 5E4FA 4P32A 3GLGB 4AKIA 3I92A 2EQBA 2B6HA 1AIPA 2I4IA 5FTKA 3UIEA 5TARA 4BFYA 5EUMA 3SNHA 3UWKA 5CB8A 4NE2A 3OIUA 2QT0A 1NG9A 2YHSA 2GJAA 5JFGA 1KDOA 5JRZA 2ZJ8A 4Q9JA 4K8OA 3AUYA 2W00A 3RRMA 3T1QA 3VU9B 1BS1A 3R9WA 4L15A 3JVUA 1ZNYA 1E1QA 1ZCAA 1L4YA 1AJEA 3ZVNA 3OESA 3DOFA 3NBXX 4XSHA 4E03A 2QAGC 4IOKA 1T0HB 2MSCB 2ZE8A 4NCHA 2C99A 3DL0A 1C1YA 3Q85A 5CK5A 4DCSA 2WSMA 1NY6A 3EG5A 4R9UC 4OHZA 1TF5A 1VCMA 2GHIA 3QQ5A 2ZVQX 1ZIOA 1CR0A 1XWIA 5JECA 3LDAA 1GL9B 2O8BB 5IDVA 2O8CB 3EAQA 3EX7C 2O8DB 2GBLC 4QHYA 3MGCA 5H68A 2WKQA 4GP7A 5JS8A 1XTKA 2WWGA 2BMJA 2GCOB 1OIXA 1WP9A 1G5RA 1XTJA 3AVYA 4JLVA 3ND8A 4KITB 5KNCA 1E2HA 1VYUA 1Y3AA 3PIRA 3B1YA 5A0FA 5D3MB 1Z6TA 1S9DA 5DE3A 3R8CA 1Z29A 3IBYA 2N1BA 4TT3D 1P62B 4L9WA 4GOKA 2OXCA 4TLDA 2O8EA 3P4XA 3MSXA 3K0CC 5HE9A 2FOLA 2C96A 1GVNB 3OIYA 1UAAA 2QA5A 3LO5A 3ZD7A 4MDEA 1SVOA 2JASA 3K0FB 3ZVLA 1EFCA 3OF5A 1FFHA 4J0QA 3U44B 5UKDA 3I4LA 5H8WA 1P2TA 2WJJA 3SBDA 4A82A 1TX4B 4IXMA 2W2VA 2IYWA 5EE0A 2QM7A 4G3XA 5HZKA 4CEIA 4DJTA 3T1TA 1MO4A 2VIIA 1KDRA 4W5WA 4EPYA 1II8A 1DTSA 1TL7C 1Z6YA 5JWOA 1OH6A 2W83A 1RZ3A 4QNRA 5HR5A 2WV9A 3LXXA 1K5GA 3BH7A 1BMFA 4RKFA 4BASA 4BRWA 2CNWD 1IJFA 3VNUA 2PLRA 3IEUA 3BK7A 5HCNA 5LBIA 2IHYA 3A1SA 2EFHB 3DKVA 1KDPA 2RGBA 1NMYA 2GAAA 2ZAOA 3T5DA 1R5OA 3NBFA 2QN6A 3QNUA 4RZUA 2FA9A 1E69A 1SQ5A 4B6EA 1VCNA 1N6PA 1DELA 2OLKA 3LY5A 1NY5A 1ZP6A 3DKPA 3T1OA 3FMFA 2A5YB 1Z47A 2P67A 3CZQA 4P4SB 4HUTA 1ZMXA 1ZNXA 2ZI9A 4YXWD 1VYVA 1GFIA 1XZQA 2DCUA 4C9BA 1JB1A 1Z5ZA 2OILA 4A0RA 4AC9A 1L8QA 2ZUBA 4OHXA 2P0EA 5JJKA 2ERXA 1NRJB 1SVWA 3IO5A 3O47A 2QZ4A 4AK9A 3PXGA 2D62A 5AR1A 1NKTA 2X8AA 4Y0VA 3RHFA 4CEHA 5FL7D 3PEYA 2KE5A 1U9IA 5B2ZA 2IWHA 2ZS7A 3QKSA 3VHXA 1XMVA 4DXAA 2G1KA 3BRWD 2GJSA 3AH8A 4EPRA 3V9PA 2QRNA 1KNXA 1N0WA 4CT4B 2NZ8A 1G6OA 5G53C 3C41J 4FD2A 3KXLA 2DWPA 3W34A 4TYWA 3QOFA 2R2AA 4KYIB 4YC7A 2G9NA 5KNDA 3BORA 5CYOA 1NVVQ 2ZR9A 1OFTA 2C04A 2ANCA 3AVWA 1U8ZA 2NPIA 2A5JA 3WMGA 1DPFA 3V00A 3ADBA 5AJVB 2CE7A 2G88A 3NVAA 1P72A 2VP2A 4DLZA 3CPHA 5KU1A 2P6NA 1DG3A 1ESMA 2WMNB 5SZKB 3KQHA 3UG6A 1JAIA 3KZ1E 3ZS8A 4NONA 1WRBA 2GK7A 4Q7JB 4BFVA 2FDCA 2O8FB 2B8WA 2WWYA 3A36A 4OI4A 4LSGA 4LBYA 3VQTA 2P65A 4CW7A 1KK1A 3SN6A 2OO7A 3CNLA 4NU0A 4NYJR 4B71A 4HLDA 3AGQA 3MJHA 4IJMA 2FPMA 2JLSA 2FN4A 2YZ2A 1I2MA 3KB1A 4PXAA 2QPAA 2W6JD 1KIMA 2QUZA 4JBXA 5BYJA 2RGCA 3MUFA 3T12A 1G9XA 1TUIA 1Q44A 2O0KA 4LJ7A 3FHOA 3PJRA 5ELXA 4O0MA 4QG7A 3QXXA 3B78A 3WMFA 3H1TA 3SI7A 4JBWA 3DMNA 2JDID 1JR3E 2VSOA 1OXUA 3QSYA 5L3SB 3QJYA 4WZAE 4LC0A 5AUQA 4US1R 5K8UA 1DAKA 4UXHA 1IONA 3MWJA 1BMFD 3GLIA 3DM5A 4Z1MA 3QXSA 1E98A 4RD2A 2ZM5A 3ZZTA 3AF3A 1NI3A 1ZUIA 3KUDA 3TW4A 4URXR 1W0JD 1KJWA 1KNQA 4U00A 3W5IA 3S1AA 3R7WA 1EX6A 1G3UA 1G19A 1QRAA 4DBLC 1N6HA 3GJ5A 3HYRA 2J0QA 2BDTA 2C5LA 2I3BA 2ANBA 1GKUB 4NYJQ 3RLFA 2CMKA 3TMKA 1NN0A 2GVZC 3OFNA 2UZ3A 3OE7D 5TDHA 2ZJAA 2B7BA 2W0SA 3IDQA 3T35A 3VX4A 5K8TA 3QEOA 3B2EA 4LWZA 4OI2A 4US0R 5B30A 3UMRA 3ICEA 4JSTA 4C3ZA 5FUVA 1Q22A 4H9GA 4MGZR 1MOZA 4DB2A 4B2PA 5EE1A 2HF9A 1CU1A 2QMHA 3CBQA 1E9EA 4IOMA 4FW9A 4PSKA 4MGYR 2HYDA 4DLVA 2Y8EA 4MH0R 3RS0A 4XWOA 2JDIA 2AL7A 4M1TA 4A6PA 1Z83A 5KO2A 5AK0A 5AJWA 5TVKA 4IXNA 3BOSA 5FTMA 5FI1B 3THYB 3DO6A 1N25A 4MRRA 1VYTA 4LHZA 3ASYA 1P7CA 1KYIA 3GJ0A 1P9NA 3TSWA 2KB0A 1SHZA 2ZR0A 2G0TA 3C14C 4AI6A 3WHLA 4PSVA 5C46F 2ZS8A 1DO0A 1Y63A 2FU5C 4A0GA 1XJQA 5EP3A 1M34E 2C8VA 1Z06A 4X8MA 3BGWA 4L5BA 1BYIA 2NOAA 2Z4RA 4I1UA 2DBYA 3LBNA 2O8BA 2OCBA 4C4PA 4BLQA 1H8ED 1XEFA 3OE7A 1X8KA 2AWOA 4IDNA 2MSEB 2GXUA 2XGJA 1KKMA 1E0AA 5EP4A 1G21E 4RD1A 5DI3B 1E79D 4XVRA 3LX8A 2V9PA 2AD1A 4Q9HA 4WAUA 3QUSA 1OIWA 3RRZA 3RS2A 4D25A 1XD9A 1AS2A 3JZAA 5FOVA 3IQXA 2WMOB 1OHHD 3W8RA 2DR3A 1HQCA 4TYNA 3AVTA 4ZCIA 2ZJ5A 5F9FA 3RABA 3PR1A 1C4OA 4HEJA 1NLFA 3KQLA 3C4JA 3L0SA 4RSGA 2JJ2D 4YDHB 2IT1A 3IGFA 2ZE5A 2JJ8A 1N6NA 1UF9A 4HUQB 3GCGA 1DAIA 3EZ9A 3NBYC 1DS6A 1WB9A 5E7JA 4BZPA 3HP1A 1RVDA 3GLIE 1SKYB 3EWSA 4XVUA 2H92A 4NMMA 2A78A 2CK3A 3R8FA 2N42A 5JHGB 2FV8A 1G1MA 4NYMQ 3P32A 4NCKA 3TQCA 2ZI7A 3WRYC 1JJ7A 4IVRA 5DIFA 4V02A 3VKGA 1J2JA 4D2IA 3WY9A 3BIFA 2QTFA 4HAUA 1AKYA 1D8TA 1OF1A 1QHHB 2GXSA 4KBFA 1YZLA 1G4UR 2OCYC 3T06B 3EARA 1H8HD 1KHTA 3PG5A 4LV8B 4M1KA 3IIJA 1KY3A 4A2WA 1SVSA 2Q9BA 2RCNA 4KO8A 3TBKA 2WICA 2NO1A 2IS2A 2F55A 4LC1A 3MAAC 5C18A 3LH5A 2HT6A 1DAMA 2V54A 4ZCMA 3NIBA 1P60A 3E1SA 5CLLA 4EPTA 3GLFB 5JI2E 1NSFA 4P33A 3I8XA 4PAMA 