5EMKA

Crystal structure of prmt5:mep50 with compound 9 and sinefungin
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein arginine N-methyltransferase 5
publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 212
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emkA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emkA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emkA02
4BLUA 4E2WA 1F3LA 1XLAA 1XICA 1XLIA 3VYWA 3BUSA 4X61A 1INLA 2OB1A 4E2ZA 3ELUA 5B7YA 5KS2A 3DX5A 1BHJA 2P1DA 5FCDA 5DX8A 4GLEA 3FUTA 2A14A 3G89A 5DXJA 4QE5A 3SXJA 4QE1A 3TM4A 1I1NA 3UJ6A 3NTVA 5CVDA 1EAMA 1KP9A 3LCUA 2IPXA 5KQSA 1R18A 5EMLA 1ZGJA 5LR6A 2AVNA 2JG3A 2AOTB 2GS9A 2I6GA 2PT6A 3GRRA 2UYQA 2Q41A 4L7VA 2NXCA 3E23A 4QDKA 1EQAA 1TW3A 2AVDA 3HEMA 4FP9A 4YUWA 2NXJA 4MTLA 3UJ7A 2QUMA 5ERGB 3TPZA 4GQBA 2AR0A 3KQTA 3A4TA 4WVLA 4KRGA 4POOA 3LX6A 4IKPA 1VBFA 3NGFA 4IWNA 1QAMA 2ZDSA 1XIMA 1JG1A 4BP3A 4ZB5A 1XXLA 2P3OA 3OE4A 2GPYA 3DOUA 3L23A 1T43A 3EVBA 4BLWA 1Q0TA 5G02A 1IXKA 1KHHA 2NP6A 3QC0A 2FRXA 2P3QA 3AXTA 4MWZA 2BR5A 4PNEA 2ONYA 1XJ5A 2I9KA 2I7CA 2YR0A 3IUIA 3JWIA 3P2IA 2PY6A 3C6KA 4QQNA 1SG9A 2PXXA 3AY0A 5EVJA 2C7OA 1FP1D 3KR9A 4QTUB 2ZBQA 3AYTA 3HVJA 4KIGA 2I57A 2ZBPA 5DTMA 4ER3A 1XP3A 4Y30A 3EVEA 3SSMA 5LQAA 4A6DA 5EKUA 3TRKA 2HK1A 5K8VA 3AXSA 2ZLBA 1QZZA 3HCFA 3I5UA 3M6XA 5EIFA 5BXYA 3X0DA 2IH2A 2P40A 5FUBA 2VDUE 2GB4A 2ZSUA 5CVUA 4GC5A 5CM2Z 3T7TA 2BR3A 4E30A 2VDVE 2B3TA 3BGDA 8XIMA 4EK9A 3CC8A 1XIBA 3VNLA 2AOUB 3FTDA 3HVHA 3OU2A 2PBFA 2O0LA 1QYRA 2DPMA 1G6Q1 4QPPA 1I60A 2JH8A 3BKXA 5DM2A 3UXIA 1N7JA 4RTJA 3PTAA 1D8WA 3REOA 3RODA 2ONZA 2PXAA 3EEYA 4M7RA 4GBED 2ORED 4XIMA 2GA9A 4YTTA 2YXLA 3TVAA 3KBWA 3C0KA 3G5LA 5ICFA 3CKKA 4AZVA 2B9EA 5C0OE 9MHTA 1JR4A 1P1CA 5DM4A 1QUMA 3HCBA 2AOWA 5FADA 4CKBA 4E33A 1D2CA 5LSAA 1JQ3A 4XCXA 3R6TA 2AN4A 1DE5A 3UJ9A 5EMKA 1XLFA 5EC8A 1DCTA 4OA8A 3EPPA 4XUEA 2QW5A 3TM5A 2IGTA 2ZZKA 4FGZA 2XYRA 3IEIA 1XLGA 3M0HA 1NV9A 3P9CA 4UOEA 1WXXA 5HIMA 9XIAA 1KPHA 2R6ZA 3LBYA 4HGYA 4PCLA 2XISA 4QVKA 5JUWA 2F8LA 1RI1A 3FPEA 4GF5A 4A6EA 1R8YA 4HH4A 1BXBA 3PB3A 3TKYA 1XIHA 3NW9A 2ZTHA 5HILA 4YUZA 1XCJA 3KR0A 1KYWA 5DTQA 3SR4A 3Q7EA 2ZVJA 4YUVA 3FPJA 3GDHA 5DPMA 2IP2A 2YVLA 3AALA 10MHA 3PX2A 4XIAA 1G55A 2BZGA 4PIPA 3S68A 3KQSA 3PLAE 1XYLA 2G0WA 1ZHFA 1BKYA 3KCLA 3QXBA 1L3BA 1U2ZA 3AJDA 3BGIA 5HZMA 3I58A 1SKMA 1NKVA 5GM1A 5K0CA 4DA4A 3A25A 4EACA 3E7PA 5EZQA 5FTWA 5FWAA 1DIEA 4HGXA 2PGXA 3BZJA 5HFJA 5CVEA 1KXZA 1Z3CA 3CCFA 4PWYA 4K6MA 4ER0A 4YV2A 6XIMA 4YV1A 2IIPA 2XBMA 4YMHA 2YX1A 3KBVA 8MHTA 2YTZA 1I9GA 1XVAA 1X1CA 4XSMA 2CMGA 2Z6QA 1JG4A 1NW3A 3FUWA 1MHTA 5T64A 2GH1A 3FTFA 3E8SA 4E31A 1YFLA 2Y1XA 4ER7A 1XISA 3DXZA 3SMQA 3LDGA 1OR8A 2UYOA 3LKZA 4P7KA 4KW7A 1HMYA 3BKWA 4RTSA 3VNIA 1RI4A 1JG2A 5K0GA 4PYQA 2OY0A 2FYTA 2P41A 4A8RA 3M6WA 5K05A 3IUDA 2O57A 3QV2A 1PJZA 1L1EA 3HA7A 3HCEA 1L9KA 3PFGA 3PS9A 4C08A 3CQIA 3GRZA 2Q02A 1XIDA 3XISA 4K1GA 4RSRA 5FHRA 2P8JA 3U0HA 1XTPA 3T0IA 2C7QA 2HV9A 2PX4A 3LECA 1AQIA 2OKCA 4GEKA 5DTRA 4HGZA 1XLJA 3DTNA 3B89A 3PFHA 4KDCA 4V0RA 2E5WA 2PSSA 3T7SA 3UA3A 3C0QA 3ITXA 1QANA 2XINA 1NW6A 1XCLA 4P58A 1NW5A 1WXWA 2JHPA 3OZRA 4PYLA 4R6WA 3MHTA 5DT2A 3KPVA 1EJ0A 2B78A 2PKWA 3FZGA 4KWCA 1M6YA 2NQHA 3LHDA 1XLMA 2DULA 4IV0A 1JTEA 1ZG3A 3C3PA 5GIPE 1SQGA 4XUCA 5EQJB 5ICEA 1O1HA 2IDKA 4R8SA 3BXOA 5CVVA 2J6VA 2QM3A 4PGHA 3SSNA 3BGVA 3KQYA 5E9WA 1RI2A 4RVFA 1WZNA 5EIWA 2IBTA 5CVJA 1VL5A 2LD4A 5D1NA 3EVCA 3M0LA 2V74B 2I56A 5H6HA 3TC3A 5B1SA 5DX1A 4CTKA 3G2OA 4GOLD 5EEGA 5HEKA 3NWEA 3TKAA 2OXTA 3BDKA 3P9IA 2FPOA 3M0VA 2AN3A 1X19A 4XUDA 4DCMA 3GIWA 2IH5A 2ZWAA 2ZWVA 2OB2A 1OADA 4DUOA 4X60A 1QTWA 3LSTA 5K0BA 1DUSA 4EMSA 4QQKA 2FK7A 3DMGA 3I64A 3UJ8A 1L3IA 3KQPA 2AS0A 9XIMA 3AWIA 3LMZA 1HNNA 2HWKA 3GNLA 3UA4A 5C9ZA 4LNCA 4LG1A 1X1DA 1I6NA 1X1BA 2X7VA 3OCJA 4MIKA 3NDIA 5EZSA 5EG5A 1TW2A 4OA5A 5KQRA 3B3GA 4LECA 5U4XA 3ITTA 3A26A 1A0EA 4RVGA 3M0MA 2VDWA 2G72A 4BY9E 1TPYA 2YXEA 3A7DA 3ELYA 3HP7A 2HTEA 5K0NA 3P14A 5J8LA 2OYRA 2BH2A 4P7FA 3P8ZA 4C03A 4KDRA 4YMGA 3FUVA 2PX2A 5KYGA 4DKJA 2GLKA 4RYLA 3GU3A 4W4QA 4M38A 3B3JA 3GXOA 3MCTA 1NV8A 4YTSA 1YZ3A 2EJUA 1QT1A 3ELWA 2G8NA 3ID6C 2HNKA 3JWJA 4FS8A 3DULA 3Q87B 3A27A 3UJCA 3I53A 2PVCA 4DM3A 2PJDA 3TOSA 3P6LA 2OBFA 3CWHA 2AN5A 4PINA 5KVAA 2C7RA 3DXXA 3DR5A 4HSGA 5FWDA 2ZZMA 2ZCJA 4LWOA 3XIMA 5XIMA 1R6AA 2UYCA 5CCBA 3ITVA 1XINA 3VNJA 5DRTA 3GGDA 1F38A 3ME5A 4AZSA 5HIIA 4RTQA 1AV6A 3EVGA 3AAMA 1X1AA 3M6VA 4RV9A 5E1DA 3OFKA 4C07A 5EMJA 3N4AA 3ANXA 4FSDA 2YXDA 3MCZA 3FRIA 4KW2A 5EMMA 3KWSA 4HHMA 2NNWB 3ER8A 3C0SA 3NVKI 3IV6A 1G38A 2EX4A 2FCAA 1S5NA 2GYIA 4US6A 3KQQA 4YTQA 1KIAA 3T7RA 2IBSA 3HVIA 4R6XA 5DM1A 5FHQA 3HM2A 4ZB2A 3G2PA 5BW4A 2V7EA 3DMHA 1XLBA 2FHPA 4QDPA 1XDZA 2PT9A 4ZTBA 1YF3A 5GP1A 4E3VA 1R00A 2VP3A 2OO3A 5DLYA 5K0JA 3M6UA 3DH0A 3H2BA 3IHTA 4PONA 4C04A 3TLJA 4OBXA 1M0EA 4GJJA 2ZBRA 2QRVA 4PYNA 5D1HA 5DSXA 2B2CA 4XSLA 2OU4A 2NYUA 3VYLA 5P8WA 1NBHA 2WA1A 4KVZA 4PYOA 5GOZA 1YFJA 2KW5A 1XLEA 1NW8A 2VS1A 5T67A 4DCGA 4YV0A 3CQHA 4GOOD 5MHTA 