5EKTA

Crystal structure of mutant-k146a of peptidyl-trna hydrolase from vibrio cholerae at 1.63a resolution.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
197
structure length
196
Chain Sequence
MVSQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHDELDLPPGVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHADKVAGYVLGKAPAKEQELDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Crystal structure of mutant-K146A of peptidyl-tRNA hydrolase from Vibrio cholerae at 1.63A resolution.
rcsb
source organism Vibrio cholerae o1 biovar el tor str. n16961
molecule tags Hydrolase
total genus 63
structure length 196
sequence length 197
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 5ektA00
3TD2A 4IKOA 4ZXPA 2Z2IA 1RYBA 2MJLA 4QD3A 4P7BA 4FOTA 5IVPA 4YLYA 4OLJA 5IKEA 3VJRA 1RYNA 5EKTA 4LWQA 4JC4A 4QBKA 5IMBA 5B6JA 4JWKA 4DJJA 4Z86A 3KK0A 4QT4A 2PTHA 2Z2JA 3TCKA 2Z2KA 4DHWA 4JY7A 4FNOA 4JX9A 2NAFA 1RYMA 4HOYA 4FYJA 3OFVA 3TD6A 4ERXA 4FOPA 4QAJA 2LGJA 3NEAA 3V2IA 2JRCA 3KJZA 3P2JA 3TCNA
chains in the Genus database with same CATH superfamily
2AOUA 3QLUA 4JASB 4E13A 1KFJB 2R1TB 2F3SA 4OUKX 4TMYA 2JASA 4BVBA 1K08A 3W8FA 4QELA 5EINA 4FP9A 1MNAA 4IDQA 2OCXA 2P0AA 3GFGA 5FBHA 4CI9A 2HSJA 3C7DB 2G4LA 3K9HA 2VHYA 1C7RA 4YV1A 1HE2A 3UAXA 4H1HA 3GFFA 1PK9A 3SYTA 2J32A 2Q8PA 2YXPX 4L22A 1FP4B 2HCRA 3LV8A 3WLLA 4GI5A 2B92A 3FYCA 3OOJA 4L08A 4R01A 5EKUA 5JATA 3P4UA 2ZB2A 2CN1A 2YWEA 1JBQA 3HKDA 3HSYA 1E7WA 3PFWO 5E6SA 4LPSA 3V7NA 4KR9A 3W4JA 5HMMA 3M6VA 2RAVA 3BWXA 3Q8WA 4O5OA 5CTAA 3IAEA 3VH3A 4D3FA 4Q48A 1AK1A 4I0WB 4BB9A 5K8VA 1SZPA 1WTCA 1A77A 5ITZA 2PA0A 2DF8A 4XGKA 3GQVA 2YC2C 4L7QA 1FTQA 2MINA 4QXQA 4ZI7F 1Z45A 4B5LA 3HI6A 1NJ5A 3R5HA 5EP3A 2H1OA 3TQIA 4QGFA 2D2EA 1O6FA 3H8WA 4EPYA 3W6ZA 4EBFA 1VJ5A 2FMFA 3V97A 4YBRA 4J4HA 3MTBA 3T1YB 4KDRA 3CUTA 1EK6A 4TVBA 3ZDBA 2BR4A 2O3RA 2XUHA 1IN4A 2V5UA 3Q7TA 5FBRB 4DIUA 2J30A 5BWOA 1OWLA 3SYMA 3AERA 4D9HA 1ULZA 5JTTA 2O05A 2A0KA 2WJ4A 4U00A 1T10A 3CTPA 4JB8A 5TQVA 1BA2A 1ID1A 3I34X 2PUDA 2VHJA 2J59A 2I3ZA 1W87A 4QDJA 1WUYA 3GC6A 5LQDA 4DV7B 1WABA 3E3NA 4WLOA 5EJ5A 2E5FA 1OH8A 2ZIXB 1N77A 3NVMB 4FYXA 5H1YA 1MF7A 5LBIA 1RS0A 1O3YA 3U26A 4FMDF 4A2QA 3OVMA 3TE7A 5JUWA 4NJMB 1MB4A 2JHAA 3DE4X 3EXHB 2PRZA 4TM8A 2I7XA 2RI6A 3R3SA 4D45A 1RPZA 3F73A 1XWWA 1CEQA 3OJEA 1N0WA 4V0NA 3I30X 4IH9A 3WNDA 3ZE6A 4BNYA 2BSQA 1U8FO 3KL4A 4O4LF 3PYLA 4IM7A 1IVYA 1E94E 4L5AA 5AHXA 3SCZA 4L2IB 4G4SP 3RNOA 4DCUA 4Z6KA 1IG3A 3DVRX 1QR2A 1HG1A 5IHPA 3DV0A 5J58A 5ICGA 5ETJA 2JAUA 5C8XA 4I55A 4KRYA 4NPAA 3EGWA 2GPAA 4ALJA 1LGYA 4UATA 3NAZA 1SGWA 1I32A 1MX9A 1X7ZB 1FLDA 2VUTA 1DEOA 2RSLA 3I09A 2DUWA 4KO2S 2ZRPA 4BX9A 2DSTA 4CQNA 1VM6A 4BFCA 1H8HD 2WHQA 3HWX1 1P8JA 2FR1A 2YMPA 4ZOCA 3SJBA 1QGDA 3EEYA 3HNOA 5JC8A 1GXSB 2XNCA 3FMVA 1U04A 4FJ0A 2FG6C 1Y8QB 3MTQA 4D41A 1QXSA 1VKZA 4RW0A 3Q3HA 1BFDA 1VIVA 1WDWB 2FUCA 2VTVA 5HUHA 4LTNA 4XYBA 4KO4S 4KQEA 3RSQA 3EQ2A 1OQAA 4EHLA 2VXCA 4RHCA 3R7SA 4C1BA 4EI7A 2EKQA 3I1YA 1V9CA 4LF5B 5AW7A 2ETVA 4KZKA 5EN4A 3TDMA 4K46A 4BKPA 2PT6A 5C2JB 1KJQA 1RPAA 2IP2A 1UQTA 2IXAA 2Q46A 2RCYA 3BWVA 4QXAA 3F96A 2AMLA 5CLIA 1Y5MA 3KU4A 3F9IA 2KYRA 3LPAA 1OIWA 1U8UA 3B78A 4R8VA 3MBIA 2Y1DA 5AXCA 5TV2A 5IKEA 2J0SA 3IELA 2QPOA 3ZR4B 2ON6A 2VYFA 4M7WA 2WM8A 5TIIA 2DQSA 1R8SA 1RAEA 4DR5B 1CR6A 3GCWA 4K6HA 3ASUA 2W6CX 2VA8A 3FR7A 1ORIA 1SVKA 3KS9A 3WDMA 1I2DA 2D7CA 4EMBA 2MIIA 4H7JA 2QY9A 4QTUB 4P6VF 3LYUA 5EZYF 4CDMA 1G2OA 3FUVA 4FIDA 1WDKA 3VHRA 4QODA 4LY9A 4DLUA 4D44A 3V4RA 3FKQA 4JCCA 1M75A 5CB0A 2XDQB 4I9HA 3PDIA 4NCIA 4OSEA 3TKYA 3GW8A 1QYXA 1MW8X 3KUDA 2GZ3A 2VUUA 3R7AA 3WLQA 3W77A 4WMLA 1FTWA 4DR1B 2JEYA 1JX6A 1C9NA 1SUBA 3DFFA 2Q5FA 5EHGA 4IJQA 5A2QA 4CN9A 1KDVA 2EKDA 2RHCA 3PHLA 1H9AA 3A1VA 1IAQA 2NTVA 1VPEA 2IYVA 3ML1A 3CVJA 1RAFA 2QR5A 4Q3AA 1FZQA 3AJ9A 4DR6B 3U39A 4TMXA 4TX1A 6NULA 4DA4A 2VBCA 3W7BA 5B3JC 1W75A 3LW7A 5EZYB 1OY1A 4FDAA 4KQIA 3FYUC 1Z0FA 4I6JA 2JDIA 4TS3A 1P4JA 2C77A 3LVBA 4UAJA 4A8PA 4N41A 3IOBA 1DQSA 1ZJZA 2IUSA 3O92A 1QWOA 1RR6A 4RUKA 3SR3A 1RD4A 1KDTA 2VHQA 1VMAA 4EW3A 4PNHA 1PZEA 2PMKA 5AJXA 1TYBE 4MARA 3UCXA 1HRDA 2O9JA 4S0ZA 5BYAA 1KAHA 4Q9AA 4XX0B 3R7DA 5J5AA 3Q5EA 1RWMA 1FDOA 3PQ5A 3UZUA 5JH7F 2VL7A 1UPAA 2CXSA 1CQXA 4EPTA 3WRXA 2YIDA 4UBMA 3S2GA 2FPGA 1YWGO 4FHCA 3TZKA 1TNDA 3HVHA 2WJVA 4X6LA 5DPMA 5A5FA 3HO8A 1USGA 3G7SA 3HEMA 4L74A 4B2YA 1PGJA 5LUAA 4OYHA 5ITVA 5G3ZA 4EATA 5HFJA 4HYYA 1SUAA 2J4CA 3AVYA 4X3CA 4HO1X 1QYWA 3QW4B 2X8AA 1JA1A 4XPIA 2JCSA 3VYUB 3A4IA 3ETJA 3GGJA 3P0RA 4JLSA 1YDEA 5ES3A 5BURA 4LDJA 1P0QA 1DHRA 2B8JA 4Z49A 4H7EA 2JAOA 1JHRA 2X2FA 1TCUA 1R0YA 3EPKA 2IHUA 1P4RA 4RA6B 1H9CA 5ELXA 1K68A 1R6XA 2NQ2C 2ZW9A 3EZ9A 3ND6A 3I9KA 4B7AA 4CEIA 3IIKA 1H66A 1TEZA 4ENSA 4WAUA 1ESEA 4ZREA 4BX8A 1UMBA 2G63A 1GP2A 1U9IC 2D1SA 3L0IB 3LZDA 4RLHA 1QFSA 1MV8A 2BDTA 2I6GA 2I29A 2PXHA 4JC4A 4P0PB 1S9DA 3ELBA 3V2UA 1A5SB 4I1IA 1X6VA 2VNIA 5EHIA 5EVCA 2NUAA 1KJWA 4OQPA 4W9MC 4EA9A 1HT2E 2XKJE 3E81A 1VP3A 2OENG 5JADA 4LBWA 5JY1A 5FWDA 5JQWA 1FRZA 5JR3A 4BX0A 1GA6A 4GBGA 3GXBA 3JAKB 