221PA 2QRZA 4B32A 1A7JA 4Q9LA 1OXTA 1CJVC 3A1VA 1GNPA 3PUVA 1W36D 2QSZA 3CWZA 2UZIR 4IEEA 1E2MA 4B48A 4TZ6A 4OI0A 3KUCA 2YOFA 3IEVA 3K70B 4GP6A 5EP2A 1TEVA 1E9SA 2GDJA 4D6PA 2C03A 4F93B 1WBDA 1E9BA 3AVPA 4NYIR 2ZI4A 4NH0A 1KI6A 1HQYE 1P9WA 1H8EA 2XEXA 3SQWA 3C16C 2XZOA 3THXA 3RWOA 4FMDF 3IHLA 3K9NA 3UKDA 4B75A 4Q4LA 3VFDA 3CLVA 2ZRDA 3UMSA 1GKYA 2GJKA 3VR1A 1M1YE 3CF6R 4BLOA 2A7QA 3S1AB 3ZIAA 4WIAA 4DLUA 3FFBA 4JLAA 2YV5A 4GZMA 4N1AA 2L0XA 3BB1A 4Q5IA 4LZZA 1ZBDA 3W6NA 3CRRA 1FP6A 1KZGB 3BERA 4FI3C 4F4IA 1M7BA 3C15C 3FHCB 2OG2A 1XTQA 4WOPA 2VYFA 3BJIC 3UANA 5HZHA 4G5OA 4MKFA 1IHUA 1K8RA 4E5UA 3FKSD 1LTQA 4DIDA 1E2NA 4WW0A 1TU3A 1EX7A 4LJAA 2GVDC 4LPKA 2IL1A 2E1RA 4I4LA 4DCNA 3SC3A 3KQUA 1FUUA 3M1IA 1G7TA 5KDDA 4ESVA 2FF7A 2O8EB 4WBSA 4B76A 1XCGB 1UKZA 4DDTA 2VP0A 1E1RA 4TYQA 5ANRB 1R10A 2B8TA 1AQYA 4MUBA 3ZVMA 2ZE6A 4OKSA 5KSZA 1OB5A 4RFSB 2G6BA 2QL6A 2BHRA 3WBJA 2QY9A 3N2EA 1I4DD 3QVVA 4R2IA 1SXJE 5AJZA 2H8KA 2LKDA 1UDXA 3SDZA 3DZ8A 2QQEA 4UQOA 4N3NA 2ZRLA 4IVQA 2O8FA 4L9SA 3CX7A 5FUYA 1DBSA 4TMWA 1P2VA 1MRNA 2GF9A 2WOOA 3AF2A 3CM0A 1R0YA 4B3DA 4BLTA 1E96A 1SVIA 1J7KA 1U81A 2RB4A 2GILA 4IRUB 1CULC 5JWHA 1UKYA 4JT4A 1KI9A 1UJ2A 4QBIA 1KI4A 4XOIA 5FI0B 4KFTA 4DEXA 3ONWA 1ZD1A 1EFUA 3ECCA 3EW9A 1G8YA 4O25A 1FMLA 1ZINA 1U0LA 4DLXA 1CRQA 4GOXA 1IN7A 1S8FA 4Y0AA 5AUPB 1D2NA 1U8AA 4QBGB 1G3RA 2JLVA 3TAHA 2BC9A 2ODWA 3TUJC 2X2EA 4A0HA 4TZ0A 3CB4A 1ELOA 1F48A 1RYHA 1EWRA 4HAZA 4KFRA 1G7SA 1S0UA 3AKCA 3ICQB 4GL2A 3FOZA 5AUOB 2VO1A 3D6TB 3MJRA 4YMSA 3MLEA 4FXPA 4AG6A 4B74A 2VF8A 1Q1QA 3OAAD 3HPQA 4DC9A 3GLGA 4MA4A 2QMUA 1XZPA 4A15A 4F91B 3FTQA 4RD3A 1QHNA 1PUJA 4TLCA 4LYAA 1E6CA 4ASUD 4EFMA 2IX3A 1GNRA 1IY0A 1R0XA 1RW4A 5GVSA 1K5DA 1QVAA 1Z2CA 3I1FA 3L0OA 1XD8A 4JIMA 4RCZA 4EKDA 5HTKA 1QHSA 2QAGA 4QL3A 1MRSA 1UEIA 1I2DA 3K0SA 4PC6A 3LQQA 4PC1A 2LWIA 2F43B 2YYZA 3BXZA 4BFSA 4HZIA 4PC7A 1DAGA 2DFNA 5J4VA 3DMDA 4ESHA 4LHVA 1ZJ6A 4G5SA 1XPOA 1QHIA 1KO5A 2WIAA 4CZ2A 2O52A 4EPXA 3GQBA 3K0EA 3QPVA 4BZXA 2ZJ2A 1ESNA 5E7IA 4TQUS 2A5FA 3KXKA 3PENA 4A8JB 4DLRA 2H17A 5J47A 4C30A 5FBRB 3Q9LA 3VR6A 1SXJC 3QF4A 3LW8A 4ARZB 1W2GA 1Q1EA 2FSGA 3SJBA 1WDTA 4Q1FA 621PA 1HY3A 3EPKA 4DUGD 2ZYVX 3TR0A 3OZXA 3SYLA 3WXMA 1ODFA 4F7WA 4QHSA 4R71A 4ACAA 1R6BX 3B13B 3B1VA 2ERYA 1IN6A 3KKQA 1VECA 3K70C 1ZD8A 3F3YA 3MWLA 5DGXA 4RZ2A 3SFZA 1JR6A 1YR9A 5DISB 4M9QA 4LBVA 2ZYUX 5LD2C 2J0UA 4WZBE 3P4YA 2IBMA 1FTNA 1GRRA 1YKSA 1E4YA 3FVQA 3KX2A 4D0NA 2XAUA 4EDHA 5M04A 1IY1A 4ZDIA 3KFXA 2KJQA 8OHMA 2RH5A 2ZRGA 4A4DA 2QGNA 3M4YA 1KI2A 5JZVA 3NG1A 3P20A 1HURA 3Q3JB 4CIDA 3SJAA 4PHGA 2VHQA 3GJ4A 1VDZA 4C0HA 2JLXA 3SYKA 4CT5A 1W4CA 4HSEA 4IFBA 4UXIA 5L3QB 3ZZUA 3GEIA 2VP5A 1W4AA 3ND9A 4MDFA 4LUCA 4BGDA 3X1WA 4V03A 4BE7B 2TMKA 4AD8A 3I8SA 3U6KA 5EP1A 3AKYA 3AM1A 4TMXA 4ZDWA 3G82C 3PEUA 1KSJA 1XD2A 5FOTA 5K8LA 4TL9A 2JLRA 4PZLA 4KFSA 5JEEA 3AGPA 4B3XA 4D4KA 2GJ9A 4A2PA 2FGKA 5FL7A 4KODA 1LF5A 1OXSC 3GJ7A 4P3YA 1N6OA 1SGWA 4TLAA 4D4MA 1MO5A 3AVVA 5DNYB 1OE0A 2ZETA 5CM9C 3T5GA 3U7HB 4CEJB 4PPNA 3B82A 4M22A 4UNQA 2PJRA 3MRSA 2Q3HA 2OFWA 1E2QA 2C9YA 5FFMA 1A4RA 1YE8A 4GFDA 3UWOA 1EG7A 4G01B 1KSHA 2A3RA 1KO1A 2R62A 4PHFA 1QVRA 4NYMR 3CPJB 1BKDR 1FL9A 4XJXA 3KJIA 3DZDA 4MYUA 4NPHA 4DDUA 2WJHA 3K0AB 2ZQ5A 3PUXA 2BBWA 1CEEA 2FZLA 1CTQA 1CRPA 5IRCD 1SHKA 2XNSA 4OHWA 2ASEA 1Q3HA 4LX0A 2QM8A 4PO9A 5FBLB 3KTAB 3Q7PA 2R6DA 5FTJA 4HLUA 2CL0X 2KWIA 2P5SA 3VKWA 2ORWA 1JXOA 2CLSA 3MWYW 2VLIA 3CR8A 3EZFA 5B58C 1NN5A 1KO4A 2WM9B 1YR8A 3AF4A 3GPLA 2VF7A 1YZNA 2FFBA 4KHZA 2E9SA 4RZ3A 4D4LA 1S96A 3PUZA 4FMCF 2XNDD 2WBLC 1JEDA 4HZUA 4NCJA 4R98A 5EXPA 1OSNA 1NBMA 2Z43A 2IYYA 1P75A 3K9HA 2BEJA 4Q21A 3RC8A 2Z6VA 1GAJA 2F1RA 2W2TA 2AKAB 3GD7A 4BRUA 2AWNA 3IUYA 3WBKA 4M9SA 4AKEA 2EU8A 2PT5A 3GLFA 2AK2A 3THXB 1XXHA 4M1YA 2QTHA 2HCBA 4V0OA 5CDFA 3B1WA 2VH5R 4QJ5A 1CXZA 3TSOA 1XPRA 3RVBA 2FNAA 1XF9A 2ZJYA 1NMXA 1VMAA 3L8ZA 4DSTA 5JSZA 4M8NE 5EXTA 3QPWA 2AFHE 1IOZA 4B47A 1E4VA 1ONBA 3B1XA 1HYQA 1KSFX 1KMHB 3K9LA 4NP6A 3TRFA 2Q9AA 1FMJA 1R7RA 4ZO4A 2V3CC 4A6XA 3H2YA 2WWFA 2BM0A 1LS6A 3QXCA 1E32A 3E5HA 3EA5A 4URYR 2I1QA 4DT1A 2XZLA 2PT7A 2ZRNA 5H1YA 2MMGA 2XB4A 3PVSA 3AP2A 3WHKA 4NHOA 4JL8A 1L2TA 4DZZA 4FWTA 4LV5B 1XPUA 1JPJA 4ZIRB 5FL3A 3U4QA 4GT1A 1E0SA 3I5YA 1T5IA 4FWIB 4RFSA 1JBKA 2VQSA 3FYHA 2GJ8A 1UM8A 3T34A 3U60B 4YXWA 1JEEA 2HLDD 1QHHA 2R9VA 1G20E 1ZM3A 4RCYA 3IKJA 1E2IA 1M6NA 4URWR 1S4QA 2QP9X 3CRQA 1KK2A 