5EZ6B

Crystallization and preliminary x-ray crystallographic analysis of a small gtpase rhoa
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
179
structure length
179
Chain Sequence
AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
publication title Crystallization and preliminary X-ray crystallographic analysis of a small GTPase RhoA
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 64
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ez6B00
1E94E 3ZVLA 3RAPR 1BMFD 5C1BA 4GDFA 2ZI9A 1OW3B 4N1AA 4NBSA 4OK6A 5CITA 2OZEA 1GFIA 2WMNB 2G0TA 1G7RA 3QBVA 4BFXA 4TYWA 2BMFA 1X3SA 3KFVA 4B6EA 3WHLA 3MWKA 1VECA 1OFUX 3K0AB 4G3XA 1U9IC 5LDDC 5M04A 5CYOA 1KDRA 5J4KA 4QHSA 1EESA 4A15A 1E2GA 5LB2A 3GEHA 4OQMA 4V0LA 2UZ3A 4MQBA 1K6MA 3TLXA 4EKDA 2X8AA 2GTPA 5IK2A 3AVYA 2BMEA 4PPGA 3X1ZA 3JVUA 3MGCA 3OE7A 1AQYA 4HATA 2F1RA 3C7KA 2J59A 1NIPA 3GLFB 1QG2A 1P2UA 3BWDD 3TIFA 3UMRA 4LBZA 5JHHB 1Y3AA 4ZI3A 1XTJA 4DCUA 4L4UA 4QJ5A 3K0AA 3ADDA 2GILA 2IXFA 1E79A 3OIVA 4RSGA 4Y0AA 4F38A 4S2EA 2XITA 4D25A 1SXJA 4ZCLA 1N6LA 1UBGA 1C4OA 2GJ9A 1WA5A 2KJQA 3EZFA 4I1UA 4LX0A 4G01B 3R9XA 4HB0A 2ORVA 3EWAA 4R2HA 2DPXA 4MGIR 2I4IA 2IX3A 3A1SA 3ZD6A 1U8ZA 5C4MA 1J90A 3GQBA 1JXOA 5FOWA 5A5GA 5JEEA 5KPDA 1OFIA 5H70A 2R8RA 1B23P 2R6CA 4Q4JB 2WTUA 4WIAA 1CRPA 2XSZD 4ESVA 3R20A 3PUWA 4TZ6A 2AXPA 1COWA 3JZAA 4Q48A 3SE0A 1EFRA 4MGYR 2D06A 4G5GA 4PO9A 3LXRA 4A2QA 3RS4A 1M74A 4CDGA 1R0WA 4M2LA 3H2YA 4LCBA 1Q44A 2JLSA 3GP8A 4LY6A 1UBFA 2FFQA 1GSIA 1UFQA 3UK6A 5DIFA 2IEZA 5K8LA 3TR5A 2C5LA 1WMSA 1T5IA 1FFHA 3CNLA 1OXSC 4MUBA 2IL1A 1II9A 4GL2A 4TL6A 5EE5B 1KO8A 3ZIAA 5ELXA 5KDDA 2JGNA 4Q21A 1EGAA 2C9OA 5K8IA 1TX4B 2IEYA 4L16A 2BEKA 3WBJA 2W2VA 3BB1A 4DLRA 4CEIB 4E5UA 3KKMA 3I92A 5JJLA 1IN5A 3TW4A 4L15A 2GCOB 3QVUA 4URVR 1MO4A 2JCSA 3EZ9A 2VHTA 2ZJOA 4P3YA 5FR2A 4D0NA 4BLSA 2VO1A 1QRAA 2DCUA 1NKSA 1NBMA 1ZD1A 2GJAA 5KNCA 1GRRA 1KJYA 4AYWA 3N2EA 4LJ6A 2JEOA 4EPWA 1ZUNB 4JLKA 1E2QA 1IY0A 4RZUA 4LC1A 3EAQA 1SVMA 1Z6GA 5TXGA 4NYJQ 4WZ6A 4TMVA 4M1KA 1WDTA 1CP2A 1L7VC 1HH4A 1NJFA 3CONA 2KI5A 2X19A 4GOXA 3EWSA 4M1MA 4Q7JB 4UNSA 3IEVA 3W8NA 3I61A 4ZDWA 4M22A 1XMIA 5J4HA 1PZNA 2V1UA 4KV9A 3WY9A 2ODNA 1L2TA 1XBTA 3K70B 4DUGD 5F9HA 2AHOA 1P2SA 1E9CA 4TTQA 3VR5A 1OIWA 1SZPA 4I1OA 4NCIA 5SZKB 1Z07A 4IDPA 4O25A 5AJWA 3SFZA 3WBKA 1UEIA 4RZ2A 4RD6A 4D6PA 3RS0A 2PZEA 3QKSB 3A8TA 2Y8EA 2HYDA 2EYUA 1E9SA 2NO1A 3AP3A 3Q3JB 1S96A 3SJCA 4JMPA 1W0KA 3BH7A 1Z83A 2JIZA 2IBMA 4R98A 4QM7A 3SYKA 1Z06A 2JJ2A 4L8GA 4KFTA 4TMWA 1IN8A 4NMMA 3FGNA 2F55A 3IIMA 4KBFA 3I62A 2W6ID 1CTQA 