3HCCA 4FT4A 5CCXA 3NDJA 2ZIFA 1JSXA 3TR6A 5E8RA 4DF3A 1XYBA 2I62A 2ERCA 4Y2HA 3FTCA 3KCOA 4AZTA 5K0FA 4OX9Y 5B7ZA 3C0LA 5FA5A 1O9HA 3FYDA 5XINA 1VP3A 1YB2A 4HTFB 4MHTA 3G2MA 4LWPA 3FUXA 4ZBCA 1VPTA 4ER5A 3UJDA 2NQJA 4H0NA 1G8SA 1XIEA 1L3CA 3GRYA 3MERA 4RTLA 4B17A 4HC4A 5B80A 2GLUA 5CIYA 2AZTA 3SSOA 1AF7A 1O54A 4V0QA 3HA3A 4XISA 1FJXA 2XYVA 3HCAA 4HNOA 3M33A 4Q7IA 2H11A 3KQMA 1CLKA 1XLDA 2NXNA 2BR4A 4G56A 3JWGA 3KBSA 4PGLA 1SQFA 5LQCA 4GUAA 3BT7A 1FBNA 2CKDA 3FPGA 4RVDA 1AQJA 4CXMA 2ZIGA 3I9FA 4RTMA 1XDUA 1EIZA 3KQOA 3NWBA 4QEEA 6XIAA 3DBNA 1RJGA 1YUBA 3M4XA 3TQSA 4PFHA 1GW9A 1R8XA 3SGLA 3G5TA 1ZQ9A 3FTEA 2AOXA 3LBFA 4RX1A 3LCCA 5K03A 2ZVRA 2VZ9A 1ORHA 4U7PB 4P7JA 2QYOA 4GOND 1P1BA 3MQ2A 4ISCA 3UWPA 2N47A 2ZIEA 1XIJA 2PWYA 3LGAA 1S5MA 3KCJA 3FYCA 4M37A 3R0QA 3BWYA 4RVHA 1N7IA 3CJRA 4ZB0A 1MJFA 4CWAA 2Z6UA 2AOTA 2QY6A 4X41A 1DE6A 1B42A 4U7TB 3LKDA 4YTRA 3GRUA 4PYKA 5EPEA 5HOQA 2XVAA 1XLKA 5IH3A 2GVEA 1FP2A 3B7PA 3BZBA 3CVOA 3FVMA 3QYSA 3BWCA 4QTTB 3M70A 1JQDA 2QULA 1MUWA 3HA5A 4Z2YA 5GINE 4QEHA 4AZWA 1IM8A 1RJFA 3R9XB 2QE6A 3OBEA 1EJ6A 2BM9A 4FSXA 5ICGA 1A0CA 3LCVB 2FK8A 3EMDA 4QE4A 2P7HA 3OZTA 4HHLA 4QDJA 2XIMA 1XYMA 2B25A 2YUIA 5XIAA 1NBIA 1I4WA 2EFJA 4BLVA 3UJBA 2Z6AA 3VSEA 2GUBA 1N2XA 4OBWA 5FQNA 2Y1WA 4R8RA 2O06A 3D2LA 2H1RA 3K0BA 3KPYA 3KQWA 5K01A 3FPHA 4J4KA 2IH4A 2NXEA 2XYQA 4CKCA 3G2QA 3SX0A 3M0XA 4X1OA 3BZGA 3FUUA 2HK0A 1UWVA 4KIFA 3OE5A 3EVZA 3HCDA 3TFWA 2WA2A 4OQDA 5FQOA 1XYAA 4RTRA 2ZZNA 1KR5A 4FR0A 3UJAA 1RI3A 4IV8A 5DM0A 2HR1A 4OVXA 3CQJA 1BC5A 4K3ZA 1KYZA 1WS6A 2O05A 3P97A 4QDWA 1NT2A 1H1DA 3UZUA 4YUYA 2AOUA 3DLCA 3KR1A 3O31A 2IFTA 4RTPA 5HIKA 2G70A 4GC9A 4QVGA 4RWZA 4CTJA 4EQZA 1M6EX 5LQKA 3EVFA 3P2KA 1TZ9A 4DMGA 3CNYA 4DVOA 4A8LA 1R74A 4PGGA 1Y8CA 4ER6A 3EEOA 2NP7A 3F4KA 3P9NA 1UFKA 3C3YA 3BWBA 3VC2A 4X63A 1XLLA 1Q0SA 2ADMA 3KQVA 2QUNA 2BM8A 2OZVA 2PLWA 4WXHA 5E9QA 3GJYA 2QRVB 3G88A 3K6RA 2X7WA 5GWXA 2JHAA 2WK1A 2AOVA 5HIJA 4PCAA 2H00A 1MNZA 1V39A 3TMAA 3SM3A 3EMBA 2EJTA 4NECA 1SUSA 4P7GA 1XLCA 4E2YA 4EAYA 1JG3A 1DXIA 3OZSA 5F2OA 3VC1A 3PVCA 3OU6A 2CWWA 1JQEA 2ESRA 5DWQA 5H1WA 3ELDA 3FPFA 3GCZA 2P7IA 1VIDA 5E2AA 5FA8A 3EVDA 3ITLA 1RJEA 4AX8A 3KPJA 3LL7A 4EKIA 5LQJA 5CD1A 4DQ0A 4R05A 5E9JA 1RI5A 3CBGA 2YQZA 2ZFUA 3CJQA 3IUHA 4HTFA 3CGGA 1XIIA 3LDFA 3KU1A 5LQNA 4C05A 3ITYA 5DX0A 2HMYB 3KR2A 3RIEA 3G8BA 4F86A 5K09A 3L8DA 3V97A 1XIFA 3NJRA 3JU2A 3QZAA 4PYIA 3UU0A 5E1MA 5DRYA 2IDJA 1A0DA 3KKZA 5AVNA 4MQ4A 2PWPA 3DP7A 5CUQA 4RTNA 2UYHA 3A7EA 1ZKDA 3BANA 3NMUF 2G71A 3EVAA 5EKXA 3RW9A 4E70A 1WY7A 4EKGA 3B3FA 3OPNA 3DMFA 3KBNA 3U3HA 3THSA 2K4MA 1NW7A 3HVKA 3WSTA 3ITOA 2PXCA 3O4FA 4FT2A 5E2BA 3ERCA 1EG2A 1QAQA 1SUIA 3P71T 4JXJA 5LQRA 5FULA 1P39A 1VLMA 1YZHA 1IY9A 4RTKA 3KBJA 1XIGA 4C4AA 5AVHA 4A8NA 1WG8A 2JHCA 5TNVA 4YTUA 8XIAA 1O9GA 1UIRA 3DXYA 3G7UA 2O07A 3LPMA 5K0LA 5LQUA 5I7GA 7MHTA 4PYJA 5DXAA 3EGEA 3V8VA 1DL5A 1JTFA 4F85A 2UZ4A 4DZRA 1ORIA 1QAOA 3QOXA 5EOVA 1XDSA 3IYLW 5F2KA 1KPGA 3ER9A 2C7PA 5DSTA 2PX5A 3G8AA 4HRAA 3LDUA 1P91A 3EGVA 5EEHA 1KPIA 3DUWA 1RJDA 3UBTA 5E8JA 4A8IA 1D2HA 3JWHA 3MTIA 3P9KA 3KPUA 4PIMA 1FPQA 4RTOA 3E05A 1VQ1A 1NE2A 3CJTA 5EGSA 4XKMA 2XVMA 3MAGA 4CKEA 3GRVA 4GJIA 2NQ9A 1G8AA 3AYVA 3THRA 3U81A 4ATNA 5BP7A 5GIOE 3MGGA 5K0EA 3CQKA 3NVMB 3C6MA 3KHKA 1JSZA 3GNXA 4EVIA 2GAFA 5E1OA 2G1PA 4GOMD 5F2NA 1K77A 2ZW9A 2P3LA 5T6BA 3UFBA 4O29A 1YX1A 3BWWA 3VNKA 3MTEA 3KPWA 2PX8A 3PX3A 4E2XA 1XLHA 3O7WA 5BW5A 3P2EA 3UVAA 4PYMA 3KTCA 3EGIA 3SVZA 2P35A 5C1IA 5E1BA 5ICCA 5IKMA 2HCVA 4OQEA 3GO4A 1BOOA 3B5IA 3BWMA 1XYCA 3OFJA 1ZGAA 1G60A 2JH9A 2PV0A 4HG2A 1DIDA 1PRYA 3VNMA 5JR3A 3XINA 3PT9A 4C06A 3HNRA 4M36A 4QPNA 5EHGA 4E32A 2CL5A 1BXCA 4BP1A 2EG5A 2OPBA 3GWZA 3OU7A 3DLIA 2G4JA 3MB5A 1SVUA 2ZULA 5EHIA 2CMHA 3HTXA 1VE3A 1D2GA 1VP9A 3WQOA 2R3SA 3ORHA 2JJQA 3R3HA 3FRHA 3QOWA 5H02A 4AUKA 4F84A 3KBMA 4YUXA 3M0YA 7XIMA 5M5BA 5GM2A 4FZVA 3R24A
chains in the Genus database with same CATH superfamily
2OEPA 3A1TA 4EHFA 3VYWA 4GM0A 2C5SA 2ZYTX 2PL9A 5B7YA 3NTRA 1S3FA 1N8SA 2FZ4A 3ADBA 4DGQA 4DTCA 3RSGA 1B3YA 3GFOA 4QO7A 4GLJA 5FUWA 2GPWA 3RSCA 4LFBB 1RRKA 3L68A 5IHRA 1E6QM 3N7AA 3INYA 4GMFA 1XB2A 3BW4A 3OE4A 3E2VA 5FKYA 5EJ4A 2XCIA 3LY0A 3QV9A 1KRHA 4EHLA 4D4KA 6ENLA 5LQAA 3GG2A 2FZNA 2AZ4A 2EBHX 1NOIA 3EDFA 2P3SA 3ICPA 1V3QE 1I60A 4US2R 3I01A 3TRFA 2X1TA 1C4OA 5JDCC 4Q4JA 3G8DA 5FUVA 2WWXA 4DWJA 4GL2A 4N4QA 1KS9A 4D99A 3OD5A 4TTIA 4J0DA 5AKYA 1FRQA 3ZFHA 3RTBA 3BIJA 5C5EA 2XISA 1EJUC 4HH4A 5BSRA 2C9MA 1FP7A 3TIVA 2VCEA 3QXXA 1M3SA 3U31A 4L7QA 2QROA 1V6AA 2CYBA 7PTDA 2J87A 3CUUA 5E1QA 4YEDA 3W7EA 2GBCA 1Z37A 3B6JA 5AKJA 3BRWA 3HXLA 1KTIA 2R87A 4I1SA 2OKGA 4MWBA 1B8VA 4EFDA 1Z34A 3WGLA 4GUFA 2BASA 1RSCA 1PR5A 1X0XA 1OV6A 1PU2A 3C3PA 2QV5A 3B3AA 5DYYA 1YQ9A 1FHUA 1O9BA 3WYCA 1A8PA 3BCFA 4U7DA 2IH5A 5AOAA 1M7JA 3SEQA 1OADA 2EATA 2GRAA 2OBMA 2EDAA 2UY2A 3SDSA 3AXXA 2VZLA 3L0GA 3R44A 4DJAA 3VPAA 1LPPA 1X1DA 1TYDE 4H3KB 3BJSA 8RUCA 2BZSA 3EA0A 2E1WA 2QCCA 4KDRA 3IJ6A 1K7XB 4R53A 2E5BA 5TQ0B 2IXDA 4JYMA 2RGRA 1QT1A 