4TT3A 3RDPA 3WYGA 3CZPA 3GJ3A 2GZAA 4PPGA 3RC3A 1IJEA 1OV4A 4EFLA 4OQNA 1KSGA 2F9LA 3D8BA 2MSDB 2V1UA 4IEIA 3WP1B 3RS3A 3PEWA 4MRVA 1MO6A 1RRFA 2J7KA 4JYCA 3TE6A 3LBHA 1CJMA 2WHXA 2ZRKA 5FPYA 5KNBA 1N6KA 4UXJA 2I1VB 2GEDA 5FH9A 1KAGA 3QY0A 3SYNA 4NCIA 2WJVA 5CIQA 2KI5A 4MQBA 2QENA 4Z51A 1XDBA 2WSSA 4W5HA 4OYHA 2PLFA 1YRAA 4S35A 4FN5A 2FFHA 1CKEA 4P31A 4EPWA 1IN4A 2Q9CA 3CR7A 2J7PA 2WAXA 4BFXA 4D81A 1OH7A 3EIHA 1ZCBA 2OEPA 3U2QA 4Q1AA 1KI6B 5EQTA 2G3YA 2DFTA 3U61B 3THYA 1IN8A 3AP3A 2CNWA 4QHTA 1AA9A 1E3MA 2ZSDA 2NG1A 2HXSA 3FMPB 1W36C 1J70A 3OEHA 1LV7A 2IYSA 3BFVA 3A1WA 4HYYA 1XJCA 4QGHA 3PCRB 1OYWA 3HYTA 2CK3D 2ZU0C 4Q48A 4GI7A 4V0LA 3FHTA 2B21A 2FWRA 1Q0UA 2WJGA 2ZRCA 1OFHA 3SQXA 1F2TB 2JJ1D 5HKKA 1MO3A 2QPTA 5GJBA 1G3IA 2C78A 2RMKA 3NC1C 4TL7A 4ABYA 4YQFA 4Z8YA 4HDOB 4MRNA 2ZYWX 3I61A 3DHWC 2QQ0A 3RRNA 2X77A 4LBWA 3VHLB 3ZLJA 3I73A 1D9ZA 2CLDX 4DVGA 3FE2A 4ZKDA 1ZU4A 1Z6GA 5G40A 1JALA 3MMPA 3EC1A 3OEED 3Q72A 3N2IA 1MKYA 4UKDA 3GFTA 3WYAA 1RRCA 2EFEB 4JVLA 3P1JA 3EPLA 4P0TA 1OH5A 1PVOA 3IIKA 2KSQA 3CRMA 2F7SA 1ANKA 2JATA 2HYIC 5SZJA 2PMKA 4TL6A 2BOVA 1DAFA 4M21A 4MYHA 4RKEA 4LI0A 4BFWA 4LYFA 2NO9A 4NZYA 1MR3F 4OQXA 4B3BA 3OIWA 1XMJA 5SZIA 4JZKA 1W0KD 5AJXA 1SVLA 1OT3A 1E2DA 3QEJA 4Q7MB 2G77B 3AVXA 5J4YA 1XU4A 1UADA 4A1FA 1COWD 4LOAA 1PLKA 1DE0A 3KJGA 1OJLA 1E9FA 5AUNB 3TVDA 3CPEA 3VR4A 1RRPA 2OUKA 2XZPA 4FINA 1HT2E 4QRHA 4UJ5A 3KQKA 3P27A 1LF0A 3ADCA 2CL6X 3GFOA 1OKKD 2HUPA 2F1IA 2PEYA 2RGAA 4EAQA 3CX8A 4OQFA 4JLMA 2IYTA 2IEZA 1OLOA 2AN9A 1G41A 2BWJA 1CBUA 1S2MA 4HLUC 2BKEA 3CIOA 3O8DA 3QF7A 4KLZA 5CIWA 5JMTA 5KSOA 3EXAA 3CX6A 2ZRFA 3BB4A 1OYYA 3LVRE 1E2FA 2ODBA 2VEDA 2Z0MA 3KJHA 1JQJC 4XWAA 2P2LA 1KGDA 2OBLA 4HI0E 1CR2A 1XCPA 1GSIA 4QJ4A 1G3MA 3QPUA 4LBZA 5C2JB 2VHTA 2ZRAA 3DDCA 3A4NA 4NCNA 4YMWA 4I1VA 3VNVA 2V55B 4A0FA 3TUIC 2PCLA 4LYHA 3UMFA 4EPVA 1BYUA 4DDVA 1FTSA 2IYVA 4I1SA 3REFA 5CLQA 1GM5A 4BECA 1GITA 1WQ1R 1WCV1 2F3RA 3CRW1 4JLOA 4Q4HB 5GVRA 1XRJA 2J1LA 2AFIE 2HDNB 4MYTA 5EE3A 3EIQA 1KI3A 2J5XA 2VHCA 5DI3A 5JLJA 3NEJA 1GZSA 1Z0DA 3K0CA 4H1VA 2JJ1A 5HKKD 4W7SA 1T8TA 3RS7A 3WNDA 3AB3A 1W5TA 2V4ZA 2AKYA 3IPXA 1O87A 1YZGA 1JAHA 5KPJA 4PHTA 4ZCLA 2JLUA 1RIFA 2Q0HA 4URUR 4NL4H 3KXIA 3L0PA 4XWKA 2VHUA 1N5LA 4POAA 1VCOA 4II7A 1YZTA 4C0LA 1W1WA 5L3RA 2EWVA 3FKQA 3WNBA 2JLQA 4LJ5A 3K8YA 2ATXA 1VPLA 4LHXA 3BC1A 2GEUA 4BLPA 4GSYA 1V5WA 2ODEA 5BN5A 2VP6A 5IT5A 2EYQA 1CS4C 2YOGA 3OIVA 5FOXA 1R8SA 2QNRA 1NL3A 3DVLA 1D6JA 3BD9A 2H5EA 4A36A 2GESA 1UDWA 1U99A 3H4MA 1U2RA 2FPKA 3QBVA 3CUEF 2OAQ1 4M4SA 1PLLA 1Z2AA 2IXFA 4DCTA 1L4UA 2IEYA 2EVWX 5D3QA 2OESA 3MD0A 4HB2A 1KKLA 1ZUNB 1F3OA 4Q18A 3ZZ0A 4Q9IA 2D2EA 2BCGY 1TMKA 2WKPA 2XB2A 1P3JA 1MABA 4BEBA 2OHFA 1T9HA 4TMZA 4EJSA 1FNMA 1YJ5A 3T15A 2ZVPX 1W44A 2IYRA 1W47A 1TNDA 3EZ7A 2FSFA 2J45A 1C9KA 2BIFA 2WWXA 1YZQA 3WP0A 4AKGA 4Q66C 4KVGA 2GWHA 3U5ZB 1W4RA 5E3HA 1OH8A 4PC2A 3QKTA 5L3VA 1U9IC 2JLWA 2HJGA 1OPXA 4NBSA 4WXPA 2QT1A 2GCOA 1T3LA 3GLIB 1UBEA 2BJVA 5F98A 2UKDA 2NO7A 2EFCB 3K1JA 4M53A 1JR3D 1KK0A 2ZSAA 3H0KA 3X1DA 4U7DA 2A30A 1YHNA 1SKYE 4HATA 4L16A 2QTVB 1FQKA 3HU2A 1VIYA 3ZD6A 2F6RA 4KXFB 3RSLA 2QPOA 1II9A 3TQFA 1HE1C 2GTPA 3TKLA 3PITA 4LY6A 4GZLA 4DCUA 1DG1G 1X6VA 3K0AA 1AQUA 1QBKC 4KJZA 4DLTA 4IDHA 4LJ8A 2GK6A 2Z4SA 5DLQC 5FPKA 5EE9A 5JI3E 4NTZA 2R8RA 1BIFA 2DYKA 3Q8XB 1VKJA 4Q4JA 1E9DA 2AHOA 2XJ9A 2PBRA 1XFAA 5AWFC 5GADl 4QC2A 5C4MA 1D2MA 3G0HA 1R8QA 1W5SA 2O8DA 2CXXA 3H84A 4I99A 1HUQA 3DOEA 3AUXA 3B9QA 4FCWA 1XJ0A 2O0JA 1S1CA 1IBRA 2ORIA 1Q12A 2QP4A 5DYIA 5E7MA 1Q3TA 4YONB 4G5QA 4DWJA 3AEZA 2V6JA 1GWNA 1LFDB 4ERNA 4B2LA 5DSZA 4LRWA 2WPDA 4B3FX 5HPYB 3U3JA 2JAQA 2ZI5A 1TTTA 1FNNA 2NQ2C 5K8IA 1GTVA 1GL6A 4XIGS 1P9RA 3TR5A 2ZRJA 2CEAA 2GETA 3SFVA 3FWYA 3PEVA 1XXHB 1X1SA 2B7CA 4A9AA 3KJEA 4OBEA 2R6CA 1I4LD 2IYUA 1DADA 2H16A 2C9OA 3OFND 2HXYA 2DHRA 2QMEA 3HWSA 4OK6A 3QIAA 1E2GA 4DLSA 4DHEA 2NIPA 2OBNA 1MT0A 4EQ6A 3LX5A 2HJVA 1Z08A 1E2EA 4A8JA 2G0NA 4WA7A 5TB5A 1VCIA 3ZS9A 2QBYB 3PQCA 1F60A 4HDCA 2YINC 4AWXA 3A4LA 2ZTSA 3EZ6A 1RPZA 1M8PA 3AQ4A 1M74A 2PZFA 2RAPA 2OT3B 1GILA 4A92A 5KDOA 3W90A 2NZJA 3CH5A 1R0ZA 2WTUA 3ADDA 2QE7D 4JVNA 3B8HA 1X1RA 2XOKD 4AURA 3KDSE 1NVXQ 1XEWY 4PFSA 1RKBA 4JLNA 3V4FA 2XJ4A 4TSFA 1G64A 3C8UA 3NKVA 5JSZB 2FGJA 2EW1A 3FKSA 2PJZA 4FMDB 4GPTA 1II8B 2FJUA 4ZDJA 2RKOA 1KO8A 1COWA 1I4TD 3O8CA 3A58B 4MGKR 3C5CA 2PX0A 4Q00A 2RGEA 2JEOA 3D3QA 1ZYUA 2GCPA 1S9HA 