1G1MA 3QMWA 5CRIA 2WJJA 4P86A 4KDFA 4DLLA 1X80B 1Z88A 4HAUA 4NFYA 4I1UA 4C0WA 1F2TA 4W8HA 1FYFA 3CWZA 2DR0A 3FBGA 3MBOA 1U90A 1UC8A 1NUUA 1CPYA 1QCZA 2XTMA 1S3GA 3EXEA 3OFKA 3QWFA 5ENVA 4EIWA 2OLKA 2V45A 3U7JA 3DGFC 3EFOB 1OFHA 3PRYA 2CB0A 4PZAA 3BUSA 4YQYA 5JWRA 1NF3A 4DNXA 1D2AA 2Y1KA 3LYHA 3TAHA 1WWKA 4Q3NA 4K86A 2FLKA 3IUMA 5F3RA 1RP7A 4E5SA 4ZOLB 3RIHA 3F1LA 1ZS9A 2ADOA 4EHIA 4NBTA 5CGQB 3WLOA 3TG2A 4JB0A 3UT6A 5K20A 2JJYA 2JZCA 1GADO 1C80A 1U31A 2WU0A 3HDGA 4HNUA 4UU8A 1X74A 3CF6R 3RS4A 3FTPA 4GPEA 4CKXA 5CPFA 3H65A 3B51X 5FQNA 4B8ZA 1FP1D 4N03A 1SAYA 1SBNE 4ZTBA 5BQ3A 4BQFA 1GYRA 3RK0A 1JNYA 3KKNA 4KXVA 1QZZA 1K0FA 1QJCA 3EGDB 4O2LA 4E5VA 3CX6A 1L6RA 3HABA 2PUEA 2GMWA 1CBUA 1R9JA 4Q6WA 1B1AA 1VJTA 1VYHA 2PJZA 1IN8A 1AHHA 3F3KA 3QEJA 4RPKA 3S1AB 3TX2A 2I33A 3U3MA 2PY6A 2O54A 1YR3A 1GQRA 4IJ5A 3GFVA 3SLGA 3DAGA 3AP1A 4EY6A 4JI1B 5HKLA 4DNQA 2QLJA 3C6QA 3D43A 3FCAA 2QN2A 4P83A 1RC0A 2GS9A 4EHAA 1YQUA 1QHHB 3F5SA 2PWYA 1I6MA 5CDYA 4HGPA 3QTBA 4RD2A 3HJGA 2OCKA 3WB1A 1N7IA 1NQWA 1P1IA 4KR3A 1SMKA 1KE2A 2WP0A 2DP4E 5PNTA 5DNYB 2Q9AA 3FWHA 4CFZA 4I9GA 5IXJA 4J7CA 4OHUA 2F9MA 1P8AA 3DKIA 1HH4A 3G2KA 3LUCA 1I94B 3JAKA 4L15A 2A30A 5EG5A 4PFKA 3FZQA 4XJVA 1GAJA 2Y0PA 4GWKA 3AR8A 4PG5A 1I1NA 2V65A 4RY8A 5E0OA 2RGWA 3HNPA 4O8CA 3MWFA 4E5UA 1I7DA 4XTCS 4OL0A 4W5QA 1G66A 4YV7A 3WX0A 5CA1F 2IL1A 3LQQA 1O95C 5C8YA 2BKEA 2WABA 2BBTA 3IDZA 2YJ6A 3K9BA 3NTQA 2A1TS 4IOMA 4ZQFA 5EQFA 4P4LA 5CT4A 3VOBA 2ZJ4A 3JD4A 5E9WA 2E4ZA 1ACJA 2QA5A 1KZ9A 2XCOA 4N0PA 4NBNA 2Z3VA 2B20A 2BGTA 1FFEA 1Z36A 1PFVA 1UMKA 4PG6A 2Q3LA 4ZI3A 5I9BA 4RZHA 3R6WA 2H65A 3FSRA 1OTXA 2Q2QA 4NG4A 3OAAA 4DPLA 1GLGA 3IAHA 1OLXB 1HLPA 3OZIA 4JT8A 4RKEA 5JS8A 1M76A 3H9JA 4BJ3A 4FFMA 3WFIA 4L6CA 2FUEA 3QITA 3KKMA 2PWAA 3HLYA 5ALJA 2NACA 4NATA 4QHSA 5JZMA 5I4KA 1TO6A 4M99A 4MVJM 2Z2XA 4OQYA 4QGBA 4KIGA 5COQA 4HZUB 5C4GB 4EQZA 4EYEA 2VH5R 4WBNA 3KKKA 3PC8C 4OK5A 3L04A 1TM2A 3Q72A 4CR7A 2J7KA 2JAPA 1SUWA 3NC4A 3AGQA 5FUVA 3TSZA 1JXOA 3IBFA 2QUBA 2CWWA 4C7OA 2DUMA 2VT6A 3RRBA 1X1TA 1UR5A 3H1FA 1GITA 5CA1B 5KTOA 4FLFA 1U9CA 1CP3A 4HG2A 4M36A 4UJ5A 3T0FA 5DGTA 3ZI7A 3ZY3A 3GARA 1TF7A 1YNOA 2CVPA 4ZVSA 3G0IA 2P5YA 2QDXA 4X0EA 3CG0A 3OECA 2NU8B 5IU6A 4ONEA 4H1UA 2W42A 3LC0A 5COBA 3WG9A 1RLOA 4YCDA 2DOKA 2ZRHA 4CLRA 3NUQA 3GEPA 1RFLA 3O47A 4HDCA 4MUBA 1HMYA 3JRNA 3UFBA 5AM0A 5KUTA 3GEBA 2O8BB 1QPGA 1LUAA 3MOIA 1KP9A 3I6MA 1R5JA 4NEHB 2AFIA 2Y05A 4I08A 4NH4A 4ISCA 4QE3A 1LXCA 4RIHA 3GYGA 3QPDA 3CE9A 3GLQA 3V7YA 4B32A 1PK7A 2GFQA 1LKZA 1YDGA 1H2FA 1XDDA 4KQHA 1WA5A 5GPBA 3B13B 1G17A 2O0LA 5ALVA 3JVUA 4DLKA 1R5NA 4EKDA 3LOPA 5JS1A 2BR5A 3A1SA 3I6QA 3CRZA 1ISGA 1C2YA 4P34A 4C21A 2FR8C 4YR9A 2VBGA 1HSZA 3E3OA 2QQEA 4JLJA 4DMRA 4L5BA 1YIOA 5EWJB 3UH1A 4AS1A 4NJEA 4FD3A 2YZNA 4KPUB 3JD1A 3M1AA 2Z3ZA 2HNKA 5IBQA 1LK7A 1NQXA 4FKMA 4OH7A 5EZSA 2RB4A 5HYVA 1AA6A 1QK4A 2MSCB 1ZO8A 1C1XB 4Z9YA 221PA 3RS7A 4H1TA 4AAYA 4FGWA 4OHPA 3D6UA 3O83A 4WH0A 2GHTA 3GRKA 5IJ9A 2RI1A 4ASUA 1KJYA 4NY1A 4R51A 8ADHA 3L1HA 1M3SA 1PFKA 2X23A 2QRHA 4AROA 1QR6A 1YDWA 2Q50A 4C4YA 2CUTA 4JUDX 1BE1A 4RMJA 3DBHA 2BE7A 2BEUA 3GUCA 5DISB 2F62A 2BBSA 1M2EA 3Q4GA 1AQNA 1OFGA 1QFXA 3K9GA 3AZPA 4K03A 4L78A 2W2LA 5TMBA 4JR0A 3ZYCA 3K0FA 5I4BA 4FJ1A 1TFUA 3PFFA 2NU9B 3TOZA 2H16A 2G28A 4KKVA 2RH4A 5GONF 1V45E 5AKHA 3UUEA 3E3MA 4C29A 3A6FA 3RWBA 1SVLA 1AC5A 1NG1A 1QZXA 2GZSA 3OCJA 4M88A 5BRAA 1QPZA 4QAQA 4ENRA 3HEAA 3DEJA 2H0AA 4NNPA 1ICIA 3ZHUA 1OF1A 3OU2A 4V03A 2WY2D 5G4KA 2O8EA 1SKAA 4RFSB 4F56A 5AM4A 1JQAA 1UWKA 3KRTA 1Z4JA 4Y6PA 1MW9X 3EARA 2M2IA 3K6JA 1E5VA 2HA0A 5ADUS 1CUWA 3AKYA 1E4EA 5J2UA 2DC1A 3G9UA 3OESA 4W99A 5BQ5A 1N2SA 4FOPA 3TZCA 2OC9A 5JCOA 3WYDA 5KQRA 1QRAA 4P4SA 4UFPA 1QGUA 2IZ7A 1O77A 4ZZIA 1P9WA 4FFBB 1TUEA 1CNMA 1RYFA 2XNDA 3TGWA 1R4ZA 4XDHA 2XNDD 3U4DA 2CZGA 4BVJA 4E7PA 1E9RA 2E0IA 5I51A 5HXAA 2GCOA 3ZVMA 5KYWB 2WLSA 2QYTA 3IXQA 1BMDA 5K0BA 5CM9C 2JS7A 1MGOA 1T35A 1P18A 2QR2A 1KKUA 4PZCA 4AF8A 4BMXA 3U3ZA 1T5SA 5H80A 2YVLA 5ITSA 1RHUA 2DAPA 5LFAA 1JBKA 3HWRA 4BLVA 4AX4A 3OPNA 2DETA 5COAA 4DSTA 2VRCA 1FLAA 3JYOA 1ZCZA 5BR7A 2E21A 1H1DA 3EIQA 1D4FA 1H2YA 2QT1A 5EXSA 4F1JA 3TRDA 3R0XA 5F12A 4Z54A 1WKCA 3UN1A 5FT9A 1MVOA 4E5PA 1BD4A 1YD7A 1IJKA 4A0FA 1XZNA 5KYKA 1VC2A 4LX0A 3AEZA 4MA5A 1VCHA 1OMOA 3NHLA 3J7AC 4AKIA 3AUUA 3Q7RA 3A27A 3KP1A 5FO0A 4HCJA 4ND1A 2I2CA 4JU8A 1L5ZA 1T36B 2J9RA 1WW2A 2OBLA 5K9ZA 1WM1A 3RPEA 4E22A 2XH8A 3BT7A 3T0IA 4C7KA 3ECAA 1ZQ1A 2IJGX 3AW8A 3OLWA 1M0WA 3QY9A 2FEWB 5IJXA 2VUSA 1M2WA 1VXRA 1CJCA 4Q5IA 4ISBA 1UQRA 4V0KA 2D2XA 1KJ8A 1G3MA 4LXHA 4CXMA 1ZX1A 4HWGA 4DIMA 2QG4A 3OUUA 4I66A 3ACDA 2CCKA 5FL7A 5ALZA 1ZUHA 4XUCA 1YQ9A 2Z9BA 1RW4A 5DK6A 2GKOA 4ZARA 2FFAA 2GILA 1GQQA 5GM2A 3IEXA 1GSAA 2J08A 2HPZA 4KLZA 2ODTX 3EB9A 1CS4C 1TMYA 4TL7A 4Q3EA 2NT3A 2PZMA 1HL7A 1ULUA 4K28A 3PCXA 4Z9AA 3G0OA 3M3DA 1JHDA 2YKGA 4Y1RB 5FTJA 1MFZA 3KSAC 1TVMA 3FSGD 3TNJA 1DX9A 3GRVA 3AESB 3HMQA 3BH6A 1E2KA 4Q19A 5A4AA 1ZSNA 3B2QA 1U2QA 2DFVA 3K09C 4P32A 1GT91 3AG6A 4BTVA 1YFLA 4LYFA 2MDTA 1G4HA 2WJYA 2XHEA 1J0XO 3D5TA 1FYVA 2JLUA 1VHQA 