3S1AB 1RZ3A 1W46A 2HT6A 3VR2A 1XTIA 2EU8A 4JZKA 2RGGA 4IEIA 4MKHA 1LNZA 3B1VA 4CEJA 4A6PA 1VYVA 4IHQA 1ZNXA 4IKEA 2Q6TA 2GEUA 3H84A 3KKOA 2J0SA 1ZM2A 2V6IA 1F3OA 1HUQA 2YVUA 2PBRA 3ZDQA 3X1XA 4M1SA 2XJ9A 1N6HA 2YWEA 1K5DA 3KB1A 5G53C 4A0RA 4W7SA 5TB5A 1ZU5A 1E2NA 2A5DA 2IC5A 3PEYA 1N0UA 1XXHA 5EE1A 4KU4A 1AJEA 1XD9A 4II7A 3LV8A 2OFWA 4A36A 4DSNA 2VP2A 3K0FB 1R8SA 2MMGA 3PENA 1YZQA 1SVIA 2F6RA 4I99A 2ZR0A 2HF9A 4B48A 2ATVA 2ZI3A 1JECA 3KB2A 2JLXA 3MJRA 5FUXA 2VSXA 1YJ5A 3WMFA 3IEUA 1IAQA 4US1R 5IHPA 2EFGA 1GL6A 1GNPA 4UXIA 4ARZA 1NI3A 2ERYA 1FUUA 1UBEA 3CM0A 3IBGA 3L0OA 2EYQA 5EP4A 3GLIB 4S35A 2NO0A 1AA9A 1UADA 3L8YA 1KJZA 5EXXA 4EPTA 2BEJA 3PVSA 4WBSA 4DZZA 4HLCA 1ZRHA 2ASEA 1EFHA 1RFLA 4Z1MA 4B3CA 4RD4A 2QPTA 2WOJA 5HKKD 5L3RA 2PCLA 4C3ZA 2CE2X 5BN4A 3ZZUA 4D80A 2NZJA 3Q5DA 4AYXA 1W36D 1E0JA 1LFDB 1XCMA 4NPHA 1RJ9B 4A0HA 1OXXK 2FSFA 2CMKA 3IUYA 4PAQA 4PFSA 1L8QA 1ZYUA 2CVHA 4RD3A 5FOVA 1AGRA 1U0JA 2UVQA 1J8YF 2REBA 3DOEA 4HB3A 4BLOA 2R6FA 4RD1A 5LD2B 4JKYA 4NZYA 1EX7A 4WVFA 3GMTA 1DBSA 1UEJA 5IT5A 2PLRA 5E7JA 1A82A 2OBNA 4Q1CA 3LLUA 4NH0A 1R5BA 4O2LA 4XTRA 2ZXUA 1JB1A 1LF5A 4Q9JA 2IYWA 4R7ZA 4ABYA 1NRJB 1KDTA 1W2HA 4K46A 2F3RA 2JDID 4LGMA 4BRUA 1TF2A 3A36A 2IW3A 3U61B 3GJ0A 3KJGA 4V0OA 3RLFA 2ORIA 4GI7A 4HLDA 3K9NA 4XWKA 1T8TA 1KI7A 4MA4A 1IOZA 4RJLA 2V9PA 1E2HA 4RY2A 3LVQE 2GBLC 1D9ZA 1A2BA 2ZYWX 4C2TA 2ZRAA 1XD2A 3TVDA 1VHTA 2FSGA 4TT3D 3M4YA 3P32A 2GESA 1IY1A 4F7WA 2AN9A 3ND9A 1DOAA 2GCPA 4Z8YA 2QT1A 1MRSA 2OAP1 3SDZA 4DJTA 4BLTA 4DSUA 2YOGA 2VSOA 3ZQ6A 1YR6A 4A6XA 2O0JA 3LW7A 2V1XA 3TRFA 3AQ4A 3I72A 3OHMA 5EP2A 1F48A 3A1TA 2H7VA 4LUCA 4Q4AB 2ZSEA 3IQWA 4DIEA 1JR3D 2WKQA 4M9QA 3B78A 1JXMA 2BJWA 4PAOA 1OT3A 1N6IA 4HAZA 4PANA 4BWYA 5KDOA 4D26A 1RRCA 1ZJ6A 2VP6A 1GITA 3OEED 3NDPA 4FMCF 3ZD7A 4CGZA 3AM1A 3NTUA 4FW9A 3K0SA 2A7QA 5JS8A 2HCBA 4WW0A 1P4SA 2IWRA 3SNHA 3RWMB 5JHGB 1AM4D 8OHMA 1JNYA 1XMVA 3MLEA 5FPHA 4WOPA 4ACBA 4KVGA 2WJVA 1S0UA 3B7GA 3FKSA 1II0A 3VR1A 5KO2A 2G83A 4HDCA 3B1WA 4IFBA 2O5VA 2RGNC 3UWOA 1TMKA 2CCJA 3RS2A 1IQPA 3EPKA 5JCPA 2Q0HA 1NY5A 3ASYA 3K0CC 1G3MA 5K8UA 4Q18A 2E1RA 1ZIOA 1OHHA 4KBGA 2ZPTX 2WPDA 2ZRJA 2O8EA 4Q9HA 3TK1A 1SHZA 1G7SA 3KJEA 4IXNA 1B0UA 3UATA 4DSOA 3MD0A 2NPFA 3U44B 2CLCX 2RHMA 4C4PA 3O8RA 4MKGA 3U7HB 1PV4A 1ZNWA 3WHKA 1KDOA 2VSFA 4ASUD 1EFCA 5KOYA 3V4RA 4V03A 2GAAA 3CX7A 2BDTA 1PLLA 1HA3A 2WJJA 3EIHA 1W0JD 2JJ8A 521PA 1VIAA 4OHZA 5F98A 3SR0A 3IIJA 3ASZA 2H16A 2FE4A 4XIGS 4G0NA 3CNOA 1NG9A 2J7KA 2QAGB 2PZFA 5EZ6B 3LH5A 1E1RD 1VPLA 4LBVA 2W00A 4BQSA 1KKMA 4PSVA 2A3RA 4KODA 1TTTA 4AI6A 