3ZQJA 1T6NA 1ZNZA 2IW3A 2J59A 4LCBA 5IK2D 2RGNA 3LLUA 5EE5B 1B23P 2ZYTX 1UBFA 4PR0A 2XTZA 1HE8B 2FPLA 3PV0A 2DPXA 2RHMA 4DLYA 1E94E 4RFVA 1P4SA 1XP8A 3B5JA 3F8TA 1FX0B 1O3YA 2WKRA 3NC0C 1X8JA 5LPNA 4AIIA 821PA 3I62A 3HDTA 3BFXA 3CO5A 3KFVA 1HV8A 3KTAA 2IUUA 2QU8A 1NVVR 3MWKA 1Q1BA 3SBEA 1P5ZB 3SHFA 1DAHA 3FDIA 5J40A 3VU9A 1OFUX 3NTUA 3FMIA 4BFZA 4O3MA 4DSNA 4TSFD 3C7KA 2PZEA 4DUGA 2V8OA 4OJQA 4TWZA 5BN3A 1NLYA 3DM9B 4B35A 3IPYA 5KHOC 3Q5DA 1Z07A 5EZ5A 2Q3MA 1TF2A 3ZH9B 4ACBA 2CLCX 1Z63A 2J0VA 3LVQE 3NWJA 4TL8A 5AJYA 4ZDKA 3U6BA 3I72A 4N0EA 4RVCA 4KBGA 5H70A 2V6IA 2CCGA 5LB2A 5J4LA 5IK2A 2J41A 1T5LA 4AYTA 2HEIA 4XH9B 1KI1A 4U5XA 5GJCA 2B92A 5BXQC 4TMKA 3EZ2A 1W36B 2VTKA 4TQAA 3W3AA 4PQFA 1NN1A 3TH5A 4CDGA 1A1VA 4OHYA 2XTNA 5FUWA 2DFLA 3M0EA 3A37A 5CJPA 1GNQA 3HR7A 3L0IB 4ASUA 4D4JA 1R5BA 1ZM4A 2DWQA 4ITRC 4PANA 2ZSBA 1AKEA 1D9XA 1QF9A 4QOSA 1ZD9A 1E2LA 4IDOA 5JCZA 2IC5A 4GDFA 1JPNA 2ZSEA 4QJ3A 5JS7A 4MUAA 1G7CA 2ZUCA 4B6FA 2CBZA 4MGIR 1W4BA 2FEOA 4IHQA 1G4AE 5E95A 3QF4B 3B60A 2HLDA 3VX3A 1CR1A 1US8A 1H65A 2X1VA 3N5CA 2GXQA 3CWQA 4DLWA 2C9CA 1Z8FA 4QFMA 1FX0A 1VIAA 4ZKEA 4O2LA 5FBWB 5FR2A 3W9YA 4QBHA 1V43A 3HJNA 3QBTA 4PZYA 1CJUC 1N6IA 4JLPA 1A82A 4LPSA 4XTCS 2A5DA 4AG5A 4BZQA 4DB4A 1GDDA 1KTVA 2EWWA 2BKUA 1XXHE 2GZDA 3RS4A 1AS0A 3BH0A 2XSZD 3ZQ6A 1E9AA 4MITA 1WA5A 1IN5A 5JWRA 2O5VA 3CKLA 3J81k 4V0NA 5DHAA 1M7GA 5FR1A 4Q19A 4OK3A 4MKIA 4OK5A 1TUEA 5CB6A 1A2KC 2ZE7A 4UNNA 1NF3A 4O2RA 1IQPA 1YZKA 1SXJD 2D2FA 2DY1A 3NDPA 3U3MA 1UKEA 4M2LA 3L82B 3LV8A 2ZUDA 4IKEA 5KSYA 2RGXA 3IQWA 2HT1A 1N3BA 1OIVA 4UJ3A 3ZYCA 1WF3A 2C95A 1W46A 3QE0A 4E09A 5FBVB 4JLDA 3UPUA 2BBTA 1KJYA 2FSHA 2FMXA 1IM2A 2FFQA 2HF8A 1U8YA 2HV8A 2OXRA 3ZIAD 2VPPA 2ATVA 2Q3FA 1RFLA 3REGA 3NH6A 3TSZA 1XEXB 3DPUA 3QG5A 1HTWA 3T61A 2F43A 4EQ6B 5BW8A 2WJIA 1F2UA 3HPRA 4FMBB 1N5JA 4FMCB 4TYPA 1TADA 4Q01A 2QAGB 4X8OA 1SVKA 1YVDA 3X1YA 3SJZA 3EPHA 4LJ9A 4G0NA 2YC4C 2A5GA 2XITA 4IOLA 4TN1A 1UKVY 1WE2A 4A8JC 1AZSC 3L8YA 2XX3A 1ZU5A 2ODNA 2QI9C 3PUWA 4MKGA 4PPFA 1OHHA 1EFRD 2OFOA 3LAWA 3FB4A 4YLGA 3VAAA 2CHGA 5DO9A 3W6OA 2JGNA 2YOHA 4HAXA 4PO1A 3TUZC 3L43A 3K70D 3ZDQA 2JIZD 1II0A 1US8B 2NPFA 3IBGA 1KI8A 4RY2A 3ADKA 3I5XA 3BS4A 2IUTA 2J87A 4TQ9A 4C0KA 3GP8A 2IS1A 4OI1A 421PA 5KUTA 5HE8A 2YKGA 2JLYA 3LXRA 3C5HA 4G1UC 3GLHE 1AS3A 1JJVA 3GMTA 4TLEA 4FCVA 1WMSA 4LDJA 5FOWA 4PC3A 2IF0A 2RGNC 4JL5A 1EFTA 2IK8A 5CJ2A 4KFUA 4C0BA 2H18A 2BJWA 1J8YF 1G5PA 2VSXA 5J4HA 1P61B 3AVQA 4HAYA 4LGMA 4G5RA 4LJ6A 5SZHB 3EIEA 5JJLA 3OAAA 3U7GA 2ZI6A 1LB1B 1KOFA 3F0TA 1UEJA 4JL6A 4ZI2A 2Q21A 1XBTA 1UBGA 2ZAMA 1E0JA 1GRNA 2VP4A 1FPMA 4IW3B 2ZU6A 1XMSA 2XXAA 3RYTC 1G5TA 1D5CA 3VR3A 3GLHA 2CJWB 1E2JA 4Q4JB 3RRYA 3ETLA 1VG0B 4MRPA 1CP2A 1NBMD 4KCGA 5FPHA 3NDBB 1SXJB 5LDDC 4Q1DA 5EUQB 3U3KA 4LHWA 1P2UA 3VTKA 3RNLA 4BEJA 2ZRBA 4RD6A 1P73A 5B64A 1G8HA 1SKQA 3GEEA 5FPSA 3TAUA 4C0AC 5EZ6B 1QZXA 4EUNA 5TY0A 4DEYA 1JI0A 4L8GA 2ZROA 4PPQA 3K09A 4Q47A 2W2XA 4CYMA 4DSOA 2VL7A 3HR8A 1NIPA 1U94A 1IAQA 2IS6A 4M1WA 5CK4A 1TU4A 3K53A 1ZM9A 5FPTA 1FP7A 1NSTA 2CVHA 1OB2A 1XTIA 4D82A 2OZEA 2SHKA 4EJSB 2BMDA 4HLCA 4PAQA 4MYCA 4IFEA 1MABB 2W6JA 3X1ZA 4C2TA 2WPDD 2CHVA 2IYQA 1NNEA 1H8HA 1PZNA 1GOTA 4XD7A 4G5GA 4BLRA 3QKUA 2BBOA 3GFPA 3B7GA 3X1XA 3RANA 3IIMA 4Q7KA 2R6GA 1R2QA 3BB3A 4Q1CA 2ECKA 1U0JA 1M7HA 1BO6A 2NTYC 5F9HA 1AGRA 4M0LA 5DHFA 2D7CA 2LCFA 4TMTA 1F5NA 5BQ5A 1A5TA 3R7WB 1DVRA 1JR3A 1VTKA 2WWIA 3MCAA 2FH5B 1HA3A 2F1HA 1P6XA 1NBME 3LA6A 2NMVA 3E2IA 1W48A 1HEIA 4IDPA 1E99A 1N6RA 1T8UA 1ZC3A 5FBQB 1GG2A 4Q4HA 3RS5A 4NDZA 1KO7A 1G18A 1OW3B 2ZRMA 4JLBA 2JIZA 3IILA 2BEKA 1Q21A 4XTRA 2W0MA 1QHXA 2WWWA 2Z83A 4CRWB 2LKCA 2R6FA 3CNNA 5F3WB 3EASA 2DB3A 5KDLA 1D2EA 3THWA 4DSUA 2QAJA 2ZXUA 1Z28A 2GNOA 3QG1A 4U02A 4JMPA 1TAGA 1DEKA 2CVFA 3LQRA 4JKYA 5GJWC 2IXEA 4IDQA 3SOPA 4LV6A 4CVNA 5DN6A 1PUIA 2GF0A 3OHMA 1U0HC 4HB0A 4DIEA 2ONJA 1RRGA 3SE0A 1U98A 2W6IA 2IWRA 2IA5A 1J99A 1A2BA 1NIJA 5P21A 3GLGE 4HDQB 4V0ME 5TXGA 2FG5A 3R9XA 4JJZA 4W5JA 4JLKA 2IF2A 1NLZA 1F6BA 2ZIAA 2QSYA 5EXSA 3TW8B 2YWFA 3A1TA 2IHBA 1QHGA 2GCNA 2E87A 3THOA 4B34A 2GZHA 4DDWA 1CLUA 3MFYA 2OV2A 2ONKA 1EESA 1YQTA 1KY2A 4B44A 1E2PA 2YWEA 2P5TB 4TMVA 3LD9A 4ILEA 3UK6A 3BH6A 2ORVA 2AK3A 3U3RA 4JJKA 3W5JA 4EFNA 4M9ZA 4P4TA 3WYFA 1KMQA 1JECA 4L4UA 2V7QA 4KI0A 4DT1B 121PA 1W0JA 1UBCA 2BMFA 4WXRA 2FEMA 4WZ6A 2AXPA
chains in the Genus database with same CATH superfamily