2Q5IA 2X3FA 3JWJA 2HMUA 4GKJB 3BE8A 5KVQA 3IGHX 2EKCA 1I7QB 4AZSA 3ZKAA 3AIBA 2XGGA 5AYIA 2ZTSA 1GG8A 1C7ZA 2PMDA 3CV6A 4R1SA 1N4AA 2VTFA 3LV5A 4Q7LA 4RADA 3DD1A 4B79A 3UKDA 3D4IA 4P3XA 3T9CA 1JGTA 2VUYA 5TVKA 4G9GA 5B7ZA 5DX7A 2A9JA 4B2DD 1V3VA 5HUQA 3QF4B 3KYCB 4GZMA 4G1NA 1G8SA 4FMDF 5KSPA 1RWBA 3RC9A 2FG6C 5IBXA 1KI3A 2YY7A 5JXQA 4IIHA 3GLHB 3NOVA 5BXRA 3A4VA 4UAVA 2WQZA 1AUSL 2AAMA 1OWOA 2X1SA 1F7UA 2ETXA 2HIGA 4ALJA 2JC3A 3IWPA 2A85A 2M6KA 2OKOA 1UOKA 3A6KA 4YC7A 1GSHA 1XR2A 3LZ6A 4QJ4A 5CB0A 3QYSA 4QJ5B 4KBFA 4ZAYA 4OAQA 3PE6A 1TYEB 3IE1A 3IJLA 1TMLA 3H13A 3VSDA 3WKZA 4RA6A 4OGWA 2GN8A 4TLCA 2X5JO 5I07A 3UJAA 3SFKA 3E9ZA 5EXXA 3PPYA 5I5RA 2ZI6A 1N5LA 5FV4A 3RAPR 2ZXFA 1JCTA 4N0EA 4B7CA 3ZLBA 4H83A 1B3ZA 4LUSB 2P0YA 1TG7A 1DFIA 2XVYA 4YCDA 3SM3A 1YR2A 4K9OA 1XVLA 1THGA 2HRQA 4AD4A 4AX8A 4NX5A 1SIUA 1RWNA 1NZFA 1J25A 2DW7A 2P1ZA 5J4KA 2UZAA 2FMOA 4G1EB 4GW3A 3VR3A 3DP7A 5HPYB 4YRIA 3HRKA 4NCAA 4NZ5A 3DBOB 1JCXA 4O8CA 3W6ZA 1X39A 3MMWA 1W0MA 1JHVA 5CHEA 1QTNA 1O95C 2RSLA 1JAEA 3VOBA 2EJBA 1P5RA 1MTZA 1FPQA 5KTTA 2W2XA 1TR1A 4BNXA 4II3A 1WXEA 3HBLA 3M49A 3ZHZA 3FTQA 3FBGA 5JO9A 3TD9A 5TD4A 4NS1A 2J7FA 1F74A 3VFCA 1B2YA 1S5PA 2VJOA 4FZJA 1OIXA 1WZIA 4NCHA 3XINA 4QXIA 1NG9A 3TNLA 3ADPA 3VNZA 5DZSA 1RQPA 1FMFA 4ZC1A 4IKEA 2XUPA 3SXJA 4U2BA 3ZNOA 4LBWA 1L6WA 5D3QA 3B78A 1C1DA 1SCDA 3FMGA 2GS9A 1O94C 5JS6A 2OOKA 3T0BA 4MB1A 1VGAA 3SUTA 1PZ2A 4HDMB 4IGHA 2PDCA 3BFJA 2RGAA 4OUDB 4JSTA 1XJ5A 1K9SA 1Z3IX 3NBFA 3WLEA 2EKPA 4DJDC 4PXSA 2NM0A 4Y1RB 3LQRA 2QM7A 4E2FA 2WCAA 4Y6PA 3X0DA 4HMCA 2YIVX 2ECKA 4AZCB 1T2AA 3C14C 3W3AA 3NG1A 2J08A 5HJ5A 4Q4AA 5A4MS 3ORQA 4GZJA 1S0UA 5JVDB 1V4BA 2D23A 1XL1A 3U49A 4XB3A 3GAYA 5HMEA 5C0OE 1PD1A 4S3FA 4POAA 1KDZA 3IEUA 3RUDA 1TM5E 5BUSA 3LT5A 4X8LA 4Q4KA 2IIBA 4HLQB 3TIMA 1GUZA 1DIOB 1NSFA 2FPSA 3RCYA 3NHAA 3YPIA 2OP0A 1E1QD 1W87A 2QJWA 5BSWA 1E1CA 4L8GA 3GY1A 3BE7A 1V1RB 3PEUA 1HXHA 3H5AA 3C74A 1T2CA 3KBVA 1T8YA 2YLAA 2Z6QA 3PDJA 5DSZA 5LP1A 5JU6A 2QRJA 3HO6A 1DBWA 3HGSA 1IY2A 1KMMA 1SJAA 3KAQA 2YBEA 1M54A 1IG0A 5LNK1 2YQ4A 5M5DA 5AKHA 1J24A 1LI4A 1O1YA 3WNLA 5DNCA 3VC7A 2Y70A 3K9QO 3CF2A 3S9ZA 1JCNA 3LC0A 3MS4A 3L2LA 3FJ1A 2V74B 4XD4A 5B7PA 4TV5A 1KFBA 3P9IA 3GRAA 2QZZA 4AVNA 3U2CA 3A22A 1D3AA 3PNSA 3T3HA 2PUEA 3SC4A 5EG5A 4JS3A 4GVIA 3CBQA 3JVVA 3IILA 1RW4A 2BH2A 5DCUA 1V8EA 4URIA 3MW8A 5B1IA 4P0PB 5EYPB 5C1PA 5FPTA 2OBFA 1DWGM 3W85A 5M29A 1A8HA 2YDRA 2PI6A 1G17A 3RYFA 3OESA 3OZOA 5EMMA 1S5NA 4F4FA 4RJLA 3EWDA 2ATCA 5FHQA 3F98A 4MAVA 4TS1A 3LS2A 4ZZ3A 3CMGA 2OSBA 3HU1A 1DTWB 2QMZA 1TUXA 4OK3A 3CUGA 2GQ0A 5XINA 2H5LA 2FOXA 4J3VA 2AUTA 4RGYA 4YCAA 4R1TA 2O59A 3VO2A 3ORRA 1YBQA 2VP8A 3FFSA 3I9V1 1PKEA 4CIXA 2ZSFA 1LCIA 1ISVA 1X70A 4AZ3B 3FTEA 1H61A 3N28A 4IUYA 1CXFA 1XPYA 1UBJS 3TBKA 5JO0A 2YW9A 3M46A 1XIJA 2QGYA 2E89A 2ORYA 5G5IA 4RVHA 3VOCA 5AUNB 4NABA 1WMAA 4ETMA 2C9CA 5HXAA 1IT7A 1ZNNA 4CEIB 1CULC 3JATA 4C4XA 2PKRA 1V3UA 2NTEA 3D0KA 1K63A 4DADA 1VZWA 4D0GA 3VSEA 3S1VA 2NSHA 2INZA 1EEHA 2O14A 1F3EA 3GVGA 2P4EA 3VZXA 4BMDA 1G21E 3C6XA 2P68A 2GFIA 3B7WA 3V0SA 4LRUA 2E8ZA 3MINA 1QFXA 4EAQA 3IELA 1T13A 2WG2A 4HEQA 3OD1A 3U16A 1HDCA 4CLDA 3KHSA 1VFUA 3WZ0E 4EL5A 2B6HA 3CZCA 4MQFB 2DEUA 2UUAB 3UT5B 4OQXA 4WQ6A 4HXEB 1S2TA 4NECA 2ZYHA 2JIOA 3L4JA 4BJHA 3L65A 2GVJA 4QGHA 1PFWA 1YT5A 4G81A 1HKUA 1ZGDA 1X77A 1GQRA 3LJKA 3PJEA 4M1MA 1DQWA 3SNHA 2ZITA 2H57A 3PQ4A 2LIVA 3REFA 4Q01A 3KSBC 4TUYA 1MLDA 3UVEA 4MJ2A 2D69A 1IUOA 2AL2A 5DV9A 1UKAA 3ER9A 4HRAA 2VJXA 3LDUA 1M1YE 2XVMA 2CEKA 1VLIA 4MGKR 1COWA 2V5VA 3QF0A 2ONJA 3Q7IA 3C5EA 1H6CA 4Q8OA 3DFOA 4XVRA 4JI4B 3UPUA 3FA4A 1KHTA 2WWRA 3W84A 2WQ7A 4BP1A 1YU9A 1OABA 4GMDA 1GKQA 1B73A 2ZRAA 3VIFA 2HA7A 5FKJA 4DV6B 1BW9A 2IPLA 3HJBA 4WV3A 2FWIA 4TROA 5HFAA 1M74A 1YBFA 3G89A 1XQ1A 2HK7A 3QRHA 5EMLA 5I3IA 1JWBB 4FNOA 5HRAA 1GUDA 4GYKA 4QYMA 4GWGA 2ZICA 4NHOA 2CDCA 1ZL1A 1NOKA 4UKDA 3SCPA 2XKAA 2CXTA 3BAJA 4QXMA 2ZZ2A 3LIIA 2NP6A 5HWNA 1N1DA 1Q4NX 3JQEA 2CDBA 3IUIA 4X3ZA 3FSRA 3RDPA 1Z8AA 1ZS2A 4QXOA 4P4TA 1XP3A 1MABB 3CQ9A 5JMWA 1Z9AA 2DY3A 3DGRA 3NETA 4EATA 3VC5A 4G67A 4KE8A 3N75A 4HCJA 4PMVA 4GQRA 4LSMA 4MKZA 1ESZA 2OOFA 4WAUA 3C8NA 5DB4A 3C3CA 2W61A 1EUAA 5CGTA 1E2UA 3E82A 3HL0A 2DXIA 3DDZX 2CKSA 3EARA 4LE2A 4S2CA 1QH1B 3V4PB 3F7NA 4RCZA 3AS0A 3M7WA 2A9PA 2BMWA 1CZRA 1SOWA 3MC1A 3L4UA 2YW2A 4GZLA 2Y62A 3R0JA 8MHTA 5A1TA 1JQXA 4EFLA 3USBA 2P76A 1RPJA 4XLZA 1ILEA 3TWBA 4HUJA 1SC9A 4KPUB 1IZCA 1IZZA 1E9SA 3I76A 4E5UA 4HN4A 2OO5C 2HF7A 4J6EA 3IO5A 3S1XA 1DWQA 1AJ0A 4NMHA 4D8XA 2ZQYA 2FFAA 1JZSA 4MP3A 5BRNA 1OH6A 3M7SA 3EGCA 3AUFA 1WCXA 1BA3A 1UCWA 4PSVA 5CVVA 1CBUA 3SCZA 2P6UA 1QNRA 3A28A 3S5JA 1FCUA 1LF1A 2OCLA 2FPOA 4EPRA 3C1OA 4PG7A 4MKNA 1DUSA 4ND6A 2FZ9A 1EWTA 4RXFA 4Y2PA 3QPDA 2QN2A 1CNMA 2QPLA 2ORWA 3QVUA 3GHRA 3RCNA 1GVYA 4ZIRA 2ZUMA 3V1KA 1R16A 3FNIA 1JR3E 3LQFA 3LMYA 2UAGA 1QNLA 2COEA 4PZCA 2IXAA 3T1HB 1X15A 1AT1A 1BEEA 1X1ZA 2WSKA 2AF3C 2JBHA 2VKZG 5IEBA 4O2RA 1OLXB 3CHFA 4R16A 3FCCA 4MDFA 1QVRA 1EXMA 3HUUA 4W9NC 3DMHA 1L4BA 3TDMA 1M0EA 1I4OA 