5DYGA 3VKHA 3T06B 3OIYA 3IO3A 1XMJA 2KB0A 1GNQA 4YMWA 5BN3A 4K81B 4NYJR 3RS3A 4LZZA 1MT0A 1TNDA 3CW2A 4US2R 1O87A 5J4YA 1G18A 4HB4A 4JJKA 4D4JA 3H1TA 1GWNA 4M9XA 4AIIA 2IHBA 2K5UA 3MAAC 2HLDD 4JL5A 1QG4A 1R7RA 2AWOA 5HPYB 3K9LA 1W4RA 2ZYVX 3PUVA 2ODBA 3BBPA 4V0MA 5HCIA 3Q7QA 4YXWA 5C4GB 5JLJA 4QNMA 4PC6A 2V4ZA 3GPLA 1WB9A 4HUQA 1UJ2A 1KO5A 2OAQ1 2Q3HA 2C95A 4X8HA 4DRZA 4IVPA 4U5XA 2FN4A 1T5LA 4ZV4A 2OLKA 1FMJA 2VTKA 1GRQA 2A9KA 1NY6A 2HXYA 3CRRA 1ESMA 1N2CE 1X1SA 2BMJA 3NBFA 1DG1G 4A0GA 2O8CA 4BFUA 2WICA 5DYIA 3RABA 2Q3FA 1ZM9A 1FZQA 2IYLD 4KFSA 4QJ4A 3TMKA 2QTFA 1R4AA 1J2JA 4KXFB 2Z6VA 4V02A 5JI3E 5TVKA 3PV0A 4D4LA 3QF4A 1M34E 2XJ4A 3EPJA 2F1HA 2D74A 4PO1A 3U3KA 1DS6A 4CZ2A 3SYLA 3H86A 2XB2A 4AKGA 1CS4C 1I4TD 5FUVA 4EPXA 3LLMA 2BKEA 5CB6A 4OBEA 2DHRA 1Z6XA 3KQUA 2EWVA 5F2EA 3K70C 1PLKA 2GJ8A 3W6PA 3WNBA 4POAA 4JT2A 1JJ7A 2CCKA 2ZR9A 5BN5A 2X77A 1KK3A 2IA5A 3OEHD 1AKEA 1Q1EA 2HF8A 5JEDA 1C9KA 1NVXQ 1ZC3A 1T0HB 1XPUA 3CO5A 1P9RA 2FX3A 3LA6A 5C2JB 1E1QD 3VR4A 2QBYA 2Q9AA 1OIXA 4OI4A 2RMKA 2W2TA 3X1YA 4HZIA 1TUEA 1JAHA 2BVNA 2C2HA 3REFA 2YWGA 1CR0A 1ZD8A 2IXEA 4IDNA 1KHTA 4M0LA 4WXRA 1OFHA 2ZETA 4LYHA 1IHUA 1OYYA 1G17A 1GL7A 2TMKA 1OIVA 3RWOA 5DH9A 1SXJB 1UKYA 3H0KA 2CNWD 5G3ZA 5AUNB 4M21A 3UG6A 2MMCA 2LKDA 4OJKA 4DWJA 1T3SA 1W5TA 1JR6A 3VFDA 4NCNA 4YDSA 1G41A 3K8YA 3R9IA 1P72A 5JWHA 5EP3A 3V4FA 3VTKA 2YWFA 2OO7A 4IRUB 3EC2A 4D4MA 4BLPA 1GAJA 2F9LA 3RRYA 4ESHA 3TVTA 1NLYA 3KQNA 5P21A 3N5CA 4PAMA 3X1WA 1A2KC 4XSHA 1P75A 1ZNZA 4GP6A 3QG5A 3FPAA 3A1VA 2F1JA 1SVOA 3M0EA 5CJ2A 1IXSB 3AVOA 4PSAA 3AV0B 3OE7D 1QF9A 4JBXA 4FWTA 1K5GA 3CX6A 4TL9A 1LS6A 3ETLA 2BBWA 3KKNA 4YMVA 3LXXA 2FA9A 1S3SA 1D8TA 2O8CB 2IK8A 2A5GA 4F93B 1JEEA 1CR4A 4DB2A 3HPRA 2QMEA 4H1VA 3C8UA 1E99A 1TQ2A 3DDCA 4HAUA 3RNLA 3TJZA 3HYRA 3AF4A 3P27A 3VHXA 1KSGA 1SXJD 2RAPA 2WIBA 2EFDB 2PH1A 4BEBA 4LHXA 5JRZA 2NO9A 4M1TA 4M9ZA 3ADBA 4PSKA 4FD2A 2AXNA 2PX3A 3SEAA 3OFND 1T3HA 3SYNA 3B9QA 3WYGA 2YHSA 3AF0A 1VCIA 1AGPA 2WVJA 4WXPA 1JR3E 2ZITA 1ZUIA 2DFKB 2ECKA 2JASA 3ZJYA 3CKLA 4JVLA 1YZLA 1XFAA 3QF7A 4XVQA 3TNFA 3CRMA 4JLOA 3VNUA 1EFTA 4AYTA 5H1YA 1NG1A 2GCNA 1M7BA 4FMDB 4QHYA 5EUMA 1NKTA 4XVRA 3K09A 2FEOA 2EFHB 2VHUA 1ZU4A 4Q66C 2GXAA 2O8BA 2WV9A 3ZGXA 1KSFX 3BRWD 2CHVA 2XNSA 3MJHA 3QY0A 4LDJA 3LWNA 3K9HA 1OKKD 2DR3A 2F9MA 3GJ3A 3D7MA 2VA8A 3A6PC 1Q20A 2JLUA 4OI0A 1FP7A 1OXVA 3T1TA 2WIAA 3PXGA 5AUOB 2VP9A 4LBWA 1KI2A 4PQFA 2CL6X 4PZZA 1MO3A 4B73A 3SJZA 5TV2A 2ZRBA 1G21E 3DMDA 1S1CA 1MV5A 2A5JA 4LJ9A 5FPTA 3CWQA 1FW6A 3AUXA 1N5LA 3I8SA 1ESNA 5AJZA 3A1WA 5DI3A 3FHOA 