3L8HA 3H42B 3UQZA 4QX6A 3KJZA 3GF4A 4RZHA 3TTSA 4B8YA 5KC8A 3ENQA 4F3RA 4PHHA 1Q57A 3FDZA 1KFEB 2E5LB 3F3MA 1UMBB 1J06A 1H66A 1WKBA 2D06A 2QXTA 3H99A 2L19A 4X20B 2YWGA 5DP2A 4N5IX 4RXMA 1Y9ZA 5TX7A 1GKIA 4J03A 4P82A 1KFCB 1RJGA 5A71A 5I3ZA 2JJ2A 1RHQA 2CDNA 4HBGA 1KS9A 1LPMA 4XARA 3OFKA 3T0IA 3SJ7A 5DK4A 3N7UA 1JYSA 5BSFA 1SCUB 4DIMA 4P7GA 1H2ZA 4MUEA 3BBPA 4IR7A 2PQ2A 4EFKA 3PT5A 4PG4A 2C3YA 4YMTA 1XZCA 2GN1A 4MSUA 1J8DA 2V5UA 4TLLB 1MJGM 1NQVA 4Y1RA 3WLIA 1R5NA 2JGDB 1XGKA 3V34A 2V1XA 3I0ZA 4KX5A 2ZT7A 4WCFC 1RHUA 1Z4QA 1N5KA 2DPHA 4GMXA 4RK1A 3SNKA 2M6SA 2PL3A 4HRYA 5LP6A 2ZJ7A 3AXSA 4DF3A 3DZJA 3JQGB 2JAOA 2OMEA 3ID6C 4R3UC 1YJCA 3AERA 3AR7A 2P6UA 2WWHA 3GQVA 4FUTA 4PCAA 3A04A 4QUDA 4HJRA 4H1HA 4RIIA 1YJQA 3RJZA 3WJ7A 1X19A 4EVIA 5A5GA 5B1HA 1V1JA 1WDWB 2DUJA 6Q21A 2EJBA 4HF7A 2R00A 5JJ5A 1H1LB 1U2GC 2QEQA 1FW6A 1IXYA 3MUEA 1E4EA 1IY2A 4JI3B 4Z53A 1X7XB 4W63A 4Q1BA 5LN1A 1CS0B 2XV1A 2FSIA 1JLRA 2JAXA 3AJ9A 3AEKA 2XMQA 2NXEA 3AY0A 3CB2A 3CGWA 3LNCA 2EERA 4I81A 3MB8A 3A4MA 3IKMB 1F4LA 4R4JA 3UXMA 1QORA 3KE8A 4D26A 4ON9A 4O4LA 5JW6A 1FQOA 2O3SA 1SXJA 4FYXA 2YR0A 2EFYA 4ZC1A 2OFXA 2AX4A 1QIDA 3AVTA 4A1OA 4L8FA 1S3GA 4REQB 4ZRNA 3KQNA 3QU9A 2C9ZA 4JS0A 1E1CB 4Q4AB 1Z2EA 1YZUA 4MXDA 2REOA 4KPUB 1FQJA 1QIEA 3DDHA 3AV0B 4YTEA 3R7LA 2X7HA 2CJFA 4BFCA 4CM9D 3DXXA 1AX9A 2HA4A 1YIDA 1NG1A 3R0JA 4M1MA 1R4MA 1RPJA 3DCNA 2HCJB 1PZMA 2OWDA 4YJKA 1B6TA 2VT6A 5KX5A 4ER7A 1C3VA 1MNAA 3IP6A 3Q7QA 4FZRA 5D51S 5EJFA 2C98A 3SR3A 4CQJA 5BYKA 2H1LA 1CY7A 4RZXA 5DWQA 1IIBA 1L7VC 3O21A 4IOJA 2D5LA 4R2WA 1Z25A 2QN3A 3G2MA 5KJEA 4DMGA 1YNSA 4ZODA 3AVUA 5L3SA 3S8EA 4YAIA 3K09C 1ECPA 5CDHA 3O8RA 1I4WA 1U8FO 1CE8A 4BVLA 2YUTA 2J30A 3DE0X 3LW7A 3S2GA 4BAUA 1X80A 1Q20A 4HLNA 2VLBA 3E7XA 5C37A 5CDFE 2W42A 4IGFA 2CJWA 5F5NA 4C3VA 1VJCA 3NHZA 2C84A 2C2OA 3J80A 1YGYA 2CKMA 1P6QA 4JBNA 5LP1A 3GUHA 4WN9B 4E07A 5BRAA 2GAOA 3OEHD 4TUYF 4YBZA 3ZTTA 5BNFA 2OAP1 1H0KA 2XTJA 3R20A 3AM3A 2RJOA 2O0HA 1RACA 3GEMA 2EGUA 2VHEA 4GOJA 4JENA 3TQIA 3CF2A 5G41A 5C5EA 5F3RA 3PI6A 3CRVA 5AW2A 2H9IA 3VZBA 4UMDA 1ZEJA 1AHPA 1H6AA 3WGUA 5AVWA 4CF7A 3N8HA 3KUKA 1OZFA 3JVVA 1MW9X 1NZDA 1TCUA 1R5JA 2FUCA 2QRKA 4FNGA 5ALIA 2F3QA 1AE1A 3FN4A 1TTQB 4FXOA 3WO0A 1C4XA 4BHTA 4ZV4A 2BL4A 3L8EA 1D0SA 1DTWA 1Q91A 4PGAA 2ZXFA 5FULA 4GSLA 3IQFA 1T2AA 3LM8A 1E1RD 3KSRA 4I66A 1E6WA 5JJIA 3EZXA 1PJQA 2VHJA 3AF1A 4HWKA 4IJ6A 4PY2A 4EZEA 1KMHA 3HM9A 5E3IA 1V48A 2WQ6A 2WAYA 1XU9A 2ZSFA 2SKDA 2QN2A 1JW9B 5E6RA 4C7OA 1K8YB 1GSAA 1JQEA 2E21A 4JB2A 4JOCA 2XNJA 5D6OA 4OJKA 1O4VA 2QVGA 2WZQA 3BMNB 4JYBA 4YECA 2CCKA 3T41A 1PNRA 1XCMA 4HZUB 1BHJA 1UK7A 4HDKA 1LQ2A 1EP2B 1QE5A 2QL5A 2Z8YA 4HPXB 4IV0A 3QKSB 3VHXB 4D4IA 1VHQA 1WVMA 4ZGGA 2VSFA 2CC2A 1HQDA 3E9RA 5C35A 3ORYA 3RROA 3DLCA 3K0BA 3WGQA 1VG1A 1I94B 4KVAA 4IIYA 2NO0A 3U44A 1R6TA 5FOSA 1AOXA 4NOLA 5KS2A 1ZW1A 4EA9A 2ZXEA 3FPHA 3OM9A 4M76B 4QDTA 4AY2A 4E5PA 1CC1S 1W7AA 1TQ4A 1QHYA 3IEMA 1MEEA 3KT8A 3N8NA 1V7ZA 2QLBA 2X19A 4PBTA 5LQAA 2PLAA 3ZDZB 4JR2A 2VYQA 5JAQA 2PSEA 1IXKA 1ZH0A 4Q3KA 3OY7A 1X0VA 3PHGA 2CY0A 1H05A 2AF4C 1XO1A 5KYYA 5TV2A 4TTQA 4D0LB 2CCJA 5DOZA 1BOFA 2FX3A 1R0WA 2FN3A 3KBBA 3CCFA 1GNLA 2B34A 2W6ID 4V2UA 2G28A 4CGZA 2J33A 4XRRA 3GCWA 1ZD3A 3HCAA 1M0WA 1SRRA 1OKKA 3IR6A 4PYLA 5AVYA 2Z5LA 2EKPA 4C4OA 2NVUA 3WMRA 4W8GA 5ALSA 2NNLD 4WMLA 2AR7A 2WFMA 3F9RA 3V4RA 1I2BA 3PTLA 5JCJA 2MMCA 2WIDA 5KTSA 4D0GA 3X2SA 1BA3A 2OE2A 3DO8A 3URMA 1Z2PX 3I2HA 5I4CA 1ILEA 2FFAA 2AI2A 3GZNA 4M9XA 4MLDA 4NKRA 4O4JA 4QNMA 3VI3B 3ZXYA 1ORIA 2NYAA 2YWBA 1PBNA 3LT0A 1BFDA 1WV0A 4HGRA 3Q2KA 2QGFA 4B6GA 4YAKA 3U56A 4N48A 2BGJA 3EWNA 2CVZA 2JFQA 1ABEA 2UXDB 3BEOA 2JFPA 2AN1A 4HRAA 1IHXA 2HZBA 5I8ZA 1JDJA 2G8LA 2IHJA 4CL8A 5CFMA 4XGKA 5BOVA 5KTTA 1I51A 4I5DA 4BNUA 5A4JA 2K5UA 4OXYA 2PPLA 3QXJA 2WTXA 5EMMA 4RQUA 2OXIA 3W78A 1SULA 2J3KA 1W49A 4HDNB 3SR4A 1YJAA 3F90A 1VMDA 2AN4A 3E9CA 3M6AA 3GJ8A 1L5WA 3HBNA 4IH9A 3RH0A 2P3LA 3ASZA 3EVFA 1ZK2A 2O2DA 1J0XO 3IMFA 1ZGJA 3KQOA 1FW8A 3GT0A 2X40A 3LFUA 5E3JA 1ZPDA 2W90A 1XFDA 4JNCA 1NUSA 4GPAA 3UFBA 5C1IA 4QULA 5F3DA 3T3MB 1CUWA 3TLGA 1KP3A 2JGKA 4YMHA 1CUFA 1A8SA 3SEQA 3O8BA 2P90A 3DYVA 3GNTA 4IAOA 1E2BA 5BN4A 2RGYA 1KDZA 4MB2A 3GAZA 1VXOA 3QFTA 1DNPA 2AGVA 2G4CA 1NFFA 2XMZA 2ZPAA 3RSOA 4DW8A 1PV4A 2G67A 4K6MA 2RHGB 3H1FA 2R8BA 1XLVA 3TLXA 1TJYA 4C43A 3KFLA 3BHIA 2D8MA 2I6SA 3QVGB 2Q2OA 2C4TA 1P7PA 3EGDA 4ZK6A 4R7ZA 3LBIA 4Y6PA 