1B8PA 3QE9Y 1JDBB 4QUIA 3L43A 1M1XB 3VKUA 1UJCA 2FEAA 3WRVA 4Y9UA 4C08A 3QVKA 4AZ3B 2VLBA 3DCYA 1TT5B 2LP4Y 4BNGA 3KETA 4FWTA 4OM7A 2DHCA 4CM9D 3KSZO 3EZLA 4P7GA 3LY9A 3R7WB 1UDRA 5F7OA 5MDHA 2V54A 3PRKE 1SURA 3F3SA 4EF6A 1EK0A 3K2QA 2BFDB 2J3KA 2CFSA 2JHPA 5JMTA 4Q9LA 1AV7A 1HE5A 2QZJA 3EPPA 3KYDA 2WZQA 5F1OA 2C9YA 3S3TA 4O4LB 1QRUA 4Q82A 5J43A 1UP6A 3GCXA 1E2QA 2YWBA 3D8SA 5CLFA 2Y9PB 2BFBB 1UPXA 1QZTA 4B3IA 4GC9A 4DG5A 3EFOA 4OP3A 1E7SA 2QTVA 5D00A 5K05A 2VWGA 5FJJA 2IH2A 1YQWA 3FF1A 5FKJA 2HV8A 4RM2A 1DADA 4DC0A 1EGMB 3BRWA 1H8EA 1QBGA 2F00A 2OWDA 3EQ6A 4JI6B 2A5LA 2ZS7A 3F5DA 5CFMA 5KYUB 5E3HA 1RXCA 4JSYA 4KNWA 4KXFB 1D1QA 2GYWA 3ISTA 1J2RA 2FFJA 3K4PA 2ONZA 2X5NA 4TWZA 1BO6A 1IOVA 4XXHA 3JQAD 2ZKIA 4JEMA 4MGKR 4RC9A 3TD9A 2W8BB 4ZAXA 3ABQB 3SSAA 4BAGA 5L3VA 3L9WA 1VLHA 2XVXA 4GI3A 3W6NA 2HRQA 5E1MA 5A5VA 4G3XA 5K0GA 3EC7A 1H3NA 2HSDA 2P2DA 4KMOA 4UE3S 4MUEA 1BROA 4EA7A 1A7UA 1CZUA 1NGSA 3DT9A 4DCPA 5JDCA 2A59A 4DGSA 1RLUA 4E5MA 4PTYA 2HIGA 3Q5GA 3DPSA 1C7QA 1TLLA 3UANA 4HUTA 2UU9B 3IBGA 1QFZA 1ZOPA 3DC2A 5JAPA 4HLDA 4EK9A 4DV1B 2FRVA 1KZ4A 5KTTA 4C76A 2HL6A 1NPDA 1O6GA 5HIMA 4Q01A 3WJ1A 2O8BA 2AJ8A 2CJWB 2JBAA 3QU2A 4L51A 1SBTA 3F7MA 5JISA 1EXVA 1QQTA 4KVGA 1L6IA 3L7LA 4KXMA 4R8RA 4NH0A 3CLVA 1VE7A 3FNQA 3TF5A 1BW9B 1VG0B 1XKTA 1N6OA 3MT9A 1PFUA 5ED0A 3VDXA 1YCHA 1N6RA 2QE7A 2XRMA 3R23A 5FA6A 4HATA 4QOJA 1OA1A 6CHYA 1MPXA 2XEDA 4IDPA 3S2UA 5C8YF 2WE7A 5G41A 5K99A 1RXVA 2WNSA 1OH6A 5F9FA 3EBOA 1VBKA 4KXQA 3OD5A 2REOA 1XF1A 1RLJA 1Z2CA 2QD1A 2GLXA 4G0NA 4TLAA 4DSOA 6PFKA 1C3OA 3H3JA 1PQ4A 1NLYA 1YVEI 3DGEC 5FFFA 3WL5A 3IQWA 2VXYA 4IGKA 4YJ3B 3S99A 5JXJA 4J0EA 4PQGA 2BGUA 3CF0A 1TU3A 1UC4B 1K2WA 1CVIA 1SKUA 1JHAA 2BEWA 3T9DA 1QHGA 1KY2A 4PCLA 7ABPA 4ZRDA 2DB3A 3MTEA 5A06A 3D2CA 1W25A 16PKA 1UF9A 1Y1LA 4LRTB 5A9TA 3V7UA 2FXIA 3W4KA 3I61A 2YQ5A 2GXSA 3ILXA 3ORQA 1RMQA 1KTVA 3BB4A 3LLVA 4MS3B 1JV2B 1L5GB 4OU4A 1JECA 4MVJF 5EMJA 3PQ7A 4HRAA 3U16A 1Y5NA 3PLAE 2X9QA 3NBZC 1ZN9A 3VJRA 2ZYVX 3R3JA 5CB8A 1CE8B 2AFHB 1KAQA 3HA7A 2PT5A 2Z58A 1HQDA 3C6XA 1R3DA 1RLTA 4Y6SA 4KITB 5DKFA 2P4HX 3E9RA 1WSWA 3A28A 4AY2A 4JYPA 3AETA 3MCAA 1FU7A 1SBIA 1VIMA 3E0QA 2WIJA 3N1UA 4OXRA 4Q4HB 4LWPA 3SJAA 5LQCA 2YV3A 3RTGA 3KTFA 5J1TB 1Y3BE 4MH0R 1RXIA 2IXDA 3VO8A 2QTRA 3D7SA 4CEHB 1ZK2A 1Y3HA 1O6ZA 1P39A 2O5CA 4PQRA 4CM5A 1CUIA 2NSJA 3GJQA 1U7OA 3JVVA 3P2EA 2WJ6A 4Y30A 1L5OA 3HACA 5A02A 4B82A 1L5FA 2Y66A 1F8FA 2ID8A 3ISVA 4RCVA 1E2LA 1QOPB 1QHIA 5DI9A 2Z0MA 4I50A 4N0MA 4YRKA 4K6GA 4BFZA 3CZMA 2EQBA 3ONDA 1HT3A 3UHOA 1JFTA 1A82A 1R0WA 5DXFA 3NWBA 1T8WA 3KWJA 3LFHA 4BMNA 3VR6D 4D02A 1J06A 3FBTA 5IULC 2LE0A 1V9SA 3ZHVA 2Y1CA 1J99A 2C5AA 2XMGA 3BTOA 2WTAA 2QD5A 4OXXA 3ZCXA 4LJ6A 4Z1MD 4P5DA 2B2CA 3L8HA 3NBYC 3Q8MA 1D09A 2PGOA 4M0CA 4UUNA 4WEOA 1OUMA 2QTWB 2QSUA 4NYJQ 3NWJA 4R31A 1IY8A 3B5IA 4AZVA 5DIZA 2WFZA 2C7BA 7YASA 4JAVC 2GF2A 1TAUA 1IZ9A 2NO6A 1O9BA 2X0KA 2ODBA 4MVJP 4CEJB 1RE0A 1XZIA 3SDZA 1II8B 4QT4A 4MUFA 3F8TA 1YRBA 2WMYA 4W1QA 1VJCA 2FQYA 1CY0A 3ZE8A 2ZK7A 4M6WA 1WHSB 3BIJA 1V5FA 4UXHA 4BKUA 1XQVA 3DZGA 4L95C 2BUAA 1XK6A 1T0IA 5IT9A 5ESRA 2HR1A 4Y2VA 5EIWA 2IHVA 4U4AA 4L28A 3UWDA 4RFVA 2BHNA 2VDWB 1YZFA 1ZXXA 3AOEA 3LUHA 3DZ8A 1D4ZA 3HP1A 5F35A 1R37A 1SU7A 2I99A 3KELA 4LGCA 4B48A 2R9VA 4KJZA 4N12A 2CBGA 2OXCA 4X63A 4PBSA 5D3ZA 4CT4B 4F5EA 3DMTC 4KFCA 3E3LA 4W7HA 4IQ0A 1MIOA 2OOKA 2ZPTX 4RKQA 2NTNA 3VR0A 4LFAB 1IQUA 3OZFA 4NU0A 5GGXA 4CG0A 3R0ZA 5C46F 4MR7A 1E59A 1FFXB 3IUEA 4GVXA 2ZRFA 1M1YE 3DZHA 4EKGA 3DT6A 4BDSA 3DEKA 3GOQA 3LP6A 3TPZA 4OQNA 4LOLA 3OF5A 4IP0A 4UHCA 1MIOB 3ERCA 2IW1A 4I1SA 4R9SA 5CNJA 1N6KA 4GR9A 1JPJA 1EVYA 1U5AA 4KPGA 5JFGA 5LR6A 1UOOA 1DIBA 4OU5A 1PRYA 4ZZ0A 2RONA 2RBGA 4RKWA 2ZE7A 5FOWA 4B6JA 5AW3A 4LJRA 3H9QA 4MUGA 1J8DA 2JIZA 4BX2A 1R50A 2ZYWX 4TLLB 4XCQA 3RV4A 5CITA 4O4LA 2VJCA 2ONKA 3RHSA 5I3CA 2GK4A 4HDNA 1I36A 4AN4A 4DSAA 5ISMA 1KYWA 1OAAA 1FSZA 2IC5A 2PKCA 1ESNA 3W34A 2IYPA 4M6WB 5DM70 2Q6TA 1TX4B 5MN4A 1RWOA 1NE2A 1MJ5A 3EWAA 1H6BA 4UBKA 1S8NA 4HAYA 4TTQA 4MQ4A 3KVVA 4G24A 2R8PA 2PBRA 4JDUA 4B2LA 4DDWA 1K6XA 2XE7A 3IS3A 5KJFA 5HSGA 2B7BA 4HTFB 5H83A 2G5GX 2QBYB 4W5HA 1PKEA 5LKAA 4J76A 4TTPA 1ZVKA 5G2OA 3I72A 4UTPA 4MWEA 1STOA 3RRYA 2Q6IA 1R0XA 4DLRA 4OHBA 4UW9A 1IN5A 1H93A 3EZFA 3RK1A 1KJ9A 3P96A 5KZMB 2ZIEA 2D2VA 3WZLA 3BXEA 2FWNA 3E7XA 3ESZA 3GIDA 4KGXA 4NPHA 4CHTA 2XCTB 1PGNA 3MJTA 3K2EA 3UB3A 2V0GA 4RE6A 3FPSA 1ZDMA 3WRWA 4LYJA 2DPHA 3H2ZA 2R7MA 1QHYA 4KQCA 4O63O 1UMDB 2F4NA 1HYEA 5CFRA 1AKQA 3LHSA 4I50B 1NW7A 1TTHA 2WU8A 4US2R 4KXLA 2PSHA 3NEAA 5JQGB 3MUOA 1GZ5A 4BRUA 4F72A 4ZYZA 3W7AA 4QXOA 2IU3A 4WN9B 5DCWA 2YNMC 2QAGA 2R6R1 4F38A 3WGMA 1RQNA 2ZRAA 4FI3C 4IF6A 4QECA 5GGYA 4HDAA 1II0A 4A0QA 4LRSB 2CFOA 3P9CA 2B9EA 2ZBGA 5AVTA 1L7MA 2XB2A 3E23A 2X7XA 2QUIA 1HI9A 1N8KA 2CD9A 5FPTA 2PBLA 4JDPA 4MW4A 4TQ9A 1E2UA 2FFQA 3KLOA 5HX7A 1ESCA 1L5LA 3WYCA 2ODNA 3ET5A 5CIQA 4DRXA 3BE8A 4KN9S 2PAFA 3O84A 3UJCA 4DQKA 5THKA 4PPGA 3PF9A 1ZK3A 5ESWA 4YAGA 4JMLA 2BMFA 1PTKA 5A6VA 1Q0QA 3QF4A 3U13A 1PR5A 4DIEA 1O5IA 4TT8A 1EHIA 5FDFA 4YAUA 1M34B 