2V7VA 1S3TC 3WP0A 1KR1A 3FOWA 1JNDA 3M4NA 2IW0A 1Z8HA 1GSAA 3J7TA 7REQA 1E1YA 3ZR4A 1MZVA 1II8B 2WJEA 3P9PA 1DDIA 3OZCA 1IZ0A 4FEGA 2I67A 5AR1A 2Q9CA 3TKFA 1KJWA 1T8WA 3AR7A 3FPGA 1U7DA 1IWAA 1D3GA 1G8MA 3B48A 2AK2A 4G0XA 1HX0A 1W93A 2QZSA 5BCAA 3QMRA 1PN3A 3IQHX 4RPCA 2I80A 2QCLA 3URBA 3H11B 4GOAA 2GK6A 3JPWA 3ZZTA 2HDJA 1ES9A 3TIFA 3CH4B 2OPJA 3G5UA 1DXEA 4H8NA 2Z8XA 4IQLA 1L6SA 4FOJA 1EXPA 4ENTA 4NJMB 4IVPA 5AYBA 4HDQB 3ZG6A 3DLCA 1A0OA 4Q4AB 1LV8A 1TCBA 3WFJA 4GO8A 2I2DA 1Q0SA 1OXXK 3N7UA 1JXMA 3FX2A 1E2LA 4E08A 3VV3A 4KLCA 5LHEA 1ECCA 5DHPA 2A7QA 4Y6LA 1QO0D 3ZE7A 3WMLA 1BE8A 4AZIA 2WPDA 2HJVA 4O8RA 3AJ7A 2QVHA 4QFUA 5DX0A 4BJHB 3Q3CA 4ZVSA 3KEGA 1TO6A 3VH2A 3ZZ0A 4CHTA 1A0DA 5FWYB 9ABPA 3HB7A 3W1AA 1R0WA 4IIEA 1GAJA 1W1WA 3HVKA 1XMJA 4YAUA 5DMXA 1P4GA 1U81A 3GGSA 3C8FA 5TY0A 3R6WA 1N55A 2XUJA 1KQ3A 2PAFA 3VKCA 4DYJA 3ZU2A 3N59A 5GGXA 3FHJA 4LVBA 4YFVA 3MAGA 3CHVA 3A4JA 3SUVA 3P82A 1PQPA 4ZQGA 4COKA 1U1HA 3V00A 1EHIA 4V3CA 2VBGA 1D6JA 1ZZEA 3F2CA 4BI7A 1DPGA 1YTLA 2Z3ZA 3F71A 3VHXB 2DFLA 2CL5A 3EDCA 2FZWA 4IX1A 4GVHA 2W5FA 4UHDA 1FSSA 4FXSA 3FETA 1XTQA 1EFKA 3K0EA 2OAGA 1TMOA 5KS2A 3KWJA 1FFGA 3BA1A 4K7VA 2XUFA 3TPZA 4KQ2A 3K8MA 2BISA 4DCSA 1VJIA 1N78A 3DAGA 1P6XA 1CGYA 3VGDA 2YJ4A 4UW9A 4GI3A 1G8YA 5ALSA 1NRIA 1JIJA 2ONYA 1I7SB 3LY7A 1USUA 3MUEA 1DHRA 4H7CA 4NBSA 1GLGA 4NRDA 2J3MA 5K8VA 5K3OA 4DQWA 1NM5A 1GGEA 3NGLA 1NN3A 4EF4A 4WX2A 2BR3A 4CTNA 3L3BA 1P6WA 4C7BA 5ABFA 1QUFA 2IKIA 1Z2EA 4XYGA 4RULA 2B0CA 3CKKA 1C81A 3TOXA 3EXIA 3SU8A 2PS2A 2AOWA 4CKBA 4PBSA 1WPGA 2QEQA 1Q7ZA 5DHQA 3B36A 3QLJA 5EHQA 2DFKB 3HP4A 1V41E 4MV8A 3BD6A 3AMCA 1C80A 2AI3A 2NLOA 5C5IA 5KO2A 2QRHA 4HDCA 2BRUC 3RS3A 1F14A 3NZGA 4AQYB 3QJGA 1H1TA 4U4AA 4QAIA 2IW3A 2CCGA 4IMJB 4ISBA 2Q3FA 3QV6A 1AMYA 4HX9A 2XCUA 5KWIA 1X1CA 3FCEA 4O02B 4IGNA 1CZHA 5CGZA 1XF0A 3COVA 2ILTA 4DSTA 2CCKA 4HSHA 2A0WA 4MKSA 4TUFA 3S2FA 2XITA 2Q02A 1EH5A 1BWPA 3EX6A 5BWMA 1V7ZA 2GD2A 3EPMA 1A2KC 4GT1A 1W5EA 2TS1A 1WZ2A 4BFVA 3C4QA 2A7RA 4J76A 1KTBA 1DCKA 1YBQB 1C4KA 4QAQA 2X0HA 4G7EB 4QSFA 1GXSA 4LHXA 4L9WA 4YJGB 1ZMOA 1HLGA 2VUIB 1PX8A 2Q3MA 4HYWA 1OIWA 2FK7A 4MB6A 2WZIA 1E0VA 3AG5A 4F38A 5F7UA 2JIEA 4H7KA 1EG7A 2OZTA 5GZ1A 2V7PA 3TAUA 1JKFA 1GTL1 3VMNA 4N9WA 3GLFE 3S8HA 3AZSA 4MY9A 4EWLA 5EUMA 3HIJA 2J6CA 4BJ5A 1HWYA 5E4JA 5CJNA 3IV6A 3PNMA 3AGQA 2X42A 3HVIA 3TO5A 1WDKA 3VBEA 5IOBA 1Y7LA 3KTOA 3NC4A 1JW9B 3DH0A 5L9FA 4CMHA 1WXDA 1U7HA 5JMPA 5HMMA 1ZJZA 1EH9A 2X0KA 3PRHA 1Y9JA 5AO9A 3M0IA 2BEJA 3ACDA 5J5RA 1E2NA 4ATDA 4II2A 3WNQA 3H04A 2ZSAA 1ZD8A 4PIVA 3NNSA 3ZQ9A 1UKVY 4ENRA 1X7GA 4KKVA 4B46A 4BAUA 2XYVA 1CRWG 5G1PA 2NXNA 4J4HA 3KBSA 5HJ2A 2FLWA 3IAM6 2O1SA 2SCUB 3IBSA 1RXEA 4P9NA 1SCAA 2QS8A 1JDZA 3KFXA 4BWLA 2E48A 1NR5A 2VHCA 4EUEA 2MJLA 1E6PA 2F62A 1MJFA 1EGVA 2C14A 3E3LA 2ZUWA 4GC3A 2W9XA 3AXMA 5E09A 3QFFA 1RABA 1GVFA 2EXOA 1CIPA 4JGDA 3KVJA 3TN3A 1DB3A 5TPWA 1D09A 1Q6CA 2UZ9A 1J18A 1LDNA 1SC4A 2CXPA 3VU1A 4C6OA 1KE2A 2WHYA 3GI1A 5B7QA 3B8HA 1H1YA 2C20A 5F2EA 2HVOA 4O4HF 1E18A 3TTXA 1KD0A 2M6SA 5IANA 2I9EA 3A6LA 1PTGA 1ITCA 5JCPA 3DG9A 1WQ3A 4Q05A 3F3SA 2R8YA 4WDTA 5KYYB 5DH9A 3WMFA 2MR6A 1EESA 4POOA 4FF5A 1XX6A 4JVNA 1HOTA 1VJ5A 4R05A 2V6GA 1GLVA 4K88A 3TTYA 1ZJ6A 3T78A 2C3OA 1YHTA 1MIOB 5AZ1A 3K09A 2HQSA 4ND2A 1U83A 4MHBA 1QK2A 2EO7A 3ESRA 4IMDA 5AM2A 4DFDA 1Z32X 1W1IE 1OU4A 2KMLA 3WISA 3ITOA 2WW5A 1RQEA 4JNCA 3OQNA 3I3SR 3NC0C 3C6ZA 4L74A 4XX1A 1E3XA 3M47A 2FN4A 1UP2A 2Q4TA 3HWRA 4UQPA 1MXGA 1W29A 2TSYA 1V8PA 3CVUA 5AM3A 2FMKA 4KV9A 5T41A 2WNNA 2QVXX 2FSUA 3AOFA 3CV3A 4RL4A 1HDZA 4LVCA 4BTVA 5A2BA 3QVGA 1UZ1A 5EWJB 4YP0A 5DO9A 5IUJC 3W4IA 3WBXA 1W5TA 5G40A 2RK4A 3DBLB 3ORHA 1YIAA 2YNMD 3OIHA 4F2GA 4PG8A 4EI2A 4MB0A 3DMDA 2O4QA 4AK9A 1P5FA 4IPNB 4XDHA 3OA3A 2C61A 3UJ7A 3G1TA 3D3WA 5KNDD 4M9UA 2G9UA 3VPSA 3VDCA 2PV7A 4G6CA 1DQPA 5HM8A 5A04A 3PX7A 4IDGA 2O8EA 5G0UA 1P0DA 2VYFA 2A1YA 1NP7A 5KIAA 4YJKA 3SZ3A 4UHHA 2XWJI 1R8JA 4Q4LA 2ZLBA 3HFRA 4KRZA 1L4MA 1QI3A 1T4BA 4LEQA 4OXNA 1HL2A 2WHKA 1Q0ZA 1X9IA 2W48A 2WG1A 2WRZA 1LJ8A 2QB5A 5A9RA 1WABA 4E33A 1YNYA 3THAA 5DBUA 1VCVA 3QPVA 2ECFA 4AP9A 3B82A 2NV0A 5GONF 1H49A 1XLGA 3CTLA 4Y9RA 1XJWA 2AF4C 3E3NA 1FVXA 1ORTA 2X1VA 3IV3A 3RVOA 2DZBA 4HWKA 2R97A 2WWHA 4MS1B 3T9EA 1OD8A 4W5HA 5HZMA 5C54A 1H2HA 4GC4A 4TL6A 1OFBA 2JFZA 1PKMA 3BQ9A 5DYWA 1U5HA 3Q7TA 1E3DA 4BY3A 4K05A 5LLTA 4YP1A 2IWRA 4H7JA 4D4MA 1MOQA 4KEMA 3JQAD 3IIMA 1PJZA 1JCYA 4OYRA 2GNOA 3R58A 2BKVA 2W93A 5F78A 3HQ1A 1VBHA 3ZR4B 2CJWA 4HYQA 5ERXA 1O8CA 2CMDA 2WNQA 2I1WA 1WXWA 1B23P 3R7MA 3OQIB 4RFSB 3WV5A 3JARA 4Y0VA 3AR9A 3H4VA 3JZDA 3IUJA 2VFAA 5BV7A 1R6BX 2VGBA 1E9YB 1O87A 5G4EA 1EEPA 4AHQA 2FX3A 4XIFA 2CXNA 4XQEA 2PMWB 1KIMA 4Q8QA 4JS0A 3PT5A 1TVMA 2PH1A 2QJIA 1B57A 1Y5RA 5KQRA 3PR3A 1PFYA 1XNHA 1M1UA 4YMWA 4FXRA 5COAA 2F6RA 2OHFA 4XH9B 2FPLA 3GU3A 2G06A 2QE7A 5IJZA 4MB5A 2CL7X 4DWWA 3LT2A 2GF0A 3KQHA 1Y3HA 5DRTA 2OELA 4FALA 4FFNA 4DJDA 1TV7A 2BS9A 4ERAA 3GK3A 1B93A 4Q21A 4L73A 3KJIA 2G08A 5F9MA 1ADFA 4AKEA 1LSUA 4UFKA 2PYIA 3E74A 4RPHA 1QM5A 4RE0A 