1XNGA 2IEGA 2M9MA 4C7KA 2SECE 1W29A 1XD2B 4QWMA 1I2ZA 3JQEA 4W99A 3T4PA 1EWVA 3QV1A 4KU4A 4ZU3A 5K51A 3R1IA 1V39A 3CVOA 1GU7A 4HX9A 5ALEA 3ZLVA 4YX9A 2HNKA 1BH2A 2WVGA 4F86A 3MTAA 5AKKA 4I4NA 1T4GA 3AJ8A 3VR5H 4CIAA 4RJ2A 4KDRA 1CZUA 5JDIC 2YYYA 1SPBS 3VDRA 4KO4S 4NBKA 3C6XA 5KTRA 4OJMX 3BA6A 3OZEA 4ZC8A 4J3JA 4YDRA 3EGXA 3ZGOA 2P3SA 3ZJYA 1MXHA 1N3YA 4DG5A 5CFZA 2CNLA 4MWBA 5KPDA 1C7JA 5LVAA 3RTCA 3GVPA 3JQ8B 4QXPA 4G97A 2W93A 3TMYA 4DVJA 1NQWA 2W6NA 3HP7A 4HRXA 1WUIS 2BF7A 2F9MA 4IKOA 4PG5A 4ZCIA 4ZJPA 1LBQA 1OWPA 5JBIA 1R3DA 1JDBC 3GD5A 5K3FB 5JVDA 4B3TB 2ODPA 2HRQA 3CG0A 1ENZA 1HFWA 3D9QX 2OBBA 3GA7A 4K1XA 1QRDA 4IDGA 4OO3A 3G5UA 3OD1A 5TQ2A 2J0EA 3WQRA 3OCWA 4JKIA 3BE4A 1CNMA 5IDQA 1T91A 5KNCD 3QW2A 1DIAA 4DBVO 4B87A 2HHLA 2E0IA 3ILYA 1SC1A 4ZV9A 3Q7EA 4ZZ1A 2WSSD 3VNAA 3VPXA 3BQNB 4R2HA 4V0KA 3ZVKA 5IHPA 1LPBB 5LOVB 1NBOA 4LZJA 1JYEA 5JO0A 1KS2A 1ETHA 1FUKA 3FPCA 1RMQA 5K0LA 5EHXA 4WKGA 1ZUHA 4XJVA 2B1RA 3EGXB 2WF9A 3D6HA 4IQ4A 1SFRA 1ZIPA 3NM6B 4WA8A 4BNIA 1OREA 4L6AA 4KV9A 3TJRA 1JKJA 1V8PA 5CD1A 1K6MA 3EIXA 3O2QB 3NH9A 4HXYA 4YGYA 3C4VA 4OM8A 3PUYA 4MVXA 4BTLA 1G8PA 4KR6A 1PR5A 4RQBA 2QX9A 1OV6A 4MRSA 1KEZA 3LIIA 4OA8A 1I0IA 3INYA 4LYEA 3EIWA 3HCCA 3V4LA 1JJBA 1NLMA 3H9QA 3S2EA 4JSYA 1CNEA 4INOA 4TV9F 1GKKA 1WF6A 3Q9UA 1O96A 1W30A 4XA8A 3R76A 3QUQA 1KJ8A 1NFRA 1MAUA 2O07A 3QTTA 2WR8A 3LZCA 4D56A 5HHTA 5I7UA 4JC0A 1Q3KA 1EFHA 2LTAA 2WOJA 4XB6B 2VAMA 4KN5A 3T7EA 2J3EA 3WGMA 2NO6A 5YASA 5IXJA 3O7WA 4OLBA 3EA0A 2QBYA 3JZMA 4HOYA 1U7OA 3BWDD 3FFTA 2F48A 4DJFC 2O57A 1N0UA 4WX2B 1U90A 4PVDA 3HVRA 4PE5B 1R9MA 2YFQA 4MO9A 3QKRB 1C29B 1CQIB 4UU0A 2Y9PB 1QP4A 1E9CA 5E4FA 1MV8A 4BN4A 5CVJA 1FNDA 1H2RS 5KWVA 4P32A 3GLGB 2Q8PA 3HABA 4EGCB 4C5BA 4G2TA 3LC2O 1BW9A 3UIEA 4BFYA 3O84A 4QUHA 5DTRA 4X7PA 4NE2A 3SNHA 3KR0A 4LCJA 1OZAA 4EK9A 2NO4A 3HB5X 4RY9A 5LUBA 4XLLA 1OROA 4YYEA 3DAFA 4G0ZA 1JWAB 1JAXA 1ZOIA 1BXKA 1AF4A 2J5BA 3DFMA 4MVJG 5TVGA 5BN4B 2HH9A 3RRMA 3T1QA 3WRYA 1CPYA 1WG8A 3JVUA 5REQB 4RHEA 4TRMA 3ZVNA 3O95A 3DCYA 1WMFA 3HUDA 1JA1A 2QAGC 3OKPA 5EYPB 4E03A 1EJ2A 1RWPA 1T0HB 2ZE8A 4NCHA 3MK31 3DL0A 1C1YA 4RJIA 5CK5A 1BZYA 1PO7A 2WA2A 2ZTHA 4Z0NA 1ZGHA 2BTQA 1X7ZB 4OHZA 2EP8A 2VNKA 5G0SA 3VOBA 4QELA 3SF0A 1XWIA 1RVV1 4JODA 1V1RA 3IQHX 2Y6UA 5IDVA 1XNQB 1RLIA 4Y1FA 1FVHA 3EAQA 4CLOB 1E3QA 3TL6A 4LF6B 4CKBB 4ZGBA 3WGJA 3MGCA 3NAGA 1SU7A 4K9KA 2WWGA 4B1FA 3ZDDA 3OH8A 4HH4A 5K0ZA 2VJMB 3FYTA 4GKJB 1DFIA 2OXTA 1X80B 2FLKA 4RV9A 4CKWB 1EIZA 1XUOA 4LC9A 4JXJA 4KXWA 4BNLA 1TB4A 1E2HA 1S01A 1VYUA 2QLNA 3H1PA 3EXEA 4LZLA 4IIUA 4WEQA 5A0FA 3S5JA 1DRJA 3NBKA 5A4MS 3L7NA 1RBQA 3ACBA 4TV8F 1CF2O 4QICA 2E5FA 4TT3D 5CDSA 2OXCA 4RIFA 2ZCUA 5FWYB 2O8EA 3P4XA 3MSXA 4GXTA 5B37A 3K0CC 2BM9A 3HJAA 2FOLA 4MWGA 4RKYA 2XI4A 2E4YA 3PX7A 4HGPA 5IVKA 3OIYA 3VISA 3LO5A 5I7EA 2EX1A 5GIOE 1N9KA 4J91A 4G0WA 2IYPA 1Q7EA 3FZGA 4QYIA 3U44B 5B3JA 1JG3A 3R23A 1I7PA 2AA3A 3WLNA 1P2TA 1EI9A 2B8NA 2JGLA 2MSLA 2W6QA 4J6FA 3TL3A 3VA7A 1TX4B 3EYAA 4RL6A 2W2VA 1UXJA 1F3LA 1FLAA 2G17A 2G6TA 2QM7A 3ESDA 3NOOA 3EMDA 4QJIA 2PL5A 5LP6B 3ICOA 4QUJA 4HNQA 10MHA 3WYEA 4DPKA 1EUDA 1MO4A 2VIIA 1Y7IA 4W5WA 4ZVPA 5TGDA 5TPWA 1WTCA 1TL7C 1XZNA 2FWIA 2QTBA 3P2JA 2W83A 1RZ3A 4N3AA 3ROQA 4JB0A 3SICE 5HR5A 3BH7A 4RKFA 5F2OA 4INZA 2X5OA 2AZXA 1VHWA 1ECBA 1J23A 1G1AA 1Q0LA 2VHZA 4YFVA 3BK7A 5HCNA 1DRVA 4N39A 1N7GA 3SJUA 2IHYA 1XL0A 2HSJA 2REQA 1G4HA 2W8BB 3MWDB 4UCWA 4V1CI 2RGBA 1NMYA 2AE2A 5KEIA 2ZAOA 3NBFA 4XPIB 4D44A 2EW8A 1Z7GA 1M2FA 4RZUA 1S2LA 2Q4TA 4G67A 1L7DA 3DE4X 1D09A 3E3LA 1RYMA 2Z8ZA 5FJJA 5I7HA 2QTLA 2QD1A 1MVOA 1PX2A 1IHYA 3BQ9A 1ZNXA 1X14A 1X7GA 3MGGA 4YXWD 2TS1A 4N5NA 3OMWA 2I71A 4CKXA 5BV7A 4G1VA 7REQB 4D99A 1E3JA 1E9VA 4MQLA 3NFRA 5EZSA 4D8VA 2BN4A 3ICWA 3VOTA 5KINB 1LGYA 4R9VA 4B6PA 1BJRE 1JV2B 1JKFA 1RKVA 4HAOA 1FTYA 1NRJB 2ERXA 2WJ6A 3GIDA 4K88A 2HPAA 4R54A 4AK9A 1MBZA 2X8AA 4JH0A 1WCWA 4Y0VA 4FU0A 2BFBB 4W7IA 5FL7D 9ABPA 3COYA 4DJEC 4JMLA 3F67A 4UUAA 4UMVA 1XJWA 4FEGA 1XMVA 3O92A 2NTNA 1ZN7A 3PQFA 4BB5A 1FMFA 4JUDX 2HU5A 1JFFB 4XVCA 3QEAZ 5IYZF 3GNQA 3ZDXB 2GDZA 4DXAA 3HXQA 4N40A 4LE1A 3R8XA 1QGAA 3I05A 1M2NA 3V9PA 1J6UA 1IWBB 1JNXX 2JEZA 2QRNA 3LY8A 4FZ3A 3T3IA 4N41A 5KZMB 4CT4B 2NZ8A 3WLMA 1D2GA 2DWPA 4A73A 1RWMA 3QOFA 3HKDA 4UDXX 1LPOA 2G9NA 1TM2A 2JH9A 1WUKS 4QQFA 1I7QB 2ANCA 5FO0A 1C1DA 1X9HA 2QYHA 4ITVA 1MDFA 4PNPA 2HQRA 4EMSA 4V1CA 3OCUA 2I2CA 1CZLA 1WMEA 3A6EA 