3UNXA 2H29A 1D6NA 1EVIA 1U0TA 2L17A 2R8ZA 3IV6A 4EUSA 3U7GA 1TADA 3TSOA 4UMDA 1UBMS 5C81A 5HKKA 1ZUNA 2OGUA 3LOQA 3N8GA 4HAOA 3MUNA 2YJTD 4MKRA 5E0KB 4QGSA 2PLFA 3GELA 2N9UA 2E48A 3S6JA 3CW9A 4OV6B 3GMIA 3PICA 1E2NA 4YRDA 2P75A 2R3SA 3JYNA 1ISHA 1V4BA 2XNJA 3HB1A 1F20A 5ICMA 3FOEC 2BEJA 1AV6A 1AHIA 1IMJA 2IU0A 4RIFA 4LJ8A 4X64B 1QBKC 3KEOA 3B1XA 4EVIA 5C53B 2DE0X 2VAXA 3PGVA 4K6KA 1GFZA 3SGLA 4AU1A 1WDLA 1HO3A 4M1SA 1LTHR 2DFDA 1BU5A 2MSWA 4XH9B 3UCEA 3AI2A 3OZCA 3W2TA 5CVUA 4KXNA 4D4MA 4GQIA 1E1MA 4B9AA 1KEZA 3GJ6A 2WYVA 3JQQA 4M0EA 4RENA 4BMZA 1UQUA 3IAS6 3ITKA 4HLNA 4QXMA 2GWRA 2W6JA 4GSYA 4YBZA 3I58A 4EG7A 3ETCA 2YWGA 3NASA 1ZU4A 4Z1MA 2V7QD 2PZKA 3K4HA 3KOZA 3LKVA 1DKQA 1IDN1 1V7CA 4Q9KA 2O8FA 2BP7B 2QUJA 5P8WA 5D85A 1UEIA 3NHJA 5EIBD 3GXOA 1VFPA 1DO0A 1EYZA 2VT3A 4XSHA 5K3AA 4GXQA 1IMOA 1N6LA 4IZIA 5D7BA 1AM4D 4A5SA 4CTMA 1EUYA 4IJWA 5REQA 1JB1A 3ZGXA 4I5DA 5KJ1A 3OPMA 4NMLA 4FYWA 4I5EA 4U7PB 4EMTA 5I7FA 2BGWA 5M5BA 4FOSA 5IN5A 4BAZA 3FYDA 5IM4A 2QJRA 1HDXA 1ZONA 2ZIVB 4X91A 3KHKA 4PLZA 3ZCRA 1KVUA 4EG3A 2FEMA 1L2TA 4UREA 1H69A 4WXPA 1A88A 2JC3A 3DD5A 2R96A 1IU9A 2FUKA 4FX2A 3E6AA 2C2WA 5K6AA 5EPOA 4CMKA 5L7WA 3HSSA 5HGJA 2I6QA 2GUGA 2ZAGA 1W0JD 2CUKA 2Q49A 3DQZA 1Q5PA 3BULA 3K8YA 1KO4A 3NIGB 2VDNB 3QEKA 4JBIA 1Z5NA 1EDBA 2D5IA 2GO1A 3HO6A 1QVAA 3A31A 4QO8A 4TSRA 5GVRA 1NR1A 3SPXA 3GCZA 4CPDA 1BXGB 1EUDA 1T0JB 3BRSA 3R44A 3ZE7A 3QEAZ 4MIOA 4YCJA 1O6BA 3U4MA 1EK5A 3BWCA 4LJ4A 3GHHA 2XVMA 5K3CA 3FRJA 1U7ZA 1N6NA 4MEJA 4KI0A 5F23A 4QFBA 5KAMA 1ADFA 2JJ2A 2AQ8A 2Y76A 2YV1A 4AJLA 1GPNA 1X7XB 3B1YA 2QRZA 1IIRA 2XJ9A 4XJTA 3HYLA 4PNZA 4ABTA 2HMUA 3ZNOA 3TM5A 4EWLA 2RHHA 3VNSA 2GD0A 2NYVA 2IGTA 3CX4A 3X1MA 2FH5B 2H8KA 2XYHA 2YOFA 3NG1A 4KUGA 5AM2A 2FRXA 1W5BA 2H2DA 3RYCA 4N7MA 3U5ZB 3V1YA 2I9KA 1FYXA 1OTYA 5FIUA 3H4IA 3H4TA 3LQKA 4HPWA 4MUIA 3RYIB 4FHEA 4FNOA 2R7NA 4HI0E 4K26A 1DHTA 1HQYE 3JSAA 2VDVE 3PC8A 3AB8A 4NU6A 3T7SA 3EQZA 4MEAA 4JSRA 3WRXC 4CL8A 2NTJA 3LPDA 4ZO4A 3KTAA 4KO8A 3GPBA 3TI7A 4E94A 1GZ3A 2EHJA 1UP4A 2PXXA 4GWLA 4ITUA 3REGA 4TLCA 1UKBA 2CCJA 1T43A 1I7QB 4MUKA 2JJ8A 2DCUA 3FKSD 3VZRA 3MJSA 4C3VA 4LZLA 2JAHA 1NIPA 3H16A 1H05A 3DE2X 5C7YA 1VPDA 1DC8A 2R00A 2FPMA 2W4MA 3KOOA 2BGGA 1T0UA 4B87A 2Y6UA 4NARA 2D0OB 3GVIA 2X7HA 4V0RA 4HMPA 4GL2A 3RAFC 4N76A 3WAJA 3CLTD 2CKMA 1BYIA 4N18A 4BFSA 4IWYA 1RZUA 2K5UA 3O8NA 3QNUA 3SHVA 2R1VB 3OPYA 4DIOA 1KJZA 1TJYA 3CINA 2QS9A 1CUHA 5JO9A 1JR6A 4GE3A 3DFIA 3H4MA 2YZMA 4DEXA 2PYZA 1MH1A 1U81A 3H1GA 3E8XA 2M9MA 4F7WA 4JUCA 1IM2A 1NOJA 2VNSA 4GEKA 4RVNA 4GUDA 1KMHA 1Q7GA 1VLVA 2Z04A 5GZ6A 1KDRA 3O26A 2NVOA 2WOOA 4Z2AA 3B7WA 4KDEA 3TW8A 2Z5GA 2LV8A 3FMIA 3JQAA 2EFGA 4M0KA 3DMHA 3I04A 2QN3A 4I3FA 1C1DA 1JH8A 4ZMRA 4X7BA 5SY6A 2Z6QA 4OAPA 4BEJA 4W1RA 4QZVA 3M89A 3Q9UA 4FFPA 1YL7A 3WKEA 5CW1A 3ZZTA 1S01A 1GT6A 4L5CA 1GZ6A 1JXQA 1Q0TA 4HAVA 1FRNA 3HC7A 3Q7QA 3NP9A 5TRTA 3HJCA 1GYQA 1TZMA 1GUFA 4CIXA 4B17A 5K8CA 4X7PA 3B48A 4EVQA 4IW3B 4EA8A 5BP7A 4RLQA 3LPMA 1Z4IA 1MX1A 2R2GA 2OSBA 4IX1A 4ZTUB 1A9PA 1P1BA 2EG9A 4JVOA 2J3HA 3TMAA 1FDIA 1W44A 2O2GA 5K3BA 5ALHA 2COEA 3FMGA 2D5CA 2VSYA 3WMFA 5EY5B 4W5JA 4G5YA 2Z4TA 2IV2X 1LU9A 1I6LA 3K1TA 2SNIE 4RS3A 1BQ4A 2I4TA 4PAGA 5EWLA 5T41A 2XD9A 4IIJA 4JYAB 1FTSA 2O2DA 2CLSA 2YWXA 1MQAA 3WQRA 4C03A 2C2BA 4J1TC 3HG7A 1I3LA 2WJGA 3D6HA 5KX5B 4KX5A 3T1OA 2E1RA 3FYHA 1GEGA 3N28A 1HYBA 2AV6A 2GCOB 5CNMA 5T8KA 4C07A 3NPAA 1PNRA 3K0EA 3VSBA 1PSDA 1TQHA 1W48A 2QW1A 4Y6RA 2JHFA 2W2KB 3GLHE 2CNWD 3F3YA 2MT9A 1SUSA 1ZPDA 4GICA 3RFXA 3SIWA 1Q21A 5IAOA 1FQWA 5TS3A 3T5CA 2FWRA 4QG7A 3OZRA 4WLNA 4Z2YA 4E32A 3LWBA 4ZCRA 1G55A 1EZ4A 2XF2A 1UC5B 4NULA 5DI3B 1Q3KA 3VR3D 2X15A 3LKDA 5EHNA 3ROZA 4RGQA 3SLKA 2OHFA 2Q6OA 3QQPA 2OZPA 1ORDA 1A9XA 3K8ZA 3KZNA 3CW8X 4I1OA 3OPVA 2L42A 4WDRA 4XA8A 2GFHA 1EFVB 5D1NA 3V4SA 1NDHA 1KPGA 3HBJA 1JKJB 1RM0A 3TS1A 3TR5A 3TJRA 5E3IA 2FZCA 1H2ZA 1XZMA 2VH1A 4QD3A 4I1PA 4KLCA 5J59A 4O4JA 1GGHA 1N7HA 4G97A 1F2UB 3DL2A 4XSVA 2WW8A 1JTEA 3A3YA 3HQ4O 4ZRMA 3ZWXA 9LDBA 2VPQA 5F9MA 2HNBA 3BXXA 5I5GA 2VCHA 5EZ5A 1EWQA 3N58A 1J42A 1B93A 2AUTA 2HY7A 2JGLA 3REFA 3QOFA 4TUYB 3RC1A 1F5SA 5DN9A 2OAP1 3WHKA 1NW3A 2O2ZA 3SXPA 2D13A 3CUVA 1DI0A 1L8QA 3QLEA 3TVDA 2CDRA 3EXFA 4BQQA 5K6RA 1O95A 2G6TA 3PR2B 2P9QA 5U1PA 1CB0A 3BFPA 1EHYA 1SBQA 2JK1A 3PHCA 1JR4A 2M6KA 3U56A 2GB4A 1Y4ZA 3HPRA 3LZCA 2FYTA 2RG1A 4I1VA 5LQNA 4V1CA 2CT8A 5GINE 2M6RA 4E03A 4MUXA 2FI1A 5DXJA 4OHCA 1N9ZA 4D0RA 1NVDA 3O4GA 3AF6A 5BYBA 3DWEX 4JCOA 4KPUA 3LMKA 3PPWA 4A92A 2EZ4A 1NJGA 2LVBA 4JOBA 5EPEA 1DIHA 5LNK1 5K2MA 3FMOB 1ETUA 3CG4A 1QP0A 3ZWNA 4Q7EA 1YZUA 4QM6A 1UXKA 4FCWA 3VQTA 4Z9FA 5JYDA 4PS0A 2C4NA 5CU7A 3H6HA 1UXIA 3OIFA 2OYRA 1X8JA 4I4CA 4Z4HA 1ZGGA 4DRXB 2ZREA 3FPAA 1Q6YA 2B34A 2QN6A 2W6ZA 5HQ3B 3CVUA 4LF6B 2XOEA 4FI3F 4OBEA 1GPAA 1GCOA 1YB7A 2APJA 2WIFA 4LYGA 1O87A 4PSKA 3MILA 1I6WA 4O33A 2HSGA 4OG2A 1QH9A 1ISJA 2PWBA 3MJDA 4GPAA 1L5VA 1LRKA 2PGNA 4RKRA 4ZI5A 3SXJA 1PJ4A 2MYPA 3NYQA 1Q12A 4MVWA 1IRIA 4F3RA 3W5IA 2IEZA 3EIOA 2J45A 1DZIA 1HDYA 1OKKD 1XZBA 1ZNYA 4JH0A 5EVJA 1P44A 1YB1A 4AS2A 3BD7A 5KEIA 