1YRWA 2F8QA 3B2NA 2C19A 2EKQA 1M0TA 2NO0A 2W6OA 4UHJA 1FHLA 2UYYA 2ZWPA 2Y8UA 4MZXA 4UU1A 2FW1A 3KCQA 1TQXA 1Q7RA 1YA4A 1N9KA 1R2SA 1IWBA 1RYFA 5CCEA 2WSBA 2V0CA 1YJBA 1CETA 3MRSA 4N4AA 4EUFA 1YW1A 4UCWA 1WVIA 4N65A 4YU1A 1QPGA 3VTRA 1IZJA 3HJZA 1A9XB 2H08A 2VZ9A 5JI3E 4GOND 2SHKA 2PDYA 2JK0A 1QGDA 2ZM6B 3RAJA 4JY8A 5C52B 2ZRYA 1FUKA 3MKCA 1A9RA 2XIOA 3R79A 4ICMA 4C4TA 4CD7A 3CBWA 2A1UA 4FCWA 2BM9A 4FSXA 1TCAA 4OXXA 3VIKA 1SVWA 2PUBA 2QG6A 3N2XA 2Q5EA 2P9CA 1DHPA 3LF2A 5DTEA 1US2A 3LYUA 1H2FA 2OLJA 4PE8A 4JYCA 3KD2A 5LOVA 1CUWA 4RZBA 5LQKA 1N6OA 2W4IA 3AHGA 3B51X 3DD5A 3WRXA 3VDNB 4RF4A 1J49A 3SHOA 5JJLA 3C3YA 3VH1A 4NYIR 4U2GA 3IVCA 1ZJWA 4QUEA 1Z33A 4TV8B 4ATWA 4YVVA 4EAYA 3AFGA 1LUAA 2YJ3A 2Q3HA 3LSBA 3SN6A 1LT7A 2HJPA 4E8CA 2QOEA 3AHZA 3CPGA 3T9PA 2HRBA 3K16A 3W05A 4P8RA 4NAVA 2HXYA 4V2XA 3I0MA 2BBOA 4B1FA 1D9ZA 5LJLA 3DHYA 4WFIA 3F4BA 4A3HA 2JLRA 2HF9A 2FMNA 1Z0JA 2KM1A 3S6OA 3FOEC 3TQCA 1E4EB 4NT0A 3N8HA 4KWEA 1WG8A 3CZ8A 2BVTA 2Z8ZA 1YE5A 5FF0A 5AVRA 4INFA 5HQTA 2W0SA 4JMLA 1GVHA 4O2AA 4CKBB 1EGMB 4QG3A 3NCOA 2HB6A 2KPOA 1R9XA 3GNXA 1S1RA 1VJ1A 4MS4B 2JLBA 1HP4A 4TZTA 3O6CA 4M76B 3R0ZA 2O2GA 3VBCA 1JXAA 4BEJA 1SFSA 3ZD6A 1ZJ5A 5LVAA 2GWRA 1X8XA 4ZV4A 2EKZA 2VT2A 1OX6A 5E95A 1A3CA 2JKZA 1WCGA 2YN2A 3Q65A 1MI3A 3A2KA 2PS9A 5CEWA 2JJ2D 1LEHA 2AIRA 5FFMA 5DXXA 3WKCA 4BEQA 2ISQA 1SJCA 4TXEA 3OO2A 1W76A 3IIPA 3W81A 2VQ3A 2C3PA 1QNVA 5EQJB 2JLWA 4YUWA 2W67A 1XCBA 4G65A 2AKYA 1US3A 5K8TA 1AKWA 2GPTA 1OC7A 5FXMA 3TVDA 3S1AA 2XAAA 3TX9A 3UHFA 1DPFA 3TCEA 1HDIA 5KZ6A 1UWUA 1JJAA 4DL9A 4EECA 2AXPA 3RPMA 4B4DA 4AVOA 4Q4JB 1WCV1 1DXYA 1TA0A 2PXAA 1Y0EA 3BAFA 3KT3A 2FI1A 1U80A 4EZBA 2ZRNA 1XBVA 3FVRA 3SQWA 1GPFA 3MU7A 1HFBA 3MYPA 4JT4A 4FR5A 3TU9A 1ZL0A 4ZJPA 2A5JA 3WQCA 1NMEA 1HUVA 3RSFA 4GF5A 1BXBA 1YXYA 4UAUA 3G2HA 3MYOA 1OGYA 1CZ1A 2ZBFA 3RIXA 4D5EA 4JBIA 3LQQA 3PLAE 3RM8A 1QQ7A 3X1DA 4DCVA 1BD0A 1XA3A 2C8VA 3W8DA 4TVOA 3ZU4A 2OX1A 1I2MA 3U3ZA 1TJ4A 1A49A 4C1NA 5EIBD 4TZ6A 1A3WA 1TZBA 3AI2A 1H11A 3EIXA 4H7HA 1NUSA 4NBLA 1YVRA 3LKZA 3BKWA 4Z4CA 4LS3A 3KBBA 3CPJB 1KI4A 5AJTA 4JLOA 2E3ZA 2CZEA 4B47A 1VE9A 3DFHA 1IVYA 1R9JA 4YROA 4Z6KA 4YT8A 1IJBA 3GLIE 4R9UC 1OFAA 1M2NA 5J4YA 1T6BY 4JN8A 2HH9A 3QF7A 1NF2A 2DDXA 3M6LA 4IMCA 3CV7A 4BRZA 1UIMA 3RSHA 4FFRA 3OB8A 2QN6A 3T55A 2J41A 3K2QA 4O59O 5ULLA 4EI8A 3M5VA 3EXTA 2QP4A 1MPTA 4UTUA 4ZOLA 2JL1A 1J6OA 4MULA 1TPYA 2XVKA 1P44A 1R27A 4CQNA 5HAOA 4MLZA 4B6SA 4LW7A 3IKTA 3EFBA 4BOYA 3C2QA 3VGPA 3ITVA 1KEKA 2ACQA 3GIDA 4UATA 1D3CA 1TZCA 5CSSA 1T15A 3MJMA 3AFHA 5A6KA 4RGQA 3QE0A 2GSDA 1KY4A 1XTSA 4BS9A 5K0JA 4M6WB 4MGYR 1MW0A 5CFLA 2IEAA 1R3TA 4P4SB 2XCOA 2ZB3A 4J1QA 1YFJA 3URQA 4DCGA 5KYXA 1XTJA 4NBTA 4CM1A 5AESA 2MDTA 4AZTA 3CUHA 5T4BA 1P74A 3AFMA 2YCEA 1Z17A 4M21A 2LDBA 2Q5JA 1U2SA 1TEZA 4MM1A 4MSSA 3U1TA 5L6LB 3V5OA 5LU8A 4KWWA 3G0SA 1IRIA 1H2EA 2KYRA 3RTGA 4WMLA 2NVOA 5TPZA 5BXTA 3GIPA 1J0ZA 1DWJM 2VP6A 3F7OA 3HMJG 3C87A 2GPBA 2B82A 2ZIEA 4KWOA 3BWYA 4J0CA 2H8GA 3NALA 5IH3A 4AD3A 3UXYA 4KVFA 4JYPA 2YHAA 3IMGA 1DC6A 1L6GA 3AVPA 1RM3A 4DO5A 4XPIA 4ALLA 1RYNA 1GVSA 4UOQA 5JXIA 5C1DA 4WKOA 2JFUA 4NCXA 3OE5A 4TLBA 1CF9A 3IARA 1NXWA 5IFPA 1FXWA 4EMUA 3GARA 3OE1A 4AN4A 2JZCA 2UVPB 2WKRA 5AC6A 2RFLA 3EXHB 5C6MA 3PBKA 4DNXA 4X6UA 2TMGA 4UMVA 3W5UA 4K87A 3RM9A 3AVVA 1O68A 1PK9A 1FX6A 3PVCA 3N8KA 1PHWA 1Y7HA 5AJWA 1J90A 3I6BA 1MH9A 4N3CA 2QTZA 2VM8A 5DNWA 4Z2KA 3RYCB 3SBXA 1T5OA 1WZAA 2OLHA 1N0UA 1NXXA 3QENA 2FZVA 3GNQA 4FYPA 3WL8A 1SUIA 1BMDA 1M04A 3DUGA 1UP4A 2IITA 4KUGA 3GVQA 4YJ2A 1JDNA 5IP5A 5HA5A 4S1NA 4AXNA 1EF2A 5DSTA 4GPBA 1HFEL 3P2MA 4YBZA 2DLCX 4HTYA 2CZVA 1FCJA 3HGMA 2PZGA 4HATA 1U3GA 2CJWB 3U3JA 5CB8A 5K0EA 3HI6A 2HMAA 1TZ2A 5BR1A 2DR3A 3AYXB 3P0WA 5H9WA 5EJEA 1PRYA 3W01A 1KY3A 1UXGA 1GT8A 1T36A 3FNQA 4QYIB 1WUFA 2ILVA 2ZULA 4YMZA 2WWWA 3HLTA 1NM9A 3VMMA 1XCXA 4FK8A 1KOFA 4RIFA 3HKEA 1AK9A 1Z39A 3S70A 1NP0A 1HDXA 1GSOA 4PE5B 2JEPA 5IDIA 3K9HA 4J43A 5ELXA 3DPUA 4WX2B 2D74A 1QP4A 2IV7A 4RK8A 5CRIA 2AR0A 3QELA 2E28A 3FMFA 3RUPA 2FHBA 5CPTA 1WXGA 4QUDA 1JZ8A 1F3TA 1VYUA 4JQCA 5EGNA 1U2QA 2WU4A 2OT3B 3BXZA 2IQIA 1CCWA 4DDHA 2VGGA 2ZA2A 3ROMA 1LOLA 1EGZA 5CFPA 4W93A 1C7IA 2LPMA 5IBCA 1D8WA 1AHHA 1RWVA 5AN7A 2WJDA 3FOBA 3EZ2A 3KHUA 4B7XA 3BL6A 5GMOA 5L3SA 3CPRA 3HGOA 1BLIA 3CZ4A 3D8TA 4FGZA 4IDEA 2B4GA 1PSDA 2GWGA 3L6CA 4QSHA 2P9QA 3WA6A 2FB9A 3KCLA 1GQJA 2FW8A 4NAHA 4ESHA 1HLFA 3E35A 4IZHA 5E7QA 3L84A 2ZP1A 4TTUA 3RHFA 2KI5A 3ARWA 2PRLA 4YLWA 4KW7A 4U2FA 3QMPA 4ARUA 1M6JA 2R1TA 1KBKA 3QNUA 3IIZA 5LZ2A 1J4AA 1T0HB 3L1IA 5EUBA 1PHQA 3FCYA 2O0JA 4DJED 5HWJA 5IKEA 2ALJA 4U31A 3COZA 3GAZA 1RLOA 1QDLB 2HWYA 1OB0A 2PR2A 4NCKA 3PWZA 4LAOA 3X3HA 3I5AA 1SKUA 2JJ1A 2IEIA 5C18A 5D2XA 3T7VA 3M5DA 4IG2B 1JEJA 1DV7A 1W2PA 3RUIA 4H6RA 4HJFA 3HB4X 4L57A 5AW9A 3LN3A 1TUBB 4BEUA 3E2PA 1VP5A 2EG8A 1FSFA 1J0BA 4TT3A 5T6MA 2WJIA 2WQ6A 4MKVA 1M2VA 2Q07A 4W5WA 3A27A 5EIOA 2QTGA 3G1RA 3ZQKA 2JE8A 4ZN6A 4XZWA 4FMPA 2G3IA 4WI1A 1D4AA 3OOYA 4EPXA 2WKPA 1Q11A 2BI8A 3KCNA 3T2PA 1FBTA 3CONA 1E0KA 3MCZA 1MXHA 