4NXNB 2G88A 2RI6A 4CR6A 2PFSA 3O9VA 4NBTA 3WAGA 1DG3A 2WMNB 4EGSA 5BR8B 3KQHA 1PNVA 1JAIA 3CLSD 3UCEA 1N1MA 3WLPA 2FDCA 1UJNA 4B40A 2CUNA 4HX5A 2WKSA 2XLCA 3A36A 1NNI1 4H7JA 4OI4A 3TFWA 2V98A 2P65A 2W4MA 2ZKIA 1KK1A 2V58A 2D5IA 1LDMA 4NYJR 1YRYE 3CNLA 4NU0A 4TZKA 4LOKA 4OG2A 2BKAA 4R1OA 1NVGA 1QX3A 3K1YA 4KQ1A 5J2TF 2C2MA 3LL7A 3VGPA 4FOSA 4YP9A 1PL6A 4NV3A 4CNBA 2W6JD 3B1JA 2B1IA 3COVA 5E9QA 5FBKA 3NYRA 4QO8A 4YJHA 2BFEB 1FTGA 3S2FA 4CMEC 3R7FA 3LC7O 3O74A 3FHOA 3R9XB 4J1SA 2P2GA 4YYZA 3KLNA 5ELXA 3IAUA 3QXXA 3WMFA 2WT4A 3SYRA 4U4AA 3QQPA 3ZCXA 3ZPXA 4IMIB 2VSOA 1VJRA 4BGUA 4AJ2A 3CVUA 1KIAA 1RQGA 2I5PO 4LC0A 4N01A 4US1R 1IONA 1T34A 1E98A 1Z39A 1ZUIA 1A76A 4LYGA 4BVFA 1Z56C 2B99A 4OMCA 1F2VA 4X85A 1L5NA 5KOJA 4FOLA 5FB3A 1P5RA 1UC4B 3UHPA 1TA9A 2R4TA 2Q3CA 3M89A 4P3OA 3RI3A 2J0QA 2BDTA 3HEMA 2HRCA 1PQYA 2ANBA 1GKUB 2XUPA 3RLFA 2E6UX 3PFWO 4EI9A 1EUDB 2CMKA 1OI3A 4AUNA 4A3SA 1WZNA 1FZTA 5DGCA 3OFNA 3PU6A 2QOEA 3C39A 3OE7D 4U1RA 5TDHA 2E37A 2WIJA 5LMCA 4MV8A 3RIXA 3RSGA 1S7CA 1TD9A 1J9EA 1YC2A 3AYXB 2H65A 1C0LA 2XUHA 1KZ9A 4JGGA 1YS6A 1BQ4A 2ZTLA 5EE1A 1LUAA 4B2PA 4ZYZA 2QMHA 4EF6A 3WB2A 3W6UA 1ZHHA 3QBDA 3DT9A 5FT9A 2YXNA 2Y8EA 5ADVA 3RS0A 3HO1A 2JDIA 2GOYA 5BRNA 3VYWA 4BQOA 1B1CA 2JB9A 4Z9BA 2A9JA 2B5OA 3U9SA 1X0XA 1NTOA 1TKRA 4QYSA 3VDMA 1XMOB 5A5FA 1Z83A 1BXZA 2PG3A 3AUKA 5AJWA 2I3AA 3UHJA 3PLAE 4L72A 2HBQA 4TXMA 3BOSA 3R0XA 1DLIA 1QAOA 1P6UA 1U28A 2EJTA 3THYB 4OH1A 2XUOA 1QTQA 4EO7A 3ASYA 1P7CA 1UFVA 1KYIA 1ZSNA 4IJVA 1T9GR 2C4KA 1SHZA 2KB0A 3L7LA 3T3EA 1BCSA 3C14C 3ITNA 4YPFA 4PSVA 4Z3KA 4LF7B 1OLSA 2FPGB 5KIAA 2XRZA 4AI6A 1DO0A 2A4KA 4D97A 3PC4A 4ZZ2A 3K35A 2C8VA 3VPCA 3CZAA 3WA7A 1ISMA 4X8MA 1J1UA 4HQOA 5HM8A 4L5BA 5IPFA 4I9UA 2NOAA 3TGWA 5JPIA 4KPFC 2FTKE 2DBYA 2GJ4A 2VJDA 2NZYA 2OCBA 3QXGA 4L4ZA 3TTXA 1H8ED 4AZSA 2NZUG 4D43A 2Q4RA 1X8KA 4AICA 3TSCA 1UBNA 2AWOA 2WFAA 3D0OA 1EE2A 3ROEA 1MHPA 3KAJA 2GXUA 4MRMA 5CPFA 1OILA 5EYPA 3ZV4A 3K5IA 1X7YA 1G21E 1JR4A 2W22A 4RD1A 4UU1A 5DI3B 4ALKA 1CDOA 2V9PA 4EY6A 1PT6A 5ES4B 3IH5A 3TWOA 3RRZA 3E9EA 3B6MA 1AS2A 1W88A 3L6RA 1SVUA 3H3JA 5BUQA 2FI1A 1JFFA 5FBZA 5FOVA 3IQXA 2WMOB 1OHHD 5HKLA 2IV7A 3W8RA 4QDKA 3PYXA 4IZIA 5B6JA 3F9IA 1U7HA 3O9MA 1NLFA 4RF2A 4RSGA 4PSCA 4YDHB 5AK6A 1B2LA 4C88A 2JJ8A 3KQTA 1S8AA 4AAYA 1N6NA 4XIIA 4DREA 3L7KA 4E14A 3WLSA 4EG8A 4HUQB 3K2BA 1UMCB 3GCGA 3A9UA 1GTRA 3EZ9A 3D6JA 2EJVA 4K6OA 2F67A 1W2WB 4ES6A 3T5AA 4NFHA 4AMUA 4B85A 3LWBA 4PG7A 7MHTA 3S40A 2PGLA 4KUEA 4XVUA 2H92A 3TW6A 2H2GA 1GUYA 2FV8A 1G1MA 4P7JA 3P32A 2ZI7A 3WRYC 2P0YA 1KRHA 4V02A 5AVOA 3O4VA 3TZLA 2OYRA 1HNWB 2H5LA 3AFIA 3LF1A 3K16A 2QYTA 3BIFA 3L1UA 3W77A 4GQAA 1AKYA 4HAUA 5C8VA 1OF1A 2D1RA 3A25A 3GMIA 2CZCA 4FNOA 3N7AA 1DBVO 2YNMD 1HE3A 1K2WA 3DMTA 1B43A 1SCQA 1KHTA 1L7RA 5CVCA 3IIJA 2VZ8A 3WQHA 1UMDA 5EIWA 2Q9BA 4H08A 2JZCA 4DIOA 4YRSA 2O1SA 2AMLA 2BH2A 1CUXA 2A6PA 4X41A 3T9CA 2NO1A 3QZUA 3TBKA 1LH0A 3EUEA 2IS2A 3LH5A 4X1KB 3PPIA 4H6VA 4LXTA 3N3AC 3QX8A 2REQB 1AGXA 1CP3A 3OTIA 2NU6B 3GLFB 1YGPA 3R24A 4UFPA 1NSFA 3PFCA 3DXZA 2GZ2A 1RQPA 3QEMB 2VWQA 3R0IA 1JIVA 3PKIA 1GSOA 4EGAA 5LNK1 1VZ3A 2JFGA 1CUZA 1A7JA 4Q9LA 1JG4A 1RYBA 2FZKA 2YRWA 2Z30A 1NI4B 2GN4A 4GQIA 4LE2A 4N9WA 3G8CA 3S29A 1UBUS 1XAGA 1Z7WA 5ALLA 3TQQA 5IKXA 4EY4A 2OENG 4TZ6A 2FQXA 1QM5A 2DR0A 2V5VA 4PZ9A 1OTYA 3NHKA 4UUPA 1ABBA 1X42A 2YOFA 3C85A 5SY6A 1M6VB 4CN8A 2CXPA 1A9OA 2OXFA 3T7DA 3B20A 4PQGA 4HGNA 4DR6B 1H0RA 3TXYA 1E9BA 3T94A 3U4CA 4E21A 1QK5A 1FFAA 4NH0A 1P9WA 4MVJE 1KEEB 3MWEA 4XYMA 2C8KA 3PPYA 4IO1A 4MV0A 4JOBA 1T2NA 3TLYA 2Z95A 1NF2A 3C16C 1K1EA 1L3CA 3M6XA 4Y2XA 3SQWA 2XZOA 2C4MA 3GOHA 3RWOA 2BW0A 5JVDF 1JJIA 1J2RA 1IPHA 1M1ZA 1XRSB 3IHLA 4BNHA 4XW2A 3X1KA 4KGXA 2DCMA 4JC4A 3T7JA 3VFDA 3F7MA 2CFSA 3CLVA 3JV7A 4NFYA 1PEKE 2ZRDA 2IYEA 1HX7A 5JD4A 1GKYA 4PAWA 4R5HA 2G8NA 2ZWIA 2Q2VA 3FFXA 4WJLA 3F1KA 3OZRA 4BLOA 3S1AB 1KORA 3NW9A 4TROA 3AL0C 3F2VA 4DLUA 2YV5A 4GZMA 4R84A 4LZZA 1ZBDA 3BTUA 4KDEA 1EGMB 4D9EA 4NOMA 1O2DA 3WISA 4F4IA 2HWWA 2PXCA 4X91A 5TRTA 1XTQA 1RM0A 4MI6A 4EG7A 3QVGA 1UZMA 5HZHA 2I8AA 2PBZA 4G5OA 4MKFA 1K8RA 4PG6A 4CQMD 1RAIA 2GSDA 4N8SA 3FKSD 1U04A 621PA 2O6HA 4WW0A 5HX7A 1TU3A 3LPNA 2GVDC 3K3PA 3QUCA 1SUFA 4NJOA 3L8DA 4M38A 4OXXA 1U1IA 2ADMA 1F8FA 1FUUA 2X6QA 3M1IA 5JSUA 4RLFA 1YDEA 5LQCA 4JBIA 4MW6A 5BURA 5ALOA 3WK9A 4WBSA 1XCGB 1GTMA 2V3WA 5ANRB 1IN1A 4TYQA 1KYZA 1JX6A 2ZE6A 3WXBA 1Q7CA 2QL6A 