4M53A 3K53A 3C41J 3UIEA 1FNMA 3C4JA 2C9CA 4P4SA 3RSOA 4BUJA 2QQEA 3GFPA 4GMDA 2CXXA 4PPQA 3U6BA 1NL3A 3LW8A 3ZH9B 1YQTA 2FZLA 2KBFA 2L0XA 5GJBA 2VHCA 1IJEA 2VF8A 4ZIRB 2NPIA 1G20E 2X2FA 2UZIR 2QAGC 1PUIA 3GJ7A 5IK2D 4CW7A 3NC1C 2PEYA 2OFXA 4UNQA 1WBDA 2P3SA 4A8JA 1YR7A 4HSEA 3SBEA 2CDNA 2QGZA 3GFOA 4HI0E 1U8AA 4B3DA 2QTVB 2GWHA 4ZI2A 2XZLA 3CPEA 2FJUA 3TR0A 3EIEA 3P26A 4FCWA 1VTKA 4BRWA 4TLAA 4MYTA 1Q22A 1RKBA 1QHXA 4FWIB 4OHYA 3BH6A 4NCHA 4Q01A 1WF3A 3C16C 4F91B 5LPNA 1CEEA 2FEMA 1F60A 4CEHB 2YYZA 3L2OB 3DO6A 3I8XA 1NNEA 1IXRC 4A8JC 1EG7A 4NE2A 1GKIA 1LV7A 4FCVA 4NKRA 4DIDA 5KSZA 5H8WA 2GNOA 2XXAB 2GA8A 5CK4A 5FTKA 1G1MA 4KI0A 2YJTD 4C0QC 2OE2A 4GZLA 1ZC4A 5KU1A 2JJ1D 3WXMA 1ZIPA 1WRBA 3A1UA 5CM8B 2ZRLA 3MWLA 2XGJA 1NN1A 3GLFE 3QQ5A 1VG9B 2EFCB 2IS1A 2CJWA 2XOKD 2FPKA 2OXRA 4Q5IA 2UKDA 1G6OA 2J7PA 3THXB 1ODFA 2VQSA 5J40A 4URYR 2GHIA 3SU8A 3CF0A 4QGGA 1M2OB 2HJVA 2OLJA 1KO7A 2RGEA 3RS7A 4ZKDA 3AF1A 5KSOA 1GM5A 4B47A 2HXSA 1BYUA 5KYKA 3LBNA 3QVVA 3KQLA 2FGKA 1KDPA 3Q7PA 3CX8A 5HZKA 1RC8A 3EARA 4A2WA 4JL6A 2PJZA 2QE7D 1U90A 1NVUQ 3QSYA 2I3BA 2QPOA 3B13B 5FL3A 1HT1E 1W2GA 2W6JD 2RGAA 1OLOA 3QPUA 1AZSC 2ZRNA 3DM9B 1Z8FA 2GETA 1YHNA 4PZLA 4RD2A 3VMFA 3KXLA 2ZSAA 3NEYA 4DCVA 4EFLA 3AVXA 2BHRA 1XEXA 4QOSA 4DT1A 2VIIA 2DB3A 1W36C 2LKCA 1XJQA 4I1SA 4R2IA 3CRVA 5DNYB 4OHVA 1ZM3A 2WKPA 2G6BA 3ZVNA 4W5HA 2DFNA 4E07A 3FMFA 2OT3B 1AZTA 1TL7C 2ZRFA 1VYTA 4G5QA 4BFZA 3QXJA 2IXGA 2IT1A 1Z5ZA 1CXZA 1CJVC 2C04A 1UM8A 2MSEB 2WWIA 1OFTA 3KDSE 3U5ZB 2O8FA 1ZINA 2ZI4A 3K09C 4EJSC 3OF5A 4HDOB 4A92A 3QXSA 3KZ1E 2IUUA 5CDFA 1NN0A 3A4NA 3ZS9A 1NMYA 2REXB 2QAJA 2P5TB 1KO1A 3A37A 3TQCA 1KI4A 3VX3A 4DLZA 4OQFA 5UKDA 3RC8A 4IW3B 4IDQA 3P20A 4MRRA 3A4MA 4GOJA 3LO5A 1NLZA 1YKSA 2PMDA 4DXAA 3ZYCA 2XTMA 1G19A 1G8FA 3GJ6A 2ZTSA 2QZ4A 1NLFA 1OXTA 4Q7LA 4RFSA 1XXHB 4DLUA 5B2ZA 4C9BA 3QENA 3VAAA 1LW7A 2V7QD 2X2EA 2ZYTX 3CZQA 4DSTA 1YZKA 4Q00A 2AKAB 1XTSA 1Z6TA 5AJVB 4A8JB 3BS4A 2CE7A 1QHYA 2IYZA 4ON9A 4E09A 1FOEB 2QNRA 2OEPA 3LBIA 3A58B 2V8OA 4EDHA 2WWHA 5DN6A 2B8TA 4K8OA 3OEHA 2GEVA 1W4AA 4ZIRA 1SVSA 1XU4A 3MWJA 4P33A 4U02A 4H1UA 1DAGA 1D9XA 4A1FA 2ZSDA 5FBWB 3PIRA 1JPJA 1KK0A 5FTMA 1G3IA 1L4YA 1UBCA 1C1YA 4M1YA 1Z0JA 1SKYB 3BJIC 2PMKA 5DO9A 2B7CA 4XD7D 5FBQB 3DZ8A 2H18A 3W6OA 3KKQA 2WJIA 5DLQC 4LHYA 5G3YA 5JWRA 2JLQA 1YZTA 2BWJA 1U8YA 2H8KA 2LCFA 2PLFA 2BBTA 2ZE5A 2CNWA 4TSFA 2CK3D 4TQUS 1Z47A 1COWD 2FG5A 2IYXA 3ZVRA 1Z63A 1EFRD 1NVVQ 2P5SA 3ADKA 4JVMA 1Z2AA 4I1VA 1XF9A 4G5RA 1MABB 4OJQA 1F6BA 3SS8A 1FPMA 3HR7A 6Q21A 4QFMA 2PEZA 4IDHA 1SHKA 1J70A 2CJWB 4FMBB 