4HHMA 4LF4B 4LXIA 3DBRA 5CK4A 1QK3A 2QZ4A 5DLEA 2CXHA 1JHMA 2R79A 4QDPA 2B5VA 3H2BA 3ZT5A 3H87A 5JNSA 2GJNA 1POXA 3ZJTA 1GCAA 4BHYA 1CK4A 4GQ0A 4ZCTA 1C9EA 3NDJA 1D0SA 1JSXA 3ESCA 1G3RA 3W1XA 3C8DA 2V3CC 1YR3A 5I9MA 2YUTA 2P5YA 1QKKA 3X1XA 4UEOA 2JH3A 4M1KA 2G3FA 3U7FB 2PBLA 1L8NA 3QHNA 3U4CA 2R9VA 1TPUA 1VJSA 3MBDA 1FTSA 3I6EA 3C3AA 3EXHC 1NYLA 2F9LA 1PJ4A 1LRKA 2PSEA 1TUGA 3GDGA 4ZU6X 2CVFA 1NP6A 1H5NA 1RQGA 4JYZA 2QCFA 4DYHA 3AKDA 2QMQA 1NVGA 4CIAA 1PS9A 1I4WA 4P7OA 2MYTA 3TH5A 1BWLA 1FNBA 4A22A 3LHSA 4M0EA 5HKAA 3SAJA 3ECAA 1KO1A 1WWKA 5BVGB 1KR5A 1A7UA 1UC8A 3D1LA 3II6X 5C37A 3GYBA 5F2LA 1JALA 2O2XA 3DZBA 4KLNA 2X2EA 3GJ6A 2GJ4A 4LYEA 1JKIA 1KLYA 4UQOA 3P9NA 5KTMA 4KRYA 3AZRA 3GJYA 3VOAA 4WZHA 1Z15A 4H6KA 1NOUA 4X54A 3NOYA 4QS5A 5EA9A 4BNFA 2PF0A 1FZQA 1TAQA 3NYZA 5FI3A 4YR7A 2D00A 1P3Y1 3PITA 1OKKA 4HS4A 4EELA 4MIOA 1WZMA 1X98A 2BM0A 1LVGA 3K15A 3V8RA 5E4FA 4NK4A 1SXJD 5I7OA 3HZ3A 5J2UB 4FB7A 5KYYA 3GVCA 4RZSA 1MUCA 5JEDA 1XZGA 3OKAA 4EAMA 8XIAA 3TCKA 5K4XA 3LKVA 4WLVA 1CENA 2FZ8A 3I37X 1EUNA 1HZZA 1MOSA 1R10A 4GXTA 3SZUA 1BKSB 2O2JA 1ZBCA 3PPGA 1P80A 4WH0A 1L6IA 3E58A 5CYGA 3E1KA 2NN3C 5FD0A 2Y2UA 4FPXA 4MMWA 1Y4ZA 2Q4DA 2PX8A 4JEIA 1W5AA 3BJFA 2ESCA 2QM8A 2WMYA 4PZPA 2G1AA 1HV8A 3RBXA 3BV4A 4RZQA 3RVBA 1S39A 3UR8A 2ZX8A 4GNJA 4NCNA 3Q5GA 2J8FA 3CFYA 1Z5UA 5AKKA 3TC6A 1HKKA 3AM3A 3ZGVA 1QHEA 3C85A 4S24A 4EHKA 4HJRA 3P5ZA 1EUYA 3HU5A 1U0LA 5LR6A 4FHFA 3THXA 1JEQA 2JA2A 3WX0A 1XYFA 1BF6A 4MR7A 2ZIZA 3ZCUA 4B6RA 4RK1A 2QAFA 1MRAA 3OLIA 1FCQA 1VBFA 2HKIA 3A36A 3ADDA 4IFRA 5D5QA 2P3QA 3G2JA 2DEPA 4LMRA 4LI3X 3DW3X 4G0WA 3AOGA 4J90A 5EJ2A 4MDHA 1OA1A 5CXUA 4AJPA 2ZAIA 2EFYA 1FDSA 1Q3TA 4D4JA 5CZTA 1XZIA 4M60A 4EG3A 2NV2B 5I23A 1FS4A 3WH6A 2BX7A 3TTWA 1U8ZA 2BXZA 1WRBA 1SZJG 2VHVA 2QVNA 1VLJA 3IOEA 1TB4A 4UMFA 4MV3A 2EAWA 2REOA 3FF4A 1IQRA 4E38A 1O0BA 4JP2A 4WWHA 3SW6A 2QCMA 2BKEA 4EJMA 3UWSA 1HORA 2CLLA 2D0HA 1TQHA 2J6IA 4ZQCB 3FPJA 3GDHA 3N8IA 2ZDHA 3TL2A 3WBBA 4P2GA 3MBFA 3AUJA 3DYMA 3QUCA 2H9AB 2WJYA 4HOXA 1XWWA 1KEZA 2OB3A 2E49A 3R7FA 2BT4A 1VE1A 4XSMA 3R2JA 4I4IA 1W56A 5KSWA 2FSGA 3KVRA 2GH1A 1XQLA 1G66A 3O1JC 5CQ1A 4RTSA 1JNYA 1JYFA 4TKLA 3TMYA 4HH0A 4B5NA 1OWLA 2FG5A 4HEJA 1P5BA 2DBQA 3GG7A 4JTRA 5FOUA 4XQ6A 3CUVA 2NWRA 5CC3A 4HEA6 1EX6A 1XWYA 1T2DA 1PIWA 4EGCB 3D46A 3Q3GE 4RZ3A 3TYAA 3EWNA 3P9YA 4KGDA 4B33A 4ZTUB 4FJ0A 1BWVA 1EYZA 1SKQA 4UBKA 3K3PA 4CLRB 2DHQA 2HA6A 3EVCA 4PO9A 2XM2A 4GP9A 2CUNA 2ZWAA 4MEBA 1XSJA 4P32A 1JQLB 4QS6A 1G3MA 1EJBA 3M1YA 1BKDR 1F12A 4YYEA 2IYXA 4OA5A 4NU7A 5IDZA 2O2ZA 2CLKB 3WIJA 1WR8A 2CESA 3ELYA 3WL7A 5KYGA 5A2QA 4RYLA 2BHYA 2DWPA 3VR4A 1FFCA 4JSYA 5FNVA 1AMOA 3PC7A 1I9CA 5A8OA 2AXQA 3RB8A 5KQLA 1X94A 1S2DA 3KAJA 1MJNA 3GCWA 1GONA 1XU7A 4NPHA 3JQPA 3WFAA 4M86A 2F9MA 4ZHSA 1WAMA 4ZVUA 2ISSA 1W9DM 3EWSA 4DNPA 2JLXA 2HJRA 1Y8RB 5LNUA 1Z82A 3GZ4A 5CNMA 5IXSA 5BWNA 5JD5A 3EAFA 4FNSA 4KFSA 2OO6A 1GY8A 1J00A 2ZRCA 2YJ5A 5CC5A 4R1OA 5IMBA 3U1BA 2DLDA 3C0LA 3KHTA 2WM8A 3ZXYA 5BMWA 5E0OA 4KCWA 4H0NA 5LBTA 2X3YA 1WB6A 3H5RA 3TDFA 3A21A 3GMTA 2V54A 3ORFA 5LA0A 1KGDA 2X19A 5LQCA 1AQ6A 3CUZA 3UG4A 2ZX9A 5DGTA 1ATIA 1SG6A 4CMEA 3DBVO 4CJXA 2WFLB 2X5OA 4O4IA 3UMMA 2A67A 4MW5A 1S5MA 2M32A 4C7OB 1JEOA 2CXQA 4GRAA 2ISDA 2OEJA 5HNUA 4JOSA 4BC1A 4YRRA 3VI3B 4DO4A 2J0SA 3USZA 2O7QA 5DY3A 1FUYB 1KDPA 3T5MA 1KF0A 2B25A 2P77A 5I7AA 3N11A 5FOVA 1P4AA 4AIUA 2YV2A 1LK0A 2VYOA 4IV8A 4HCLA 4WXZA 2XWBF 3JR3A 2Q0XA 3PUDA 4FO4A 2CE7A 2MIIA 4QFCA 5DT9A 3I2KA 2C5GA 4KERA 1TPFA 2MMCA 2DHCA 1CEYA 1C93A 4RKRA 1RZRD 4WKAA 4P4LA 1ODJA 3UGJA 2Y7EA 5D30A 4XM2A 2ESRA 2W63A 2YNMC 1LF5A 4HTFA 4RSGA 3G9ZA 4MDEA 4Y9MA 1QKIA 3GTFA 5CPNA 3ICOA 1K6MA 2NTNA 4UBPC 3SHWA 4R5EA 1OBHA 1DEXA 3V16A 1YL6A 1KYVA 4NENB 4JXJA 2RHTA 3IDAA 3DEKA 4PMZA 3BMXA 3INNA 2VEDA 3QEZA 4MYAA 4LZNA 3KEOA 4WK2B 3L0YA 2DH5A 2FZEA 4TT8A 1AX9A 1C3OA 4JT2A 3T4XA 1QRUA 4A3YA 2P3ZA 4JLBA 6ADHA 3UAYA 3FSGA 3IEXA 3O84A 5E1OA 5E7IA 2OCIA 5COQA 1TYZA 2QZRA 4EYSA 4RF5A 2HLNA 5C1IA 3ANUA 3C52A 4PV7A 1OJXA 4IUOA 2GGEA 2BVWA 3OU7A 5AKZA 2P4HX 3WYAA 3HKDB 4RACA 3TR0A 1ZBDA 2Q5CA 3PA8A 2OGZA 4F12A 2IYFA 4MJ4A 1NFPA 3M64A 5FCDA 1ATZA 3I9MA 3ASYA 7GPBA 5A5GA 3DOIA 2X1UA 3BAYA 1SSGA 5EMNA 1KM0A 2BKXA 2PUWA 3PD7A 2W2LD 2C07A 1IXRC 4G86A 4OIMA 1Q63A 2ZG6A 2NUAB 4OQVA 1R6UA 1QORA 4J8PA 2NZWA 1UT5A 2E6DA 3OPYI 4BAGA 4QTUB 2ZBQA 4IW3B 1XD2B 1QZZA 5EIFA 4EI9A 4YXFA 3EAUA 1MRNA 3OQVA 4YX9A 3BBPA 2DVXA 3BHJA 5AKXA 5CX1A 4HYYA 4ZAXA 1Q44A 2Q7XA 4LX4A 3LVFO 5T26A 1PLKA 4II7A 4HBZA 2O5RA 3TTUA 3B8DA 3O1LA 3QBJA 4AZBA 5J2TB 3UB2A 3KYCA 4A6GA 3F46A 4PX9A 1ADGA 1WXXA 1B90A 4XD5A 2QV7A 2ZYUX 2FZKA 1OZGA 1RFLA 1Y3IA 2NVCA 2HPZA 3ZVIA 4XKJA 1PTAA 1DC7A 3O8QA 3ZSSA 1ZRNA 1G55A 1E6RA 1ZY2A 1Y4AE 1BKYA 4R8KA 1U2YA 3W7NA 4M3PA 1BGAA 2VT6A 5DCEA 4LXTA 1Y9ZA 3C1TA 1L7AA 2DGDA 4ER7A 3EF3A 4QXAA 4CIYA 1Z41A 3BSFA 1AKEA 3PNPA 2Q6OA 3IBYA 1L9KA 4AYXA 1GTG1 2QL9A 1U4OA 4M7WA 1BQ3A 4O0MA 4JBYA 4P34A 3ABXA 4P58A 5EVCA 3FF1A 1WHSA 1M6YA 2E67A 4QNRA 4FHZA 2O5VA 4LW8A 3BRCA 4X71A 4UUNA 2EZ9A 3C7KA 