3OKPA 1M6EX 2P8SA 4FSHA 1L4NA 1JRLA 1QB8A 2XWJI 4BFVA 4XGRA 4LY0A 4AG5A 4I9FA 4DXAA 2WBLC 4HWRA 3C6ZA 1FRQA 1GQYA 2X7JA 4QHTA 4DJFC 3TZQA 2E82A 1DT3A 4RADA 2WT8A 4UUPA 4AY4A 1L7RA 1G63A 1MJHA 3WB2A 5BN3B 4LE2A 1SA0A 3DHNA 4JJKA 3F47A 4R5HA 1MABB 4W1SA 3LUKA 2Y4NA 3AXTA 3GZNA 4Q3LA 1NAHA 4Y7DA 3REOA 3TI9A 2C7RA 2Z2IA 1K9SA 2Z95A 1N92A 2TECE 5DO9A 2PZ8A 3UH0A 5HK9A 1N5JA 3FYUB 3ZCPA 3HXOA 3DZFA 2A9RA 3TGLA 2ZTSA 1RRPA 1ZVQA 5CUQA 4LMPA 4DAOA 5E6RB 3WSWA 1JR3A 4AUKA 4F5DA 4WBNB 3BM5A 1V11A 2ZYUX 3WTBA 4UDNA 4XX0A 1G6OA 5C4IA 4P0QB 4HOYA 4QTZA 4E3ZA 4MDHA 3IVAA 3ETGA 2C96A 4KLNA 4G0OA 4P84A 2YY6A 1X7DA 1CF2O 3L82B 3D54D 4CIAA 1VYUA 2Q07A 3MJHA 2WICA 2Z56A 1NNEA 1JJBA 1XIVA 3DAOA 5CH8A 5G0SA 3WMEA 1D0SA 4GR4A 3N8IA 3FD8A 1RCFA 1ZJ6A 3ZCUA 1UJ6A 4RDIA 5TVGA 4MLCA 1QUFA 2OCDA 4Q3OA 3SBDA 3GPLA 3IP3A 1JFSA 2IEIA 2H3HA 1SXJA 3VAYA 2XNHA 3WFJA 4UZEA 5K6TA 5IH3A 1POXA 3KQWA 2IYRA 4WBXC 1L1EA 5AKLA 5FCDA 1H1TA 1KA9H 1NNI1 1UJNA 3PEWA 1S02A 3FGZA 2BBOA 1TF5A 3NFYA 1WXDA 3ZHCA 3L3BA 4Q03A 1FNDA 4RJLA 4D3XA 4WZAB 3GZTB 1P4HA 2FDRA 4PPQA 4XWAA 5AI5A 3OLZA 1LY1A 3KFVA 1DBSA 1DDGA 1VLMA 2LKCA 3LC1O 4G9GA 3TZLA 3E70C 4NICA 3WLFA 1YGYA 4MGYR 4Q12A 4UVDA 4HQ0A 1YBHA 1KNXA 3INYA 4BLSA 4F4DA 3WLNA 1SOMA 2OC4A 4YALA 4Y2GA 1E9FA 4AO7A 1NXXA 5EPUA 3ELYA 3D8TA 2MR5A 3IVGA 3SZOA 1IBCA 2IOHA 3K6SB 1CDDA 3BMCB 4H2DA 3DHYA 5SZIA 3PXBA 1YRYE 2GPBA 4H0CA 1K5PA 1N75A 4YXWA 3HCPA 1LW7A 1P7YA 3KYDB 1UT8A 3ZXIA 2D0IA 5HCIA 4BY9E 1Z8DA 2TMYA 4U6QA 5CGZA 1E9DA 1DP4A 4RMHA 4F3KA 3SNHA 5LZ5A 3R7WA 5D86A 2W2NA 3JQEA 1ZN8A 3OFVA 4BJ6A 3I28A 4JKIA 5DZSA 2XCQA 3A26A 1PNQA 1W4RA 3LX5A 4K9DA 1WRBA 1XNQB 1T29A 1UFOA 3U31A 1AKRA 5TJ9A 3ZZMA 1TMOA 4HX5A 1RHRA 2VK2A 1TF2A 3KKQA 4YCAA 1YHNA 2Q8NA 3CT6A 3WR5A 4I1RA 3B6ZA 3SOPA 5C5IA 2GCGA 4JLVA 2BFAA 2P78A 4B44A 2Q9BA 5IVKA 4M22A 4HQNA 1YZNA 3VNUA 2HK6A 2R6ZA 4CL3A 5BSFA 1WXQA 4ER7A 4YI5A 1OI7A 1EFRA 1T26A 4H31A 4XGNA 3H9UA 3KZXA 1U5BA 2H5JA 2PRKA 2KHZA 3AXSA 4IIGA 4INOA 4B6SA 1P33A 3X1DA 1V1RA 2I7TA 1MJGA 5D01A 1FZTA 1FU4A 3K32A 1WCIB 2CMGA 2GHQA 4URZR 5DSXA 2WJZB 2B6NA 2WYOA 4J4BA 3U4AA 3IOEA 4IXWA 2DUUA 3RT9A 2EX4A 1BE0A 4C4AA 4J1NA 1N9GB 1JTVA 5TMPA 3AZQA 5JDIA 4YFVA 2Q0QA 4PSCA 2ZM5A 1M8PA 3G8BA 1X7YB 4DMLA 3A10A 1TUGA 3LRPA 4R7GA 3OQMA 1B2LA 1GJRA 4HGZA 2F8LA 4NHOA 4UTNA 2IODA 1Z13A 3FWYA 2NPIA 1NKSA 4LC0A 4MW0A 3QKIA 3K2IA 1K66A 1LI7A 3IT0A 1P73A 3NOVA 4IIJB 3RB8A 4D96A 3NBUA 2Q3CA 5DHRA 1H0HA 3NHZA 4OX9B 3M5WA 3PFGA 4HB3A 1XDGA 1ZM9A 2HB6A 3BK1A 1N57A 2YHBA 1SQSA 2V9CA 3L93A 3OU6A 4QYXA 5JLJA 1YZQA 1GY8A 4BVAA 5JRJA 3FPHA 4C3UA 1KU6A 2XDYA 1FW8A 2J7PA 3F78A 1JJIA 3HHPA 4O59O 4TYYA 4U7WA 4Z8YA 3D7KA 1NMSA 1F2DA 1DE0A 5K3FB 4B1FA 3E03A 4YXWD 2XGSA 4L73A 3A9RA 4GR5A 3WYNA 8GPBA 2IZ0A 1U02A 4FZ5A 4DY4A 3IAUA 2GYYA 1X1EA 2IYWA 1I01A 3K1JA 4I9NA 4GOMD 2IYSA 2H7VA 1CQZA 3JQ8B 2P5TB 4MKIA 3OEHA 1TJNA 2N3ZA 4IUCS 4RPIA 3WISA 5I7EA 2YFHA 4MRPA 3K70C 5A3SA 4KJXA 4NRDA 3UMGA 1HLDA 4X6YA 2X8BA 3K6KA 4JGGA 5DK4A 1B16A 4ZEWA 4BYGA 1I51A 2BC9A 2MSKA 2NV0A 4K3VA 3E7WA 1ZD8A 3MOGA 1I9CA 2EQ5A 3WQSB 5IJAA 3QIVA 4DJAA 2O8DA 5EJIA 4IDBA 2NSYA 2HTFA 4H6XA 1PNTA 1Z73A 3BJIC 3E48A 4DCNA 4J0QA 4PBTA 2UYYA 4QJ4A 3ZU4A 1T9BA 3A0RB 3PE4A 3ZVNA 1XAGA 1EQAA 1QZUA 2J3QA 2CL6X 4JKOA 2BI8A 5EUMA 5LP6C 8LDHA 2UYQA 1EAMA 3GWZA 4ENPA 4WKBA 5DM2A 3BSWA 4N3NA 2GZ2A 2HPHA 1GTG1 1FVFA 1TUBB 4MQLA 1MRNA 4L6AA 4XVRA 4PGMA 3TPFA 3LIIA 1VSVA 4YRTA 1MDBA 4M8SA 4RGVA 4DB2A 3IQZA 2HV9A 4H27A 1RP1A 2G8LA 3HR8A 3UK7A 1E98A 3JQFC 1O94A 3P0HA 1W1UA 3HY6A 4R4JA 1WEKA 5CLJA 4XB2A 1W0JA 3RRFA 5T6MA 1Z37A 4X45A 3AFNA 2HLHA 4ZU6X 4N48A 3BGOS 1JI0A 2IY7A 4RFSA 1FMFA 2HI0A 3AOEC 4AKGA 4OHMA 2A14A 2JGRA 3BK7A 1AQJA 1U0JA 3JQ7A 1FXWA 1YK1A 2WIKA 3EF1A 1WKVA 1AF7A 1BCSA 4ZJPA 3RUHA 3I73A 1N0HA 2ZR8A 1YBMA 1U8AA 1E1DA 2C0PA 3LNTA 4HTFA 4Y2JA 5F2KA 5BW5A 5KNBA 1QONA 2BFMA 2JI9A 3BEDA 3K8OE 4IFBA 5EEHA 3QU7A 5EP2A 2EWVA 2UYOA 5TQ0A 3FGOA 4YMTA 1ZD4A 3BL5A 5B58C 2YNMD 3F6YA 4N7RA 3U0BA 2VTBB 1LK0A 5BWBA 2JD1A 2OAQ1 1F6WA 1E63A 2B3TA 2KS6A 1D8TA 3KAJA 4NQZA 3PRJA 5LZ7A 1P4AA 3SQWA 2ZSFA 2WR8A 4IIEA 2ZETA 3FFTA 1VI6A 3KBOA 3R3WA 4YPVA 1GHTA 1Y80A 2HXYA 4D8TA 3CLKA 5JAHA 1AIPA 4P80A 3BMCA 4YRPA 4TLEA 4BRZA 4XWYA 2PQ6A 3UK1A 1WW3A 2WG0A 1RC1A 2AR0A 2ZEJA 3RTEA 1ECPA 4L76A 3RG2A 4WEQA 2JLYA 2IX3A 4YO8A 3ZHOA 2ECKA 2QM7A 3OFSA 3EG9B 4GYYA 4X60A 5E9AA 2PH7A 3PV0A 2HW8A 1DTWA 1A97A 1SCNE 5BN4A 1YIAA 4MS4A 1QO9A 4Y9DA 4GP6A 2ZSEA 2G71A 3CZCA 1K8RA 4II7A 3CONA 4RK6A 4WFIA 5BOSA 1NNUA 5J4KA 4QPJC 3RROA 3X1XA 3O0DA 2OXEA 4GVPA 5ECYA 5K3DA 1SJ9A 1DX4A 1SCKA 1E5QA 1P60A 1T91A 1JAYA 2ZXFA 3AB3A 3N3AC 1MAUA 1L7PA 1QC5B 1T9GS 3QW2A 4MIYA 4XVQA 2ADFA 2EWWA 4M4SA 3SKVA 4D9EA 1KSGA 1Z2DA 2ORED 1G8PA 3GGCA 5H02A 1UPUA 3TTWA 3WBKA 3LY5A 1FIUA 1Q7BA 1QKKA 2NTYC 3OZTA 3CH5A 4PCUA 3ZCQA 1TJPB 4RTKA 4AP9A 1YHYA 1JEYB 1H5UA 3GVCA 2AG6A 3WYBA 1FC0A 2EYUA 1KQOA 2PLAA 1JHMA 2EDAA 1LA2A 3Q98A 4HXGA 4HWSA 3RHFA 1TJ5A 3WGKA 4BFUA 2XGGA 5JBIA 4U39A 4X5OA 2OCLA 2O4CA 4IFEA 4PXYA 1ZNQO 5FNVA 3S1SA 3I5UA 1P3JA 5I4IA 1CD5A 3O8DA 5EHQA 3SK0A 