1SKQA 2B8WA 3L8ZA 1CJTC 3PG5A 4LJ8A 4RVCA 2BJVA 3V00A 4Q02A 4TQAA 1BS1A 1CJMA 1W7AA 2FFBA 4Q4HB 3IKJA 4ZDKA 4QBHA 2G77B 4QGHA 4TTRA 1P60A 4GNKA 4RZXA 4Z1MD 5TMPA 2O8FB 4M1WA 1JEDA 1FL9A 1GVNB 2H92A 2YNMA 1KOFA 3L43A 3E5HA 2JLWA 4MKFA 2ZUBA 2DBYA 4IEEA 5L3QB 4B76A 2N46A 4P4TA 2ZROA 3SHFA 3SQXA 2WWYA 4B3GA 4YLGA 5E3HA 5F9FA 2CCGA 4OQXA 3AVUA 1W0JA 3GLHA 1IN7A 4Q9KA 3THWB 2ZEJA 5G40A 1VG8A 2GVZC 4Q1FA 3WYAA 1RVDA 2W58A 1G8YA 3TUIC 3TSZA 1T6NA 3SOPA 1NN3A 1GTVA 5DE3A 3CH4B 3QXXA 2ANCA 3Q8XB 5AJXA 1XPRA 3N70A 2G88A 1KK2A 2QEQA 3AKYA 3CH5A 1S9DA 4V0ME 4V0KA 2HUPA 1U81A 4MGKR 3KJHA 4G1UC 4GRAA 2YC2C 3WMGA 1A4RA 2RCNA 1GL9B 4UXJA 1J7KA 2I1VB 2OBMA 4B2PA 4MRSA 2ZJ8A 1VG0B 2ZR7A 1TADA 2EW1A 5BYKA 4Z54A 4PC3A 4I4LA 3HDTA 2YWHA 5GVSA 3RDPA 2F7SA 2WMOB 3L0IB 5GJCA 3CR7A 1OF1A 1LVGA 3IDQA 4OQLA 4W9MC 3EX7C 3THYA 1PVOA 5EXPA 4UJ3A 1SQ5A 3KKPA 2GXSA 3I73A 3QUSA 4LBYA 4DKXA 2BCGY 4XH9B 4BASA 2QP9X 2VF7A 3AF3A 1E3MA 2QUZA 3O47A 5FL7A 3FOZA 2WKRA 3KTAB 5CB8A 5K8TA 3DOFA 2VP4A 4HLUC 4C0SA 2O52A 5D3MB 4YQFA 3OAAD 1DAKA 4MDFA 3KL4A 5BXQC 2ZJ2A 2C03A 4P4UA 1Z0DA 3S1AA 4RFVA 3WRXC 3ICQB 1G5RA 1BIFA 1NSFA 2IF2A 2ZE8A 1QZXA 4HAWA 1FQJA 4OYHA 3OIWA 5JJKA 1Q57A 2J45A 1F5NA 3NH9A 4D0GA 1E9EA 1VYUA 4BGDA 1VMAA 2CHGA 3VNVA 4US0R 3GJXC 3ZIAD 4AG5A 2DWOA 1FTNA 3BE4A 2WSSD 2RKOA 4PC7A 3IBYA 4NU0A 4IDOA 2NIPA 2Z83A 5SZJA 4PC2A 4DDVA 1CRQA 1H8EA 2ZJBA 2XXAA 3T1VA 4QBGB 4QXAA 5BYJA 2Z5FA 3GJ8A 1R5OA 2YOFA 5BW8A 4Q4LA 1DG3A 2VRWA 5AR1A 1R10A 5JFGA 5FPYA 4GPTA 2GXQA 3W5IA 4HAVA 3KFXA 3M1IA 4JLVA 2R62A 1CLUA 1OHHD 1ZMXA 5IRCD 1W1WA 4P0TA 2Q3MA 1CJUC 1I4DD 2OHFA 2GBLA 4GP7A 4CEIA 3FFAA 5CYPA 1N5JA 5SZIA 5DI9A 5A0FA 3R7WA 1ZD9A 2IYYA 5B58C 2IS6A 4ZKEA 2EWWA 1W4BA 4XOIA 2ZANA 3NDBB 2RGXA 2REOA 3V9PA 4B3BA 1IJFA 2XZOA 1KSHA 3VHLB 2OCPA 5CIWA 4N0DA 5HKKA 5HR5A 4PQRA 4IOKA 2JAQA 4HZUA 1A5TA 3PEVA 2ZS9A 2A78A 3PR1A 3WP1B 2ZU6A 3EZ6A 2QRNA 4UQOA 3NHAA 2D7CA 1UDXA 4PQYA 3DKVA 1E0AA 2WOOA 2AFIE 3B60A 4NDZA 4EFNA 2ONKA 3QBTA 4TMXA 1PUJA 3TAHA 2IHYA 1F2UB 2VL7A 4OI1A 1OB5A 3Q5EA 3RHFA 1VCNA 1EWRA 5DSZA 3ZQJA 4B74A 3LX5A 1Z3IX 1U94A 3NXSA 4JLNA 4AKIA 1ZCAA 2PCJA 4A2PA 4Q1AA 2V6JA 5TY0A 1OH7A 1U0LA 3U4QB 1NJGA 1SKYE 3E1SA 4TLBA 3VU9B 4EJSA 3G0HA 1XCPA 3CR8A 2G1JA 4C0KA 1EWQA 1TAGA 2VP0A 4JBYA 2XZPA 3DM5A 5EUQB 1BMFA 1Z6AA 3JZMA 5LBIA 2J0UA 4ACAA 2MSCB 2QE7A 5FOTA 3T35A 3I3SR 4BPBA 3RRMA 4NL4H 3LAWA 3IPXA 3C15C 1W5SA 2WWGA 3LBHA 1HQCA 3UKDA 121PA 2IYUA 5J5CA 4DLTA 5B57C 3W3ZB 3QPWA 3GLFA 1FNNA 4C0JA 2ZVPX 1X86B 1QVAA 3OFNA 3LVRE 1OPXA 4IVRA 4RZ3A 1S3GA 3BFXA 4QL3A 4B3FX 