2PAJA 1U6IA 3X1ZA 2VUTA 4DUPA 4X60A 3K1DA 3KQPA 3PJFA 3NGMA 2W6JA 1UMBB 4H0CA 1SKAA 3GW3A 4XRGA 2CLFA 4RVGA 2GZHA 3BL8A 3ETNA 2OHXA 2J7DA 4JTTA 4M38A 5JBEA 3TG2A 3NM5A 1EFRA 1XV5A 4WNAA 1VI5A 1F9CA 2CLMB 4OI1A 2YJTD 2D7CA 3WFZA 3SQLA 5A6JA 1HL9A 4JFTA 4O8ZA 5LNK6 4OXQA 1OLSA 3DEYX 4YTQA 1J7KA 5CAEA 1HE8B 2OYMA 3CKYA 1R3SA 1C8LA 2RHHA 4IJRA 4HD5A 5TEWA 5AHFA 3AUAA 3DYOA 1RXSA 1HPLA 3OC6A 1Q0LA 4EGAA 4U33A 1TKAA 2LLEA 2Z7GA 2EGHA 4ARVA 3T0AA 2LWIA 4RJJA 4KS0A 1SWVA 4R54A 4O14A 4LZLA 5MN4A 2OR3A 4LE0A 3TDKA 2OCXA 4E4PA 2PVPA 1OB5A 4X92A 2ZR8A 4KHPB 1OMOA 2BC9A 2NAFA 2CVPA 3U9IA 3CJRA 3MJFA 3PJDA 1CE8B 3I72A 1EKOA 3PIIA 1ZICA 3EOZA 4RPLA 3A4WA 4C14A 3S5OA 3RGTA 4WSJA 1UJ6A 4BQRA 3I0NA 2Z6AA 1E0UA 4Z7NB 5KNBD 3N76A 3AUJB 2J9ZB 4HEHA 3SZMA 2PQMA 3TWOA 3OIGA 3HLKA 2OYLA 4BFYA 2C94A 4JTGA 4JR5A 4PTXA 1JTVA 4YRDA 1QS0A 3HFYA 2W2PA 3WNPA 3MSXA 4QU8A 2WYUA 2NP7A 3U3KA 2YFNA 3UYKA 3C7DB 2O2DA 4PCAA 1HJXA 5JY6A 1D4FA 4RELA 1SUSA 1R0XA 3UMRA 4YCOA 4BLQA 1JDTA 1D07A 1HUQA 1YASA 1PEKE 1XD0A 2WPNA 3Q2IA 1PAUA 1LVUA 4BBPA 3HKCA 1SD2A 2H9AA 1E99A 5B3JA 1S6YA 3K4QA 2ZTKA 1LPAB 4CM9D 5KVVA 3DE6X 4PR0A 2YOCA 4OV4A 2ZJ0A 3LZCA 3W26A 3RJMA 1IK6A 1H3FA 4OO3A 5L7WA 1UMCA 3MELA 5CAKA 3KB6A 2QAJA 1XRLA 3HGJA 3A6ZA 2H18A 1EIWA 1M9NA 2NO9A 4H9GA 1A5KC 1NE2A 3SCRA 4UTWC 4X9XA 2P90A 3D0OA 1BD3A 4D8ZA 4QIHA 1X6UA 3T1VA 5T6BA 1Y8BA 5TT1A 3VZYA 1AM4D 2VF5X 3EODA 1QYWA 2RCYA 5IWAB 4IIGA 5LPNA 4C4SA 1DTUA 4S1TA 5IUNC 3L4KA 3IXMA 4C2UA 1YL5A 2QVBA 5FJUA 1SVUA 2SECE 3ILSA 1IU9A 1DJXA 7XIMA 3TRDA 3FN9A 3I83A 3F0TA 4O3MA 1NOJA 2WTNA 4EBBA 5EXSA 1HZYA 4OB8A 4F5EA 2EQ5A 4YRQA 1DBVO 1CVIA 1YS9A 4B75A 4J0IA 2FLIA 1I51A 1EFZA 2ISFA 3L7IA 3CH9A 2V55B 3GT7A 4NOJA 1CXZA 3ZHRA 4I55F 4YAFA 3FPCA 1P43A 1OVDA 4Z3KA 3KELA 1WD7A 5JSUA 5FL0A 2HK1A 1GQNA 1LNQA 3UBMA 2FWJA 1BS2A 3SSAA 4L61A 4BGDA 4HRYA 1OYOA 4LISA 2B0JA 4IXTA 5BRJA 3G5LA 1KP2A 2B9EA 2HLPA 5H80A 1PDYA 3BERA 1GG1A 2WHQA 1FFQA 1C3JA 2IMRA 2F48A 4JOQA 4H08A 3N39C 4LJ3A 4FYIA 5FP0A 5EJGA 1JDSA 1V02A 4RHYA 2H6EA 2YDXA 3UGQA 4A27A 3DMPA 1P9NA 1M1BA 2H2HA 4NIRA 3K0CC 1TEXA 3A6GA 2GJ9A 4IJWA 5AC4A 2WM0A 3GXIA 2GQ8A 2I6XA 1T9ZA 3BZJA 4JCMA 5CVEA 4ZO6A 1WOMA 5CB4F 4H1UA 2IPAB 3TXZA 2PEVA 2VENA 2PMQA 3K1AA 4ZCIA 2OHGA 2ZTMA 4TTSA 5AKQA 3S4YA 3D6NB 1G4EA 1K66A 1ZAHA 3QTTA 3ZTTA 3U7GA 1Z5ZA 3XISA 4Q39A 3U1VA 2D20A 4XZ9A 1U0TA 4NE9A 5ABTA 5MFZA 4D9IA 5KJ6A 4XDGA 5ICEA 2IHNA 1PJ9A 2W62A 1IF2A 3CS3A 4WLNA 2HOQA 3QEMB 1NTRA 1N0VC 4KR6A 2B4TO 2XGOA 5BQ3A 5KNLA 4F72A 2WU3A 3NPMA 3ROZA 3GBSA 5EQTA 2VI0A 5TE9A 3KB8A 3UANA 4BVKA 9XIMA 1UQYA 1DKNA 121PA 4LHVA 1DAPA 3ZWWA 3KTDA 3UENA 3DB2A 1SO8A 4C43A 3UJFA 3M0MA 3UCXA 2G72A 3ZKWA 4MO2A 2IZ6A 2VTKA 4TQTA 3TLXA 3MCTA 3WB9A 2KJQA 4HGOA 3R89A 2FPMA 1L4YA 3WQWA 3OPMA 4NYMR 1JCLA 4TYQA 4W5QA 4UUBA 3G5AA 3IUMA 1OYVA 1DJYA 3EBVA 3KWSA 3O91A 4D9CA 3ZWDA 1A7AA 4BFUA 3PHHA 4ZV9A 1OIVA 1UUOA 1UF9A 2ZBRA 4L1XA 3KT6A 4JEQA 1LU9A 5BN5A 1YIOA 2DZUA 4AEEA 5AHOA 1YYAA 4JK3A 2IHVA 1O9HA 4AMUA 2A0UA 4QJ4B 3P81A 2X05A 4ZVVA 4G4GA 3ZWAA 4UE3S 5B36A 5KTPA 3ZXXA 3OMWA 4LKOA 1GL3A 4H3DA 1NPYA 1ZU5A 2R1ZA 4XCQA 3SUSA 2PNJA 2GK3A 2AL2B 2ZXDA 2V9ZA 4TN5A 3ZLGA 4HDOB 2XZLA 4YQZA 5HJ7A 3D8RA 4A9AA 2A3NA 2JD2A 4QQ3A 3D0QA 3HWSA 3PEFA 3VHQA 4UASA 4CNTA 4CKCA 3CVYA 3G2QA 3EXEA 2RD2A 3BK7A 4LVFA 1XYAA 1E43A 3PI7A 2OT1A 4YGYA 1GU1A 3RF9A 3O31A 4QXQA 4YCPA 3V2UA 3KZOA 4YIHA 2F7SA 3N0RA 3IVRA 3T7DA 3L7AA 1L5GB 5CFMA 4L9XA 2HJHA 3WHIA 4KC0A 5JS7A 5K6TA 3CLKA 2ABAA 2FXIA 1GPYA 5KDLA 3TECE 2Z04A 5I79A 2ZUTA 5GV7A 4TYWA 3ZLFA 2RJHA 2G4LA 1GR1A 3G2NA 4B6EA 2P6RA 4HHPA 2BFFA 3OA5A 2O9TA 2GLXA 3AB8A 1KH3A 4PAWA 4JJZA 2XVNA 4GS5A 4GDMA 3KUKA 2QS9A 2IDJA 3UKOA 4K9LA 2WYWA 1U7WA 4S3BA 3R11A 2WO5A 3MM4A 2FUG1 4LPCA 2VF7A 1EFDN 4JN7A 4GUDA 3Q8KA 1XD2A 1I10A 3TIIA 1YVEI 2A9RA 3LPMA 3FLAA 2VQDA 1KO8A 4WSHA 1XN4A 1H0HA 3UT0A 5BR4A 4N0MA 4N6GA 1GKPA 3N2TA 1Z7BA 3LD9A 3N1UA 4U39A 3P84A 5H3LA 3L4BA 2CLMA 4HA0A 2WFMA 2PSHA 3DMYA 4BWVA 5KCZA 1I4LD 2VDWB 4DUGA 2P35A 4OQEA 5L3QB 3U7VA 1ZXLA 1EJ7L 4DCCA 3UD6A 1UP0A 1AV7A 4ZQFA 2WWGA 5GJNA 3PK7A 2CBGA 3CWCA 5FAKA 2ZEJA 3IHLA 4GYJA 1LW6E 4JIMA 1QNFA 1CFJA 3AEKA 5JHHB 3H53A 2ZGVA 3L8MA 3PZTA 4QE5A 4OLFA 3SIPA 4DOMA 2F61A 3VU3A 3MB9A 4RSMA 3CH6A 3C15C 4QGSA 1G5TA 2G28A 1A4MA 3JQ7B 4R2XA 3QKIA 5BWBA 2ZM5A 1UBMS 4NI3A 5JARA 3S1AB 3E9RA 3BMOA 3HYLA 3PC3A 4AY8A 3RVDA 5TC4A 3W1MA 2YHSA 1NLMA 3WRWA 4AQDA 2M9MA 4IYRA 1U8YA 5E6SB 3ZU6A 2MINB 1JZ2A 5EMUA 4DZ5A 1GZVA 1V3MA 1UXHA 2WAYA 4QNEA 4D3ZA 3NIDB 4P53A 3GFVA 4D6GA 1UOPA 1RAIA 3GB9A 4EW2A 2ZI9A 4C1KA 1X1SA 1W1A1 1FNDA 1WDPA 1SELA 2YY5A 3R09A 1OT2A 2CF6A 4OYHA 1EWRA 2A6LA 2BB0A 1EBGA 1YBAA 4PG5A 2I2CA 4QGFA 1W73A 1NW9B 5DN6D 2YVLA 2YBVA 4BEVA 4LX0A 1XYLA 4EANA 4PPNA 3MVTA 4HNNA 1OLSB 1DWFM 4PZZA 3CZRA 5ALOA 1E1QA 3EX3A 2P3EA 5IJAA 1U3WA 3PLNA 2OVFA 3UT6A 4Q3NA 4W9TA 1QTQA 3DXZA 4CKYA 3FG9A 2Z2UA 2O57A 1H22A 4JWKA 2GRJA 5FSEC 1CYGA 4GABA 2MHCA 3AW8A 3FFXA 4P7RA 4GI4A 1K6AA 3OQ8A 3WADA 1N8NA 1XCLA 1RA5A 5K0SA 1T0PA 3HJUA 2Q6KA 2WIBA 2GJSA 4P38A 3VKDA 