2NV6A 4DDMA 3U2QA 3HDJA 2WWYA 2YQZA 1XXLA 2X1HA 4C5BA 1TCBA 3OKCA 4U2DA 3THWB 3C4JA 1KGDA 4RACA 5AVSA 4G1VA 3OHSX 4Z3DA 1ZNXA 2X1MA 3MQFA 4BP8A 3W5CA 1NJSA 2G3YA 3VPDA 3QLUC 1DO8A 2SCUA 3EMVA 1JEJA 5HUQA 4E3WA 2O8CB 4BFTA 3AR9A 4IG9A 4JWTA 3WLIA 5MFZA 2X3FA 3DCNA 1NBHA 4ZZ3A 5HJ5A 2EARA 1C8BA 4KYIB 1MEOA 1XHFA 2EERA 2GAAA 2X0NA 2XCIA 4YS6A 1MABA 3PC6A 1R1DA 3BCRA 4ZQBA 5E6UB 1I2MA 2VJYA 1V1JA 4OI0A 5ITWA 4N3GA 2YYAA 3L4BC 3DJFA 2P62A 4IVRA 3GBVA 2BELA 5HIAA 3FWKA 5JAMA 4HH1A 1KKMA 4KWIA 4QUDA 3U49A 3B1KA 3RFFA 3BAFA 3QBJA 3FDZA 2HJSA 4LOKA 1EFRD 2QN9A 3UHFA 4EI8A 5AW0A 3TQTA 4TTVA 1RKXA 4MLPA 1HQCA 3ED5A 3LC2O 3O03A 7AT1A 2GPNA 4PTLA 3CNLA 3QVVA 3ICEA 3MERA 1S3FA 1XDBA 4NV0A 5HFAA 4PAOA 4UVEA 1SUEA 4FN5A 4OF4A 3KDPA 3SICE 3CRW1 4TZ0A 1MXFA 5CBPB 3P2KA 1JLLA 4MO2A 1L7DA 2P2YA 1QCDA 4FKZA 2ESRA 4RVDA 2IDMA 2V6JA 2IIPA 2Y8EA 2UYCA 4CEHA 3KPWA 3PNLA 1YHZA 4U6SA 1E2BA 1HOXA 3VU9A 4OI2A 4CMEA 5GMOA 3ADOA 5F7XA 3OKAA 3T7IA 4LNAA 1W8IA 3QNMA 5EMMA 5F51A 2XOKA 5HM6A 5EIAA 1JE1A 3PHGA 2YXDA 1OWPA 2FQXA 1AXGA 3OX1A 4QJ5A 2E4VA 4TV9F 4U7FA 2BF7A 1NQUA 2XAAA 3I6BA 1PR4A 1T9AA 3X1YA 3IEUA 3P2JA 2WYHA 2YIJA 2I1WA 4KG7A 1XFAA 2A3RA 1HUQA 1U9IA 1US8B 1PIWA 2ZIGA 2ZDHA 3ZHZA 1G8MA 2RAPA 4I46A 4JLOA 4HVCA 2OQIA 1ZJWA 2G1AA 1J07A 1JMKC 1MEJA 2OQRA 3VZDA 4YYZA 1DUIA 2O2HA 4V1CB 2JLBA 2QIOA 2NUBA 3IDFA 4M0MA 4PZLA 5I48A 3OT5A 1RQXA 2QVBA 3FDIA 2P4EA 1VCOA 2ZYSA 1N9GA 4IIHA 1Y1SA 2KBFA 4DVJA 5BQOA 2Q4RA 1FPQA 2OGZA 3M6XA 3L7CA 4LJSA 3UJPA 1MKYA 4FNAA 1MRZA 1A1SA 3BL6A 1H6AA 1TM3E 1Q1NA 2Q1SA 4LHSA 1AH2A 1JEQB 5JVDF 2D7JA 1EEXB 3AR3A 2EVWX 4LE1A 3HY3A 2CHEA 2HKIA 5IZCA 1COWA 4DJTA 5IH7A 1C3OB 2FFRA 1Y7PA 1WETA 5LMZA 4YRZA 3HCEA 3OIDA 4CLDA 4OLAA 1OVGA 3QLTA 1C3XA 5BN5B 3HKCA 3KB2A 2DWPA 3EDOA 5BOVA 4J43A 4F3NA 3I01M 2NOAA 4PO1A 4B5KA 1WY7A 3K9NA 1V2HE 1A9SA 1GDDA 2PZLA 3WHIA 2NU9A 3WLJA 4ZV9A 3FHLA 4LSZA 3HU2A 3ANMA 2CJPA 1CDZA 2OSVA 3O90A 3G1WA 3LCJA 5HS6A 2NU7A 4JBNA 3ZGZA 4N8EA 4H16A 3W6UA 2M98A 4DCGA 1CYEA 1D7AA 3EGCA 1TQ8A 3M4XA 5J4HA 2ISSD 4IJMA 1RWBA 1UADA 1T9KA 5FOUA 5H4GA 2COKA 1CUAA 1NUPA 1EGVB 2GEJA 5LLTA 1YS4A 4P3OA 4A26A 4L4UA 3ZW9A 1OLUA 2K4MA 1HKHA 4WX2B 3HCCA 5AO9A 2JFUA 4TXNA 1RMTA 2JL1A 4ZDJA 1N2CA 2YC4C 3FJYA 4DKJA 2WZDA 3TNLA 2GEFA 3H11A 3K5PA 5FWYB 4ESVA 2OM6A 1G8AA 4H0FA 1EJBA 5CX1B 1NP7A 3EUFA 4FILA 2VEOA 1DRUA 1TZCA 4B43A 1II9A 5MHTA 1M1YA 3LSYA 3G2HA 1E5TA 5C5DA 3MXTA 1L4YA 3LBFA 4MJ3A 1FDVA 4C0XA 3A3KA 5E4TA 1HZZA 1G5PA 1LSJA 3AEYA 3JZIA 4RK1A 4C2UA 4WA8A 5HF5A 1MAAA 3VX4A 5TS2A 5BWMA 4Q4AA 4V3CA 2RI0A 1SQGA 2ZYAA 1I4TD 2G82A 3FXAA 1EINA 3ITEA 4HL6A 1JNXX 4HBZA 2H2HA 2P6NA 1QH8B 1E32A 3WLMA 2F2TA 2XUKA 1H2BA 4LXTA 3PEUA 2JVIA 3GEMA 3VA7A 4PQEA 4LRQA 4EGSA 5D6NA 1N34B 1K89A 2O2SA 3C48A 5AOVA 3NHPA 4CLOB 4JITA 2WJPA 3AWIA 3GMSA 5F5NA 2AFIB 2BI4A 1U0FA 4DLWA 4F0JA 1NBWB 2ATIA 3CZAA 2F9LA 3M6LA 3RAPR 1P2DA 4XVUA 5KMGA 2J6HA 4RANA 5AJWA 3ZEAA 1BJRE 3DOEA 2NXEA 1Z5VA 1CP2A 1E1CA 1YI1A 3D6JA 4I4TF 1QHSA 3TXXA 2YDXA 1A7KA 5KCMA 3WXBA 3PGA1 1RM5A 3QBTA 5EIOA 5KOHB 3DL7A 4BB6A 2WJIA 3TQOA 4BN0A 5U4QA 4PRLA 4XWWA 4JLDA 4CM8B 1Q0PA 5K51A 3TN7A 4D5GA 4ND3A 1C4XA 5DCLA 4RHYA 2AJBA 1Q7CA 2C8LA 2A9KA 1LLDA 2BCGY 2G06A 3PQ2A 3FYUA 2FN8A 1UKAA 3GN2A 3JS5A 5AKEA 3ND8A 2XNKA 5MN5A 4UNQA 1OCEA 3KXPA 4YUZA 8AT1A 3OM1A 3OIVA 1GNLA 2WWTA 2NNLD 4FFWA 4JJAA 2WF5A 4L9WA 4XRGA 1ESDA 3I1IA 1K6IA 4TL8A 1EVKA 2RHOA 4S12A 1X1RA 4CQMD 2XT9A 4P3XA 1Y0BA 4X9XA 3BGVA 4BC0A 1E8NA 2C78A 2NV2B 1CEEA 4KOEC 4LECA 2FSUA 4MYUA 2Q99A 4BO2A 4QU0A 4B2IA 3G5TA 2GWHA 3A25A 4DVGA 3CZ9A 3QPAA 4I36A 4LS3A 4WXYB 1JIXA 4LXGA 2C88A 1Y3CE 4QICA 3WO0A 3PIDA 1QX4A 2YIVX 1W47A 3RUDA 1TGYA 1RLIA 4RDHA 3RJ9A 3L4SO 3PTLA 3N7UA 5KWJA 2AGVA 5AXDA 3R41A 4YRNA 3S2YA 2IT1A 3OICA 4FLEA 1C2TA 1GD1O 2ZWMA 2FU5C 3B52X 3ME5A 4L02A 5GJWC 3SS8A 5HQTA 4AX8A 2N75A 2O3SA 1VRVA 3KQUA 3C8UA 1QF7A 1SU4A 2G1UA 1DQRA 2I6TA 3PX2A 4I4LA 5I9SA 3WWEA 1DGQA 4JGBA 1FSGA 3TRHA 1ZNWA 3U44A 1Q6ZA 3MVEA 2JW5A 1DFHA 2IUFA 5DCYA 1JIKA 4JBGA 1FFYA 1AQLA 3CJQA 3CWQA 4AWXA 4YAOA 1G5IA 5B7GA 2BI7A 1LNSA 2BZGA 5JCPA 3AGPA 3NX4A 4CV3A 3G9QA 3LCMA 1GPDG 3BB3A 4IVNA 1PJ8A 1NXWA 3NALA 3SIRA 1KI6B 1PQYA 2H2IA 2FLWA 2Q5OA 3NNNA 4ZHQB 5EJ7A 2QLMA 4DC9A 2QAIA 1IONA 4WVLA 3QPBA 4DRYA 4HWTA 3R77A 4RIIA 1G5FA 1CDOA 5GV7A 1PEAA 1VA4A 2ZI6A 2YRXA 5JANA 4NZYA 2F55A 4MEBA 1ZSVA 2NPOA 1EVEA 1OYOA 2QR3A 3R7NA 3ND9A 1XZPA 3KALA 3PJRA 1K6JA 3NH9A 1RM3A 1EP9A 2PEZA 5EJFA 1RCUA 5CCDA 1KERA 3N2YA 4R5MA 4ZV4A 2X5KO 1ORTA 3ZKAA 4WGFA 4X1IA 2QYOA 4HAXA 3GFOA 2C00A 3BDAA 1RAIA 1X7WA 2PZGA 4GKVA 1IEVA 3NM4A 3SY8A 1KWGA 2WAXA 4OHYA 1U2PA 2IZ1A 4BAUA 3FF4A 3K5WA 4RY9A 2JLRA 1P1JA 4P3NA 3WXMA 5M7EA 2JLWA 4CV0A 4FMBB 3LTNC 2C7VA 3FVQA 1W96A 2XWQA 3KB6A 3EGXA 3TAXA 3ZNQA 2L82A 1QTQA 1RNLA 2OLJA 4KQKA 5FUXA 1KQ3A 4BIIA 5BV2P 4FDVA 1E4EB 4TWAA 1Y9AA 4NFHA 5B4UA 1YULA 5TMDA 4L7VA 4R05A 4TKUA 1DJOA 1E1CB 1KR2A 3AI1A 5CMLA 2RGRA 1HYGA 2DR2A 1KYVA 3AR7A 1OGJA 3P2OA 4K9KA 2JHCA 1GARA 2P0YA 2W2KA 4G85A 4KQWA 4TYQA 3S55A 1E3JA 5LQAA 3N76A 3DC7A 2FCAA 4BUJA 4YP7A 3T1VA 2QYSA 5BVGA 4ZJYA 