1NSTA 2RHDA 1RYHA 2VP5A 4LJAA 1AS3A 3FMOB 1HURA 4D4KA 3U7GA 2QQ0A 3EA0A 2ZM5A 4YMSA 5GJVC 1QDEA 3ONWA 4U00A 1NN5A 2WWFA 5GVRA 2O8DB 4E22A 3RSLA 2O8EB 2A2ZA 3PCRB 1D6JA 5HTKA 4JLMA 3PUZA 4JIMA 4Q19A 3RVBA 3W8RA 3T12A 2ZSBA 3UWKA 5ANRB 2QORA 4L9SA 2B7BA 1NBMD 4DLSA 1W44A 4HAYA 1P7CA 1Q1BA 1KI1A 1HQYE 1A7JA 3D31A 1OKKA 2J1LA 1KAGA 2QENA 3ECCA 5E95A 2YINC 2E9SA 3TGPA 3B1ZA 1MOZA 2AFHE 1QHGA 1LB1B 1YZUA 3P4XA 5IDVA 1Z0FA 3F0TA 1Z29A 2ZRMA 3QKTA 2VYFA 4PPNA 4QGAA 4EFMA 4QJ3A 5EXTA 3RRNA 4GOKA 2PX0A 4JKIA 4UNNA 3FFBA 1KIMA 2ZS8A 2QMOA 4HUTA 5F3WB 1SULA 4DUGA 2QAGA 2MSDB 3P1JA 3VR6A 2AR7A 1GILA 3HU2A 5DISB 2ZUCA 1P73A 2YKGA 2RB4A 1XX6A 3EG5A 3QG1A 2QA5A 2QRZA 5CJPA 2R6DA 1SXJC 2PZGA 4Q9IA 3K0EA 3PUYA 3RYTC 3DKPA 3IQXA 1OV4A 1Z0AA 1QHHB 4JSTA 3DEFA 4KSBA 4RD0A 1G3UA 1Q1QA 5H68A 3SJBA 2V3CC 1XJ0A 3VU9A 4EJSB 5EE9A 3FVQA 2AL7A 3O8DA 4MKIA 4Q4JA 4IVQA 5B30A 4NHOA 4CRWB 1FX0A 3SFVA 1XD8A 3VR3A 5FTJA 4KFRA 1KMQA 2QI9C 1G8PA 2WJYA 1N6PA 4BFVA 4EIWA 4LHWA 4XTCS 5CK5A 3GLGA 2ZU0C 3TQFA 1KTVA 3BXZA 4HUQB 3QOFA 2WJGA 2ZQ5A 2E87A 3H4MA 3R7WB 1DO2A 3W9YA 3HU1A 1KO4A 4DCNA 4QNRA 1UKEA 4KFUA 2QTHA 1ONBA 1W36B 2OXCA 1AKYA 4M1OA 3DHWC 3X2SA 2WPDD 1E9FA 4A0FA 1KY3A 2F1IA 2AD5A 3HPQA 4M4SA 1R6BX 1KK1A 1E2IA 1G64A 4OHWA 3CPJB 5DHAA 1G3RA 1SVLA 2ZE7A 3U2QA 1N6OA 1KI9A 4NTZA 4IOJA 2P2LA 1KI8A 3GLHE 3AGPA 4BLRA 3RC3A 1X8JA 3QJYA 2ZIAA 1WCV1 5HE9A 3TUJC 2LWIA 2P0EA 5C18A 2GDJA 4OQNA 4XJXA 1ZUHA 1WXQA 2D7DA 1JR3A 2FWRA 1GKYA 2FU5C 1FMLA 2IYTA 2PJRA 3B5JA 1XRJA 2V54A 3EC1A 4GFDA 2ZRHA 3KUCA 1J99A 4G5SA 3PEWA 2FH5B 5LD2C 4QBIA 3ND8A 5KNDA 2XB4A 2NTYC 1OH8A 1RYFA 1KMHB 4LHZA 4KAXA 5CLLA 2Q9CA 2RGCA 4RKFA 4QM6A 2QSYA 3IHLA 5HE8A 4KJZA 1FTSA 1L4UA 4X8OA 1W48A 2P65A 5AK0A 1HT2E 1AS0A 4HYYA 4BZQA 2JIZD 1XJCA 5KTYA 4QHTA 1E2KA 1II8A 1S2MA 3B9PA 5EE0A 3LX8A 3LY5A 4NCKA 1R0YA 5JSZB 5KNBA 1G5TA 3B8HA 4DVGA 1M7HA 3CRQA 3LD9A 3U3MA 3C5CA 1YZGA 2F43A 4AD8A 4RCYA 3KUDA 2Z43A 5AJYA 1DTSA 2ZJ5A 4TMZA 4TYNA 1Q21A 3R8FA 1YRAA 3QEOA 2RGDA 2D2FA 2ZRCA 3U3OA 1TEXA 1V5WA 1OB2A 1TEVA 3BH0A 3RANA 3NVAA 2O8DA 1D2EA 2GJKA 3I5XA 5FPKA 5JS7A 4LYAA 1II8B 3GD7A 3PITA 1E98A 4LWZA 3T1QA 2CVFA 3NBZC 1CIPA 4KITB 2WAYA 1NMXA 3Q9LA 3R9WA 2GRJA 3CLVA 1MRNA 1P5ZB 5JWOA 4MYUA 3ZZ0A 1CBUA 3AKDA 3TH5A 2NOAA 5E7MA 3B2EA 3QKRA 621PA 1G8HA 3MWYW 2IYQA 4PHFA 4ZPXA 2IYVA 2FMXA 4X8LA 5CLQA 4P4SB 2GXUA 2OCBA 3U3RA 4B75A 1GP2A 5FR1A 1ZCBA 3E70C 4A4DA 4LSGA 5FFMA 2CL0X 1KSJA 1HE1C 4Q1BA 4CEHA 4MYHA 4BE7B 4TYQA 3BERA 2W2XA 3C14C 3W3AA 5EE3A 5L3VA 4NP6A 4XWOA 3THXA 1GNRA 1LF0A 4TT3A 1I4LD 1JAIA 2Z4SA 3HJNA 