2Q5LA 1EP1B 1YONA 4Y9SA 4KEAA 3ZX4A 3N2EA 3O8QA 3Q3CA 1T3ZA 5AHKA 2WSYB 1TFUA 1V4BA 1YH3A 2GFQA 2LKDA 3JD3A 2CLOB 4JJIA 2Q1YA 4NPCA 1P7ZA 5DHUA 1JZQA 2GPYA 3IUQA 3ZY5A 4Q9NA 3LT4A 1DBSA 4TLMB 2I8LA 4WXHA 4BQRA 3KP1A 2C82A 1GUZA 5K9ZA 1U5BA 3BF8A 1E96A 1P74A 4IRUB 4CMIB 2CUZA 1CULC 2J5QA 5CFRA 2HWXA 1UKYA 2BTQB 4JT4A 4BMPB 1J07A 1L1RA 4XOIA 4DEXA 1YCDA 5CX1A 3TD6A 3ZU6A 4ZI7B 3N8IA 4CV0A 1Y8AA 4HPJB 1J20A 3ETJA 4KQMA 1XZFA 4DR5B 4GOXA 4L6IA 4II2A 3ET5A 4Y0AA 5AUPB 3ZCVA 4DMLA 3Q0IA 4G65A 4QBGB 4BXOB 3CCBA 3TAHA 2BC9A 3M4NA 1X70A 1ZSYA 3TUJC 4A0HA 1L0BA 4DR2B 3MYYA 3UCXA 3C1UA 2NVUB 4HAZA 4D0SA 1S0UA 3SZOA 1YB7A 1I7NA 1P81A 4X97A 5AUOB 4CF5A 1CUYA 2OO3A 2YDYA 4UTOA 4QFBA 3KUUA 2FXIA 4FXPA 4YMSA 3ZX5A 2ZKLA 3PNLA 4QOFA 3KR2A 4OQEA 2VF8A 4NBLA 4HVLA 3OAAD 3HPQA 4J7XA 4Q4DA 3NZEA 2QMUA 1T5TA 4TX1A 4UHBA 4NNOA 3BXGA 1C4KA 5LXTF 3RKRA 2QW1A 3CUTA 3GO4A 4F91B 1XMQB 2EIXA 4GYKA 2PU5A 1R15A 1UOPA 5G02A 4RPIA 1IY0A 4XUGB 1QVAA 4P2BA 4Y9DA 2VT2A 3RVKA 1KA9H 1Q6YA 3V8PA 5CG1A 1N36B 3HACA 3L0OA 4OLAA 5BUZA 4JIMA 5JPDA 4ZOAA 3GRVA 1CIJA 1QHSA 1MRSA 2DUNA 2AUTA 3GYGA 1JP7A 1FYXA 2KMLA 3D6VA 1W76A 3KU4A 3LQQA 4I08A 3VSCA 4AMZA 1K86A 4KWTA 2C5EA 4S12A 1AB5A 3BXZA 3PFBA 2FN7A 4XAQA 2ILTA 1DEAA 2PO7A 2G0AA 2VK1A 2NTEA 2YN2A 3C7DB 2YICA 4LHVA 4WNCA 3G5AA 2XMSA 3DEZA 2WIAA 2O7RA 4RKQA 3EDCA 5T4EA 3PGLA 2XUKA 3CZCA 3CZ4A 3M6UA 1JWLA 2K4MA 3FR8A 3FZQA 3GQBA 3O0DA 4LRQA 1G63A 2ZJ2A 1ESNA 3A1DA 3CXRA 1WZIA 3B3GA 3FIUA 3PENA 1NJ2A 4H3VA 1I33A 4LK3A 1MDBA 5J47A 3G8DA 4GI5A 3Q9LA 5JV5A 3R0ZA 1Y1QA 4ARZB 2FSGA 3DF9A 3JQ8A 1TMOA 4Q1FA 4QYMA 3TNYA 4DUGD 2MT9A 3OA0A 3QVMA 3UT5A 3C3PA 4P4LA 3SVTA 1QZ3A 4F46A 3G7UA 3D4LA 3KTDA 2DQYA 1YI8A 1R6BX 3B13B 3G02A 3L06A 5EERA 2ERYA 1IN6A 1RCUA 4MUFA 3NPMA 3K70C 3SKXA 1E5LA 5DDIP 4F12A 3H9EO 1X3LA 3G59A 3BAZA 5DGXA 4H7HA 2APJA 1JLSA 3O4HA 4M37A 3FI9A 3JYPA 2I3ZA 3WLKX 3JYQA 4BO9A 2J0UA 2PVPA 4PYIA 2ODQA 2IBMA 4G5HA 1VL2A 4G26A 4KVFA 4PICA 3VXKA 5KJCA 5M04A 4GE0A 2WF6A 1OWMA 3OLVA 4H7IA 3SM9A 3AI3A 3VGJA 1GPWB 5C5IA 3LHSA 1TIKA 3M4YA 2TMYA 1NXWA 5JZVA 4H1WA 4BO7A 3NG1A 2YMQA 2E4ZA 3OKAA 4CIBA 2PWBA 5IFLA 1QQAA 1WR8A 3R6DA 4GYWA 3SJAA 2JLAA 5IVDA 4MARA 5DWDA 2H4WA 4TTIA 4QUAA 4IFBA 4JDUA 1VRCA 2XXJA 2BKVA 2FPXA 1XZIA 1ZVJA 2VP5A 5H4HA 1T6YA 1YOVB 2H31A 4LUCA 4MQEB 5H7XA 2QX8A 2CB9A 3D0RA 2Z6QA 1ZZEA 3UMCA 3I8SA 1XHLA 2D8AA 5EP1A 1VJ0A 2UAGA 3AKYA 3W5DA 1QP0A 1N8KA 1R9GA 2EXXA 4TMXA 1PL0A 2V3VA 1HEUA 2ZWMA 3PEUA 4MW1A 4O1HA 1QRRA 4P4GA 4BP9A 4RENA 3CR3C 3P5SA 4TL9A 2FCAA 4IDAA 4Q9AA 4B3XA 3BM5A 2GJ9A 2ZGVA 2CYAA 2EDAA 2FGKA 4KODA 3W2HA 1LF5A 3W4JA 4DQKA 3GJ7A 2PUFA 3ZE0B 4BB9A 4CDMA 1V6SA 3CU5A 5F77A 1MO5A 4FYKA 3FUTA 3OOWA 5DNYB 4CTMA 2CLFB 4OIFA 4ZHQA 2C1XA 5CM9C 1E5QA 3T5GA 1EVQA 2EBWA 3B82A 3LGSA 1JMKC 3UB2A 4AULA 4YMGA 2H1FA 4NNJA 4UNQA 4KXQA 3BJRA 1DB3A 1E1CA 2OFWA 3EGWA 2YJ3A 1PFWA 3NHLA 1YE8A 3KD3A 3PEFA 2EWMA 4COKA 4D6XA 4DXDA 2OBYA 4DNQA 1KSHA 2R62A 2WD7A 3IPLA 4PHFA 1GXSA 2YIMA 1QVRA 1ND6A 4DAEA 1U11A 1BKDR 3DQZA 3KJIA 1GT6A 1DMRA 3CX3A 4MQ5A 3DZDA 3L79A 1KR2A 4DDUA 2XDQA 4A10A 3UPTA 2A0WA 4IBOA 4ND2A 3PUXA 5DNAA 1CEEA 2OYSA 5IRCD 1SHKA 2XNSA 4OHWA 3BL6A 2WT9A 3EVZA 1J7JA 1PQUA 2ZCVA 4OUKX 1L7QA 2QM8A 3HXMA 4JAVC 1D6SA 3VAZA 2AMYA 4O63O 1O95D 3UV6A 3MTBA 4BO1A 1K0FA 3DMPA 3RTEA 1PT9A 2KWIA 3PXDA 3PD7A 4CL3A 3O93A 4YJ3B 3UV7A 1UDAA 5JASA 3VKWA 2ORWA 2G5PA 1XDDA 4RVFA 4YJFA 2VLIA 3CR8A 3HV0A 3IA7A 4GIBA 1NN5A 2WIGA 3H5WA 1YR8A 2PBLA 1HLGA 3LGAA 3C5EA 3GPLA 3ZLTA 3OX2A 3B6KA 1RXWA 2DU8A 1V6AA 2E9SA 1EDOA 4MUHA 3PUZA 1J5EB 4MVYA 1F9AA 2N47A 1F14A 1XQXA 3KJNA 2XE8A 1JEDA 4NCJA 4RK7A 1ZCZA 3BHMA 3ROZA 4EJ6A 6CHYA 5EXPA 1QR6A 2AOTA 1OSNA 5C1DA 1YS7A 3SQLA 1NBMA 2DBRA 1YCFA 3TNLA 1P75A 3TQOA 3RC8A 3C4QA 2LDXA 4K26A 4UULA 1CHDA 3IQGX 4M36A 5BR7A 3DE5X 2AKAB 1UZAA 1DX4A 1MCZA 3LHIA 5FNVF 4AKEA 1HTBA 2PT5A 4MQFA 2AK2A 1E4OA 3THXB 4NULA 4F5EA 2QTHA 2IHUA 2HQBA 2PH3A 5CDFA 4GM0A 1JL3A 2GO1A 1CXZA 1KIFA 2F1OA 3GPDG 1DEOA 3KM0A 3M9XA 3DEIA 3DKKA 4Z4CA 1NMXA 4LZAA 1Y82A 4KQ9A 3GVHA 1X87A 3ROTA 1ZUWA 3RD5A 1RJFA 1Z45A 4RWZA 3JWHA 2C2YA 4YAWA 1E4VA 1ONBA 3B1XA 1HYQA 1KSFX 3MBKA 5LIRA 4BVGA 4CKEB 2YV2A 2VSYA 3FBGA 3WZMA 3RYCA 5IAJA 1FMJA 1R7RA 4OEHA 3ZXXA 2BM0A 4AFNA 3WRWA 3RQSA 1GU1A 1ONNA 3QXCA 1E32A 3ZZMA 2OWEA 4B9EA 4CIVA 3HR4A 2PRZA 3D4IA 4YCBA 5BW4A 2XZLA 2PT7A 2R8EA 3TQRA 3E58A 5JZSA 3HKBA 1X94A 2XB4A 1Q0TA 1Z68A 3WHKA 4CMBA