2O50A 1D7OA 1Y8RB 2W2VA 4ZICA 2WILA 4JLBA 1M54A 4XPZA 3UW3A 2VHWA 5A0TA 2XXBA 2A33A 3IO5A 3OO0A 4XGIA 5JSYA 1WU7A 4GP7A 2I4LA 2Q2WA 1CVLA 1E1NA 3E53A 4LPKA 4KWEA 4EL5A 4AXBA 5EKDA 5BMOA 5IMSA 3U9SA 5EWLB 1TDJA 2I66A 4MSUA 1JJAA 1CUFA 1JIUA 1MTOA 1RRVA 5DHFA 3QRWA 2Y0BA 4EB6A 2F1HA 4Z3OA 3VZSA 3A1CA 1OLOA 2PE5A 2PRIA 4ZAYA 1S1MA 3WDKA 2HRBA 1WXEA 3C1TA 4Z99A 1C30B 3RADC 3I2YX 2NUAB 5JMPA 2FRDA 4LYDA 4PONA 1ZAYA 4ZO9A 1KJIA 3SKYA 1RYYA 4GM4A 2QMQA 3FWNA 5JIBA 5JC1A 2OHHA 4URHA 5KQPA 1XRPA 1XTTA 2ZATA 3FPEA 3JQPA 1A4XA 1X9GA 2H6EA 5KHLB 1N6PA 1TAQA 1NSYA 3S2EA 2IKSA 3CGWA 3DCIA 4N5NA 3ZWOA 1FTGA 4W7SA 2BSAA 5I7RA 1Z0JA 4YB8A 3O4VA 4G23A 3C70A 1IJFA 4GGOA 5I9MA 4IQGA 3QYAA 2EW8A 4ETIA 1XTSA 1J9EA 3L7AA 4DREA 5IANA 2ZR7A 3HDYA 1ONBA 4YY3B 2H8GA 2KLBA 3OD1A 4P22A 1GLVA 1HDZA 4AKSA 5K4GA 1Z0UA 3KZVA 2VSFA 1OBFO 2BTQB 1Y89A 1SCUA 1QKIA 2VN8A 2PGJA 5F5LA 1I7PA 4L5YA 2R0QC 3RG8A 1W85B 4NLLA 4J2OA 3RDPA 3VNVA 1JLKA 2FZKA 3VU0A 4E33A 1SVWA 1KVRA 3KEQA 2H2FA 5A4DA 3N2LA 3VH2A 3GR6A 3T52A 1X87A 4CMJA 3IBYA 3H84A 2UZ3A 3CU5A 1XU7A 4RQBA 2OP1A 3RASA 3T3GA 4WN9A 4CTKA 2UUCB 1YR8A 5T7BA 3ZN2A 4HNAA 2FAXA 4ZVMA 1ZZEA 3VNQA 1Z7YA 4MP8A 5FLKA 2JB9A 3UICA 2IHYA 4G1EB 2NXCA 1BQ3A 1YQXA 3OPYB 4EFDA 2GNPA 4X93A 4PIVA 4KQFA 3LA6A 3VSDA 4D3ZA 7MHTA 1B23P 2R66A 3HCOA 1A7AA 1SOUA 2ZRCA 1Y34E 2BR3A 2Q3EA 1HEIA 4GXRA 2QRVB 4RDCA 3RUPA 2O57A 4N5MA 4C9BA 3QLVC 4S2UA 3MCZA 1L7XA 4JL8A 4RSMA 2O7VA 3WLSA 3KBBA 1NI4A 3ZY4A 5I7HA 1NYLA 3WGNA 1KORA 1YE3A 3GT4A 1I4OA 3BJMA 4G25A 1PSWA 1TU0A 3GFSA 4AICA 2H5IA 2FB9A 1VQ1A 1OROA 3IEPA 1BAPA 1TD1A 2AOUB 2AXPA 1ZH8A 3IQDB 1KE1A 3L8ZA 2JIOA 4HX2A 4IEFB 3W2GA 2ZS9A 3ZH9B 2NN3C 4FMCF 1RM4A 3OO1A 4FGLA 4CIVA 1RCTE 1JTFA 4HZUA 5DM0A 4UTRA 3FDJA 3PNOA 1JIJA 1YJBA 1FXWF 4G84A 3L6DA 1ENYA 1NBAA 1NOKA 2HXGA 1W5TA 2QQFA 3AHIA 3NW9A 4OA5A 4CMEC 5AUPB 2FKNA 3A58B 1SZJG 5IBPA 1Z0SA 2AE1A 5KX5F 4GEGA 1R15A 1SXPA 1VSQA 1SD2A 3GPCA 4JYBA 5IM5A 4J1TA 2JFOA 3L8CA 4R1UA 1M74A 3C74A 4Q7MB 4WKGA 2BLNA 1E5XA 4HZIA 3EPHA 1RDFA 3LX4A 3VXKA 1IWBB 4P7KA 4DJEC 1N2OA 1L8LA 2PKWA 3JTMA 3PRHA 4QASA 3QMVA 1WB5A 4CQLA 2FMIA 4NOMA 2ZYIA 1UM9A 1VBNA 2HNAA 5BN1A 1P17A 4JI3B 4WK6A 1L8AA 2H1HA 4BZWA 3DMPA 1OD6A 1O6CA 3ZIUA 1JYEA 4F84A 1VP9A 2WD7A 3B6IA 3DTYA 1K86A 4LTMA 3HLTA 3RUAA 4EHDA 3W4IA 3GLIA 1HDEA 1D4OA 2A1TR 1L5RA 4KAAA 3OT1B 1KO7A 1KYXA 1WCWA 4JI7B 1Z8FA 2GZAA 2C58A 2OHVA 3FCXA 4K1LA 1W76A 2CC2A 1CV2A 2HXSA 5GONA 4OGLA 1D5CA 1ULBA 2QI9F 3QXSA 4JQYA 3BMNB 4R7TA 2DSNA 4KX3A 2HRZA 5LZ9A 5BVGB 2BOVA 4C0BA 2JJ1A 4PRKA 2GM4A 4AJOA 2FPIA 3DH0A 2WF8A 4P4SB 2AX3A 3ZDZB 3PQFA 2AF4C 3A1WA 3UXHA 1IXRC 2ZUDA 4RAQA 1RFGE 1Z0ZA 3QU9A 4UDYX 3THWA 2ASEA 3BICA 1QYDA 3OSUA 2XW6A 5J2TF 3ZQKA 5BVHB 4NZMA 4DS3A 5BSWA 3T7EA 4HZGA 5ES4B 4UBNA 4XM2A 3KJEA 4NWIA 1JJFA 5CB4F 2FXVA 3FSEA 3QEMB 4NS4A 3KQOA 1PS9A 1V8DA 4MDEA 3WNZA 4E2YA 3WIOA 4LJ7A 4YFYA 1XVUA 4F21A 2PTGA 1ZVJA 1G7SA 2YVQA 1VMKA 3DVLA 3HKBA 4QHYA 3HDVA 1VE5A 1MT3A 3OEYA 3S1LA 3U3KA 1GUZA 2JVJA 5TQ2B 3JWGA 3ZQ6A 3MN1A 2CV1A 1RMYA 4I4TB 1X7ZA 5L3QB 3BB1A 4YRFA 4CGZA 3FPGA 1TMKA 2O1XA 2WKPA 3NBQA 3X1WA 3EHEA 4CU2A 4TVKA 3GLIE 1DV2A 4AZSA 3QUAA 4B46A 2FPRA 1H4QA 2WINI 1UAGA 1XEFA 1Y98A 1KO5A 1KAGA 2INGX 4C4SA 5LNK6 1Z8HA 3IOCA 3TSAA 5JD5A 4TZ6A 4B3DA 2X86A 1JB9A 4GP9A 4LDNA 4B3FX 1SM4A 3LC7O 2JJMA 4HB2A 3LQYA 5LJLA 4OGGA 3QYPA 3Q8KA 4DYVA 4CUZA 3IHTA 1JLMA 1U1FA 4CQLB 4PAMA 3Q41A 4ZHSA 4RMIA 1A98A 1NI5A 4BE7B 3KTDA 1QNFA 1D8AA 2PU5A 4E08A 3IH5A 2P2SA 3GRRA 3G8DA 3CVVA 1XO1A 2PUWA 1PLLA 1WQ1R 1GDHA 1ZM3A 5CA0F 1YR2A 3QK7A 1LI4A 1IUOA 2B30A 1W93A 3ZJTA 5HZHA 4HQLA 2I62A 4BQSA 4CTNA 1WBBA 4RWEA 1X15A 1XVTA 4L0QA 5JJ5A 2P2NA 4UBIA 3AETB 5L51A 1SHTX 3C3AA 3SZMA 1PHRA 2BKAA 2VDKB 3IOMA 4LMBA 4OJQA 4IMRA 4ARAA 2XODA 4CN8A 1XL0A 4XDYA 1TZBA 3LNCA 4RAOA 1QAOA 4PLCA 1KIMA 1L0BA 2AC7A 1HTWA 2IVZA 3PE6A 5LU8A 2IV3A 3K94A 3KVYA 2EAUA 2OECA 4N5DA 1CETA 3EVNA 1T5HX 1WLYA 2MINB 4HY3A 3E2MA 1E0DA 4PYLA 1Z4MA 3LS2A 5EUQB 1G8SA 1GRRA 3NIFB 4B09A 1V5EA 5G0VA 2IXBA 3GROA 3JSXA 3O8OA 2M32A 2UYGA 4HNQA 4EFLA 3PNKA 1DB3A 1Z39A 2JFYA 3P9ZA 3ZGYA 4BBZA 3EMKA 3JQFA 3VV2A 2C95A 3TLJA 2KMLA 5L9AA 2R7KA 2ZZMA 3BEOA 4NESA 2QTLA 2YJNA 5F5XA 4EKNB 4YCNA 4PN7A 3FJ1A 3WC4A 3ZJVA 4PXSA 5ALEA 3I53A 3Q3EA 3SFTA 3WL4A 4C20A 1P1CA 4D98A 4LWOA 3ZTWA 5KC8A 2Q6VA 3DDZX 3EH2A 3H04A 5CA1A 2H1FA 4H3HB 4RF3A 2V74B 1KYIA 5A9SA 1KY3A 2EFYA 4URVR 3UMYA 2PXAA 4FIZA 2VYCA 1DC7A 4EHFA 1TIKA 5IX8A 4WCFA 5NLLA 2BTQA 3I0ZA 4M49A 5JD3A 3I39X 2V7WA 3DTTA 4JIGA 5CBKA 4OHVA 3P52A 3A2NA 3H7IA 3RFTA 5JV5A 3HJUA 3GP3A 4MRSA 5KYYB 3OIYA 1Y1RA 4FK8A 4G56A 4MA0A 5AM3A 1SHJA 1Y4UA 2VQ6A 3G9TA 2HHHB 3G0GA 3IP9A 3KPYA 3EIEA 3Q9LA 4FINA 5CXUA 4OHWA 3NNSA 4R9UC 4UNNA 3USCS 2H54A 4CI0B 4Z4CA 4GX1A 1SQFA 3G6WA 1G20B 1XMOB 2P4UA 4HQFA 3JQ8A 2DT8A 3RBXA 3ANNA 3VH4A 3UT0A 4E5NA 4BO3A 2O6HA 4OBBA 2O0HA 2PO7A 4Z5XA 1WVMA 1ORWA 4I3GA 4TV9B 1PR3A 1PD0A 2JEZA 1FSSA 3O8CA 2Q3BA 1QG2A 4GBMA 1LFAA 3BCUA 4RMGA 3VR6A 1ITZA 1J6UA 2K2QB 1TUIA 2BDEA 4QVKA 1MN6A 4TTAA 1A27A 3C2QA 3E22B 1T9CA 3LK6A 4EQ6A 4EUEA 1PSZA 2C92A 