2NG1A 4Q1EA 4BFSA 1TUIA 3FHTA 4Z8XA 1ZNYA 2QY9A 4AKEA 4A82A 2A30A 2FPMA 3PUXA 1U98A 3OIUA 1H8HA 4LJ4A 4G5OA 1LY1A 3T5GA 4MDEA 1K8RA 1H8ED 2BM1A 1ZP6A 4FN5A 2XSZA 3A4LA 1VCOA 1KI6B 1XPOA 3QPVA 4FINA 1VIYA 3AGQA 4HB2A 4C0LA 1U0HC 2BOVA 2XNDD 1XXHE 2IUTA 2PT7A 2JLRA 4JLAA 3MUFA 4JSYA 4LOAA 4Q4HA 2GCOA 2GZDA 1O3YA 1QHNA 3GLGB 1IN4A 3IHWA 1IY2A 1S9HA 2J41A 3D6TB 3D8BA 3F8TA 3NC0C 1DAHA 3EZ2A 1RE0A 4DHEA 4ASUA 1E9BA 4TTPA 3CIOA 5E7IA 3HU3A 5HZHA 1U2RA 4OHXA 4DEXA 1NVVR 3OZXA 4FI3C 5KDLA 5AUPB 3O8CA 1ZBDA 2QBYB 2Z0MA 4LK2A 2NGRA 4Q7MB 2C99A 2F43B 3QXHA 1E2MA 5LB4A 4TZ0A 4KYIB 2Z4RA 3LRPA 2QMUA 1UF9A 4QGFA 1ANKA 3QF4B 3KXKA 3U3JA 4DT1B 2OM2A 4LV6A 1E79D 1TQDA 3TE6A 1I2MA 4Y0VA 4JBWA 3NBYC 3SC3A 4MUAA 4X8MA 1AQUA 3KJIA 4EUNA 1G291 1OSNA 3B85A 3P4YA 4XSGA 4MH0R 4QG7A 1YR9A 1GG2A 2QROA 1X8KA 4KO8A 2ZUDA 1UPTA 1RW4A 5JCZA 1TPZA 2ERXA 4ZO4A 1P62B 2D3WA 2IUSA 3QKSA 2ZI6A 3TW8B 4AWXA 3BK7A 2ZRIA 3QNUA 2B6HA 4R9UC 3N2IA 3LQQA 3K9GA 3SBDA 2G0NA 4URUR 1X6VA 1KI3A 2GF0A 2C78A 3WYFA 4BFYA 2GK7A 4C0AC 3THOA 1KZ7B 4TL8A 3WNCA 4DEYA 3AVQA 3T1OA 3X1DA 2QM8A 2OFOA 4F4CA 4UXHA 2EQBA 1KYIA 1G7CA 1Q1ZA 2P6NA 4C7OB 3D3QA 2XOKA 4MITA 5FTNA 5GJWC 4AG6A 2ZI5A 1NMZA 1WQ1R 2J7PD 3SN6A 3UMSA 4Z51A 3KTAA 2ZRKA 2B21A 3AP2A 4M8NE 4GT1A 3REGA 4B3XA 4B34A 2QM7A 3ICEA 3GCGA 5KUTA 1QHSA 2X1VA 2GEDA 2GK6A 2KBEA 3ADCA 3KQKA 4Q4AA 1G5PA 1XMSA 1KAOA 3EASA 4TYYA 3EZ7A 3FKQA 1LS1A 4QBFA 2WAXA 2HJGA 3FKSD 4PHTA 4DDTA 3ZVMA 5SZHB 2HCJB 1D2MA 2QGNA 2V7QA 1TF5A 5J4VA 4AKHA 1G4AE 2ATXA 2WWWA 2YV5A 2D62A 2W6JA 4ZCMA 3NHBA 1N0VC 1DE0A 3DVLA 4BECA 4NYMR 1GDDA 4LPKA 2BKUA 2FPLA 5EZ5A 4LV8B 5FPSA 4HLUA 3G82C 4CVNA 1P9WA 4XVUA 1GIAA 3MRSA 3W34A 3AVPA 5J4LA 2FFHA 3F5FA 4QC2A 4IJMA 3W6NA 1Z28A 3I32A 4NONA 3QEJA 1G3QA 1P2VA 1Q0UA 4JLBA 3CUEF 2R44A 4O3MA 3GLIA 1EX6A 5IF9A 4W5WA 2W83A 1XCGB 4URZR 2EVWX 3GFTA 221PA 5G41A 1VHLA 2J87A 4Q1DA 4U7DA 2FDCA 2ONJA 4DDWA 3LQRA 1F2TA 2V55B 4TWZA 4B35A 3AVWA 1R0ZA 5EXSA 1E32A 1MR3F 1YVDA 1CKEA 1GUAA 2J9RA 2OCAA 2ZAOA 3KX2A 3LFUA 4IOMA 4OL0A 1UAAA 1E1RA 2A5YB 3FMIA 5FI1B 1DELA 1S4QA 5JMTA 2IWHA 3CWZA 1JPNA 1T9HA 2IYSA 4JVNA 5L3SB 1IBRA 3EW9A 3I4LA 4GSYA 5FI0B 2C9YA 2G9NA 3FHCB 2JATA 4MRVA 1LTQA 2GZHA 4GMXA 4AY2A 2BV3A 1TF7A 2O0HA 1RJ9A 4UNPA 1XZPA 2NQ2C 1XEXB 4L9WA 2JLZA 3DMNA 3GLHB 3I5YA 2IS4A 1T4GA 2CLDX 2H57A 1Z0IA 2W6IA 4JLPA 3NEJA 1US8B 1G4UR 2Q21A 3NBXX 1OH5A 3QE0A 3MSXA 1IONA 4PTLA 1Z08A 5L3QA 5FTLA 2J0QA 3FTQA 1E2EA 2J0VA 3K70D 2ZJAA 4D0LB 1KNQA 3NIBA 4WAUA 5FOXA 1IXZA 2ZE6A 1SGWA 4V0NA 3U4QA 4ZCIA 3HR8A 3MFYA 3T15A 1BO6A 1E0KA 1E6CA 