5HUOA 3V5NA 3OG3A 4DRYA 3L6EA 3ETJA 4TU1A 5MKGB 3HN6A 4JFVA 4EYEA 1Y42X 3AB7A 3NDRA 3LGSA 1Y8QB 4ICNA 2AHOA 1WDWB 3I64A 3OF5A 4RW3A 4UMAA 5JUVA 4F60A 1NFFA 3DL2A 1I3KA 3TLBA 1PHRA 2C13A 4DMKA 4FOPA 2XNDA 1E64A 2RAGA 4BQNA 1BX3A 3EZFA 3PXGA 4CLOA 2B36A 1N8KA 5DIZA 4CT5A 2C7RA 1RH9A 4HDMA 4HPWA 3CEJA 2P78A 3B1KA 4YHGA 9CGTA 4H1ZA 3NXLA 3QJ5A 4RFSA 2AYZA 3G2LA 1DJHA 1JAKA 2H85A 1I6WA 2PUGA 2A59A 2BI7A 4MB2A 1PTDA 2PKQO 2R4QA 4TZ0A 3HNOA 2YOHA 2IYOA 3E7WA 1SR9A 5A03A 4XD7A 2QU8A 3D64A 4B35A 3A4LA 1W37A 3W1QA 2WVGA 2YCJA 3FCUB 1CR2A 4ER5A 5EP4A 5EKDA 3UK1A 3N29A 4IH9A 2PGNA 2C95A 4TX9A 1C9DA 2Z09A 1H7OA 3A8TA 4Z42C 3HLYA 1Z5NA 1NFRA 1IRXA 2ZJBA 3E9AA 3S28A 3N9IA 3OQHA 3SECA 3EXIB 3M1AA 1EJRC 2Y71A 1UMCB 1Z8FA 4CWAA 1FU8A 3RO6A 2D2OA 4L95C 2BHZA 5C9UA 1EZWA 1BQGA 2ARKA 3TW6A 3DG7A 4IH3A 5G1NA 2ZR0A 3S8YA 2EPNA 3ZV3A 3KPYA 2Q28A 3B05A 1T4GA 2Y77A 4EJ6A 1JN0A 2VK8A 1EKXA 3T3NA 1PYGA 1R5YA 3W9YA 3RLHA 1R9GA 4OHXA 1NRJB 4GGBA 4CI9A 4M0KA 3IVXA 4X1YB 1OCNA 5B6JA 3H2MA 2QR6A 5H4HA 3RM4A 1UD3A 1J5SA 3CAWA 3FTPA 3CLTC 2QX7A 1K8XB 3AL2A 4HWSA 4NXKA 3Q3HA 4X5OA 1JAXA 1SHUX 3PGLA 4HX2A 5E6RA 4M2LA 3JRNA 3CUJA 4IRXA 1OXVA 4XQCA 4UR8A 5IZCC 4MQFA 4RE3A 1FBAA 3AF2A 1DO0A 1RJWA 2D59A 3NP7A 4B4VA 3OEHA 4OHRA 1NVFA 1G67A 1LB1B 3THWB 2VEFA 3MUIA 1D2HA 2ZIDA 4L76A 4N6FA 1W36B 4YAEA 1Q3KA 3B8WA 3KZCA 3B9EA 3W2MA 1WLYA 5AVQA 2IHBA 3L21A 1A97A 4HEA1 1XVTA 4OP3A 4TKZA 4ZPJA 3GR8A 2O3RA 5LUBA 1QQBA 1WKDA 4B0PA 1U1JA 2J31A 1L6FA 1M8GA 2PDGA 2OG1A 5KYUA 3ZDRA 1YHYA 2A5GA 3PQEA 1XWIA 3C6BA 4JYEA 2ZRDA 1GVOA 1CYDA 2JEZA 5FLEX 1E40A 1E66A 2FQ1A 4FJ2A 3M0YA 4XQ0A 1S9HA 3QP9A 2XVPA 3EJWA 4DBUA 1E3IA 3TYZA 3IUBA 3HXQA 3LQ1A 2CVQA 3PLRA 3EZYA 4KXNA 5CH5A 2CBIA 2CFRA 1QHHA 3A4TA 4NASA 4MWGA 1AMKA 3AYRA 2HE5A 3NWJA 2WVVA 2I9KA 5FUMA 3RU3A 3CYJA 1T29A 2Y0PA 1A96A 1VJZA 1QOPB 3TINA 1XRRA 2Q3EA 2G8ZA 3QPWA 2VDVE 1IULA 5D04C 3ZGZA 2IPOA 4JICA 1C30B 1GR0A 4OUEA 5DTIA 5ALFA 3IAS1 5TMEA 1EO7A 2IKGA 1LPNA 2OFOA 2YVQA 1MQPA 3J7AC 1EX5A 2V3DA 1SU7A 2R6AA 3EGXA 3FPAA 3AVQA 4HXFB 4K36A 3U09A 2F90A 4L8YA 1MVLA 1S2AA 3RFTA 2Z30A 2P65A 5LA6A 4LCQA 2CBJA 4J40A 3AJDA 5C8BB 4JIQA 1V7PC 2PWVA 4JP8A 1FXWF 4KPEC 1O6ZA 1VPQA 5F4WA 3N18A 4FX8A 4ER0A 5I3HA 2PTXA 3EX1A 2ID8A 2WC3A 1VI2A 3FTFA 4Q0MA 2FKPA 2JD1A 4BE7B 4CGZA 2Q4OA 3OVPA 1DWPA 2QIIA 4HDAA 4NK5A 4LUTB 1KBIA 3FVTA 4GCAA 4E6MA 3EX4A 4DO7A 1U5BA 3M6FA 1NW6A 4PQYA 1S89A 3FNRA 3EGXB 2QTLA 1JFSA 4QYWA 4J2MA 5KYTA 5CVJA 1LRJA 2GF2A 4F3RA 4DJJA 2CXOA 4FE4A 5JV5A 5EB8A 1XK6A 3JZUA 4KTVE 4JI8B 3PFWO 4LG1A 2X7VA 1BJKA 1XSKA 1JGIA 4ES4A 2GXQA 2VDWA 3DMRA 3KOFA 2FEKA 4YMGA 3LLUA 5EIHA 4HOYA 2BV3A 5HF5A 3O3RA 2ACSA 3A3WA 1ZBKA 2L18A 2YFKA 1A80A 3Q87B 2EG7A 4HH3C 3QU9A 4PRLA 1PZFA 3TUJC 3MILA 3PXXA 4IGAA 2DKNA 1SBHA 4ZU1X 1FLAA 1QHZA 1XAHA 4P92A 2PBGA 3JV7A 3G17A 2Y4SA 1R00A 4LDJA 1T0IA 3EQ6A 3AUUA 3NFYA 3K5IA 1E5XA 3GW8A 4UC5A 1BOFA 3CZ5A 1DINA 1KCZA 2O8VA 2JIWA 2OESA 1R3DA 4EA7A 3AWNA 4GIRA 4OUIA 3KZNA 4GX1A 4PRZA 2P8SA 3THUA 4KK4A 1RR6A 4Q8WA 1XD8A 4Y7EA 4ZCSA 4MCAA 4WOCA 2V6AA 3BT7A 4C7JA 5T4EA 1ONSA 1QFEA 4DYEA 4H16A 3G5TA 3EMCA 3R12A 1ORHA 1FCVA 4U5QA 1AJZA 3WQ6A 1E4IA 4ISCA 4JY7A 4QE3A 3F9RA 3A06A 2VJMA 3H3XA 3N6XA 3ZO9A 3BLPX 3A4AA 3R9XB 1O5IA 2J67A 3P94A 1A0CA 2FK8A 4AECA 1CNFA 4JDBA 1Z29A 5FNVB 1JEYA 2FPGB 1JX6A 2RHWA 2O8BB 5CZSA 5FQOA 3DCPA 4NBRA 2NIPA 3L1VA 1G1YA 4JR0A 4EG0A 3FSJX 1F2TB 2B94A 5ALKA 4GI6A 1CS0A 4JQ4A 4RVOA 1D8AA 3ONEA 2JFEX 1LBLA 4XGIA 4K9RA 4B6PA 3ACCA 2BM8A 2F3RA 3K70C 2C8KA 4OXKA 4BX3A 5ILOA 5FPSA 2VNSA 3LBAA 2I1QA 3TSOA 4LWWA 4ZL1A 1L5LA 2ICSA 3FPFA 1A1SA 3V1TC 4EYOA 5LQJA 2RE8A 4PCPA 3UWYA 2XUQA 5AYYA 4F9EA 4H00A 5ECYA 3E3HA 5CIWA 4H7DA 1Q6QA 3N5CA 2F17A 1U2GA 5I0DA 1YC5A 2RGMA 3IX7A 1DMRA 2R4TA 1JRCA 4A7PA 3HUTA 4WFKA 2NZLA 4NNCA 3GUCA 2IQ5A 1PJTA 4DV7B 1EWDA 2VHWA 5TNVA 1WPQA 5L3VA 5ECVA 2IPNA 3PNQA 4O4LF 4C7OA 1TVEA 1T9GR 4C6LA 4TPKA 4MJZA 2J0VA 1K2WA 1UZNA 3BWWA 2J9FA 4TWAA 1V0LA 3MAAC 4UDYX 1OQAA 4AWSA 1PG0A 4D6EA 4LOCA 1EPUA 1Q1BA 1WMBA 5KOJA 3LPNA 3KEFA 3I6MA 3F2BA 1X6VA 3UF0A 1BIFA 1T1JA 2JJQA 3ZWOA 1AQFA 4C6SA 4D25A 3PF9A 4F79A 5J3JA 4PFSA 3H9GA 5DBFA 2NACA 2B69A 2CV2A 4ZGGA 1YTEA 3RUEA 3TD2A 4FB5A 1HKIA 4X93A 3QFCA 2RKXA 1ZD3A 2SBTA 2HJWA 1RQNA 3BIXA 4GI5A 2Q8PA 3AY7A 1PFUA 4EA6A 3NONA 3W2TA 1KQPA 4Q12A 3AI1A 1CW2B 5F5NA 3WH7A 3Q9NA 1GGFA 1K92A 3SSMA 2R14A 1D2EA 5KEIA 3G0OA 4TWJA 1NBME 1PFGA 1ST3A 3LY5A 4EK9A 5KYWA 4K5QA 4E7OA 3LCHA 1XQXA 5HRCA 5HF8A 1RAAA 3BKXA 1KM3A 3QYPA 4DBVO 3HCWA 4IHCA 4KUEA 3GCXA 4RNCA 13PKA 2IYWA 1F6WA 3LC1O 1XCPA 3KKLA 4WZAA 4WKNA 4EP8C 1TCCA 3TKYA 3TXXA 2M6RA 1XEWX 3BWEA 2GK7A 4U7GA 4R1QA 4URUR 2WVAA 4RK6A 5FL7A 1W19A 5AP9A 2JGRA 3IXLA 1CW2A 4MZ8A 1F6KA 1W54A 3SMVA 1KXZA 4R0VA 4F46A 3VX3A 1V11A 1YQUA 4YJHB 3T9AA 4GOXA 3L0ZA 1NNI1 4RD1A 3SMQA 3JW8A 4BMOB 2JW5A 3THCA 1U5VA 1J0HA 4RO0A 3PRJA 1J8QA 5IAKA 3LBHA 4K7YA 1EVQA 4E5PA 2FFIA 1RVV1 4V38A 4EUSA 5AVUA 1E4NA 1EXVA 2DZAA 1F73A 2Q3RA 1ENPA 1FRNA 2ZXUA 3VOJA 2GEKA 2CFFA 3RIGA 2XCSB 3EN0A 1H8EA 1H1NA 1E0TA 2Q0S