1P0IA 5T3UA 2Y77A 3ITNA 4CR6A 4PZEA 1MNQA 3MJEA 1L5QA 1GCUA 2OKCA 1WV1A 2X0EA 3LPLA 3LAWA 4H6VA 5FXMA 3HFJA 1EWTA 1NAIA 1YA6A 1DKOA 3NRBA 1YJ8A 5T4EA 4GZ3A 1V2GA 1SOAA 1PFGA 2FWPA 3MTIA 4TTSA 5DWVA 1P72A 2QM0A 4I8IA 4FTWA 2FZWA 3PJGA 1FS5A 1E58A 1UWVA 1Z5PA 2NVUA 1AF4A 1Z6PA 3NWOA 4MQMA 3ZE9A 5IC6A 4R84A 2VTEA 2VPWA 1NQAO 3M2PA 3UF0A 3R8FA 3BYZA 2V6IA 2RG7A 4B3CA 1JPNA 2PZFA 2OLEA 3WL3A 2WHXA 4DIKA 5BMVB 3S8EA 5AM1A 4JI4B 1EGHA 1X7GA 3D4PA 1NMEA 3KCQA 5JDIC 4F4HA 4G1CA 4M9SA 2WTMA 1QIIA 4J7XA 1MQ8B 2ZI7A 3T5PA 1Q50A 2PRSA 3L02A 2AI2A 3DV2A 2R44A 3FPCA 2V4MA 3F5QA 2QTBA 2VYVA 3JASA 3UOAB 4MIKA 1G60A 1XMXA 2BGLA 2VAVA 5BN5A 1BOFA 2QM3A 4B3GA 2OR3A 3PI7A 3IYLW 1KZ6A 2C31A 4X8OA 3OJOA 1JFLA 5K0LA 3BRQA 4OP1A 4X85A 1ST3A 4TS9A 5KDDA 4QDZA 3AVUA 2HADA 3BDIA 3KQKA 1CHDA 1J2YA 3GRZA 2FWIA 3D8NA 1NRXA 2IYAA 1R5BA 1D2HA 2G4VA 4G0ZA 5ESXA 3RS2A 5FEMA 5AW9A 3VVLA 1LBEA 2UVDA 4L9SA 1GPKA 2C0CA 3GX1A 2ET6A 1KYQA 4MJLA 3V1LA 1KYZA 1X70A 1K97A 5ULLA 5A3JA 4CKCB 2PDAA 1SZDA 3QVGA 4FMPA 2YBDA 4MCJA 2GBCA 2AG8A 3T8YA 1T0HB 8MHTA 1TGVA 4RVHA 1H85A 2O0KA 1QGYA 2OD9A 4TTIA 3GJYA 5JXIA 2FGJA 5BO5A 1CJKC 4FUTA 4REQA 4KIFA 4OXKA 1K8QA 1PWEA 4DADA 4DLXA 3N0VA 2HN9A 1JF8A 4EBBA 5C35A 2YJ3A 5HE9A 2VT7A 4JXJA 4CIYA 3H3FA 3G0DA 1L4EA 2PX3A 2Q4EA 1JIQA 3Q40A 3FVRA 4OJKA 3TBFA 4GPD1 1WMEA 3HM9A 2Z2KA 3LE8A 5B6PA 5PGMA 3LDHA 1K92A 5LA6B 5D5HA 3HXLA 2HMAA 3EGEA 1TK2A 4H3SA 1NNLA 2X76A 4LW8A 3ZD9A 3LGXA 4XARA 3A4LA 3BERA 1EAYA 1CJMA 2GNOA 4WK2B 2HUNA 1BKSB 1F0NA 1B2RA 1XCPA 3DAFA 3P7MA 4NQRA 4QYSA 3C43A 3QMMA 3EBLA 3HVKA 1M7BA 1NW8A 2XWBF 4LFCB 2WKRA 3Q8LA 3WWZA 5F1PA 1Z6GA 2HBZA 2UYHA 2YVKA 2Q8QA 2CSXA 4TLDA 3EIFA 1E2HA 2ACKA 2C2ZA 4KP7A 1SD1A 4YYEA 1FMJA 2TMDA 3HGQA 4UU7A 2DJ5A 3O93A 4DG8A 1RZRD 3W90A 2HBRA 2Q3DA 3ED1A 5E6RA 4CL2A 2R1ZA 1I3CA 2ZUEA 3RIXA 2VP9A 1MO4A 1VPVA 6YASA 1FK8A 4WNYA 2ZR0A 4Q16A 2AWNA 4BVHA 2QSJA 1XAIA 1L7QA 1YC2A 4P5PA 4Z51A 2VPPA 4JUAA 4NYJR 3AFGA 4IKEA 4KE7A 5G53C 5BT8A 1OASA 5HF9A 2P77A 3V80A 4E4YA 3FIJA 3Q1KA 1B0AA 4OP2A 4X92A 5TDHA 4UQLA 2A8YA 4EAQA 5JCZA 2EFDB 1H4SA 1F51E 5HM8A 4TKVA 1VLZA 3IV7A 2RHRA 4KVFA 1ACMA 4FZJA 1MOPA 1TO2E 5AWFC 3ZWCA 5FAKA 1GTVA 3D4IA 3DD1A 2RGCA 4UC0A 3M1IA 5DNVA 5ALMA 5C8VA 5IK2A 3GIWA 4L8LA 3GLKA 3ESDA 1J97A 1GNQA 1NULA 4HDSA 3TEFA 4D5EA 5FA8A 2YJ4A 4HDRA 3CX8A 2O8EB 1QTNA 4ND8A 3L4JA 4OHKA 2PQ2A 2WTBA 4LMAA 4TPKA 4FPXA 1ZD1A 3BKWA 1VLLA 4PSDA 3F7OA 3ANXA 1OIXA 3PXCX 4NDAA 4D3SA 3OCCA 4KTVE 4CL0A 3DS8A 1A3CA 3EF0A 3H9CA 4FCVA 3VYVA 4TTTS 1HZZC 1W8DA 1UZUA 2GEKA 2R8BA 1U3DA 3SU8A 4FR2A 2GN2A 3WGTA 4MXDA 5DBGA 2TRSB 2E87A 1FMTA 5JPIA 4B3XA 3U81A 2GF9A 3PCRB 1ZISA 4BHTA 3NYRA 3V9PA 4ZZ1A 3ILSA 5CAEB 2VHXA 2WQZA 3SN6A 1SC9A 1WX1A 1CQIB 1FJHA 5TNXA 1DIAA 3HJTA 3B85A 2QNRA 3T15A 3B38A 3GG9A 4S35A 1NIJA 4TMZA 3Q2KA 2QT0A 3W9UA 2Q5CA 5A4KA 3FNFA 4HEJA 1YK0A 4G5HA 1D5WA 5IKMA 2X9VA 4ABYA 2ORIA 2XAUA 1EEHA 1N1GA 4LGMA 3TOSA 4D0SA 2CJXA 4GC5A 1P77A 2BEKA 4O29A 1N3YA 3ZWMA 4D0LB 1E5LA 1YMUA 3GF4A 3E9MA 3RI3A 1SXJC 3LDGA 5H59A 2W8ZA 4LDPA 3EXFB 2PG3A 2QRQA 3H0EA 2ZBRA 1GSIA 3NAMA 1L5MA 1VJRA 1EFCA 1N2XA 2M1XA 1V39A 4MI6A 4C5CA 1QAQA 4OQMA 3BFVA 4MTCA 4ZOQI 3MGKA 3AH8A 1EB9A 1R16A 4D8UA 3AVQA 3L1IA 1X8KA 3GV0A 4F12A 4OCZA 2CV0A 5DFAA 3ZTTA 2R4TA 3WGQA 4JLAA 4MGEA 3RVLA 2YH2A 4RSGA 3UKDA 4XKJA 2HA7A 2G1PA 1JKJA 4W8OA 1T6NA 3FLEA 5HK8A 1G21E 1XKQA 1QVVA 2GBPA 4YJGB 2LKDA 1R9GA 3IOYA 3BGDA 5KQLA 5CYGA 4RF5A 2X4LA 4M8KA 3WV5A 2WHPB 4BNJA 5LM3A 3V00A 1P2GA 3RUCA 1A4RA 3G49A 3SR0A 1XTRA 2AR7A 2PGLA 1Z7BA 4GOLD 2WQ6A 2BJVA 1MX5A 3CQ9A 3AK4A 2OO3A 4TKVB 1P7VA 1JSXA 2BFPA 1B3BA 2VLIA 1EFHA 5B4TA 5AI8A 5CXSA 1G8YA 2VPIA 3AKCA 3MPOA 2VDQB 5TARA 3UMRA 4Q15A 4BKOA 1C9YA 3ENVA 3PE3A 1W73A 1M0TA 1PD1A 3L41A 2G9UA 2XYPA 3R0IA 3SOZA 4LDQA 1ORVA 4L07A 1APBA 5KX5A 3D81A 3PNPA 1N7GA 3IE2A 3HZRA 3HA5A 1XQXA 3TZHA 1N2BA 3T3HA 1L7VC 3EDCA 3FOBA 3DV0B 2PGXA 4I5IA 4JUFA 4X90A 2GI4A 2QQ0A 1OXTA 3UENA 1A9OA 1Q22A 5HZMA 5T57A 1RBQA 3ZHQA 4YEDA 3DONA 3QBDA 4TWJA 3DXXA 1SOVA 1VJ0A 3VMMA 4YV0A 4RD0A 2GPSA 1O4VA 4F5WA 1P5JA 2V7UA 2PX8A 1FA9A 4LGYA 3VYWA 1OXBB 1PI3A 1SEPA 2GTHA 1I2AA 2VBIA 1IVNA 2IZZA 2H3EA 3KVRA 1YDHA 2ROQA 3OTIA 1T8PA 2GHRA 1UOPA 4IVQA 2R8YA 4XR9A 4R68A 4DV5B 2W93A 3OIUA 2Q45A 4WECA 1VE6A 4DHEA 4EHBA 1Z38A 4GYKA 5JD6A 2QXUA 5E2AA 5DB4A 1NF8A 5BYKA 3RIEA 1E3MA 3KSRA 1GPWB 5HJ2A 3AR4A 3D8BA 5AVOA 3TIXB 1G42A 2G25A 3REQA 4O4HF 1DXOA 3ZD8A 5F52A 3GEEA 3C16C 2QGNA 1ENOA 4G8JA 4TTJA 1SUIA 4YJ3F 5B55A 1RQ7A 1PG5A 1K4MA 1POWA 1LVGA 3DDSA 5CXQA 4XZ3A 2ONJA 5KVAA 4AJEA 2ZWVA 4JVNA 3SEAA 4E09A 1E3DA 1A8IA 2JATA 1MUUA 4XFKA 3TCNA 5FI3A 4YJDA 4DARA 1GSHA 1MC8A 1XP5A 4HEHA 3MT7A 4OSPA 5AW8A 5C9ZA 1UKYA 2RGNA 1F8UA 2AG1A 4GOOD 1X7YA 4O2BB 2X8WA 1W4BA 3PL5A 3PT9A 1KOGA 3I62A 3NI2A 3AX6A 4QA9A 3NVKI 3PXDA 1YB6A 2W6JD 1M72A 1N0VC 1NY5A 1OSNA 1PQWA 3DLIA 4OM8A 2EQAA 3DDHA 5DTEA 3QQ5A 5EMNA 5TT1A 2R68A 3KT0A 1RYMA 4DBZA 2Z1NA 3HVUA 5E7MA 2WHPA 3MQ4A 3K20A 1E1KA 5CHYA 3V1NA 1SCIA 4YMHA 4D4GA 3WKBA 3AUFA 4HSEA 2TMKA 4B3JA 3R8CA 1JWAB 4S1NA 1CUGA 3E35A 4EOGA 2LCIA 3UY4A 1VYVA