2FZ4A 3AP1A 3MMPA 3NKVA 3GEEA 2KSQA 4F4IA 3CB4A 2C77A 3SQWA 2ZRGA 5DHFA 3TKLA 721PA 1R5NA 1VDZA 5FOUA 5FOSA 1M6NA 1FUKA 4B44A 2BBOA 5KSYA 4XD7A 1SVWA 1N3BA 4BZXA 2GAOA 3QI2A 1MH1A 4F92B 4HEJA 3T5DA 4JYBA 4BLQA 4RFSB 3BAFA 3GEIA 3CZPA 4TSFD 4AC9A 2DY1A 1E2LA 3CNNA 1TU4A 2WM9B 2QMHA 5HCNA 5CDFE 1H65A 1X1RA 3AB3A 4TL7A 2DFTA 1P2TA 1G16A 1TU3A 2AX4A 1X8LA 1FQKA 4LYFA 1R8QA 4B6FA 2XTZA 4DLVA 2ZSFA 1N6NA 3DZDA 3FWYA 1NP6A 1XTKA 4URXR 4C7OA 1N5IA 1W4CA 4CYMA 4GBMA 4H9GA 2OCYC 1E4YA 2OUKA 1HEIA 1XTRA 3BFVA 4IFEA 4TN1A 1OH6A 2C96A 4TLCA 2A5FA 1IN6A 2CEAA 2QSZA 3HYTA 4LJYA 2R2AA 1GRNA 1AIPA 1AK2A 1P3JA 2GVDC 2H5EA 2P6UA 1E2JA 4PO8A 2IYRA 4DCSA 2QT0A 1F2TB 4MYCA 4FCTA 1BOFA 3PJRA 2D4HA 1QVRA 4IOLA 4KLZA 4QRHA 1XTQA 3EXAA 4JLJA 5JZVA 1OYWA 5KHOC 2BIFA 1WBBA 3VX4A 1RRPA 1Q3TA 1TQ6A 3BOSA 2QG6A 2WSMA 1JJVA 5BQ5A 2ZVQX 1MABA 4WZBE 1GOTA 1E9DA 2R65A 4KHZA 4RCZA 1IM2A 1E96A 2AK3A 3THYB 3OEEA 1BYIA 4P31A 1HY3A 3VQTA 4LHVA 4CF7A 4N3NA 4TMKA 2QL6A 3O8BA 3QIAA 4RKEA 5TDHA 3UG7A 1I2DA 1W0KD 4MRPA 2HLDA 1E9RA 2CHQA 4MGZR 4F4JA 5JJIA 4CT4B 4EQ6B 3CF2A 2W0SA 2JLYA 2PL3A 2WSSA 3IPYA 2DYKA 1E69A 2RGNA 3BIFA 4J0QA 4KSCA 1E2FA 1UKZA 3RRZA 2JLVA 4TQ9A 1YU9A 2YC4C 4B71A 1KI6A 3JVVA 1E4VA 1FX0B 5KPJA 5AUQA 2KWIA 4Q7KA 4YDHB 3TSWA 1SXJE 2F3TA 2VEDA 3FE2A 4DCTA 1U9IA 1MKYA 2OILA 3UANA 1Y63A 4DLXA 1HTWA 2FF7A 3CBQA 1T0JB 4N0EA 3DPUA 3AH8A 1SVKA 1KMHA 3THWA 3BB3A 3BGWA 3BB4A 4OK5A 3AEZA 1VCMA 3FMPB 4L5BA 1G9XA 5L3SA 2VPPA 4D82A 2C98A 1H8HD 2O8BB 1P61B 1Z6YA 2QN6A 4I81A 2P6RA 1JALA 2FFAA 3LNCA 3IILA 421PA 2JA1A 3HWSA 4CIDA 2VHQA 2HEIA 3L0SA 4DDUA 4JVSB 3T61A 2R9VA 2JJ1A 1BH2A 1DADA 1XWIA 2BCJQ 4NCJA 1DARA 1US8A 4FMCB 1PJRA 2H1LA 1CR1A 3U60B 3RS5A 4PHHA 5E4FA 2IS2A 1GKUB 3BORA 1E1QA 1VKJA 1JBKA 1T91A 2ZAMA 4KCGA 1XNJA 3B1YA 1G6HA 2AD1A 1KKLA 1ZM4A 5GADl 2G3YA 2PT5A 1CF4A 4Q9LA 1DAFA 4TYPA 4MRNA 5KSPA 3EA5A 4O2RA 3PFIA 5TARA 2ZJZA 5D3MA 5C46F 3AKCA 4OI2A 4PZYA 1P9NA 3CRW1 4FXPA 5L8VA 2Q9BA 1XEFA 3WNDA 3ZZTA 1FP6A 3UMFA 1AS2A 2ZRDA 2QPAA 4JJZA 1JI0A 3QKRB 2OSBA 4AURA 1CULC 3GLGE 2QP3A 1ZW6A 2ZREA 3B6EA 4UNRA 4YC7A 5J47A 2O0KA 1YRBA 2FGJA 2YZ2A 3AF2A 3K0FA 3FDIA 2H17A 5FBRB 4WZAE 2CBZA 4R71A 2FV8A 3L82B 2YOHA 4NYIQ 1N0WA 4DLWA 2GJSA 3PEUA 2HYIC 4ERNA 2ZRPA 2R6AA 5EJEA 4CEJB 4Q47A 1A1VA 4KYUA 821PA 2N42A 2RH5A 2ZJYA 4NYIR 5FUYA 1Z22A 4O0MA 3GLIE 3OAAA 1BKDR 5BWMA 4C2UA 2DFLA 4B2IA 2GKSA 4C30A 1VG1A 2XTNA 2JDIA 1E0SA 4M9SA 4EAQA 4LYJA 4UJ5A 4YONB 1E9AA 4BEJA 1JQJC 2XAUA 3EPLA 3U44A 1QBKC 2VHJA 2ZS7A 1J8MF 4B33A 1QHIA 2NO7A 1M7GA 4C0BA 4YMTA 3SI7A 1RRGA 1OXUA 4CT5A 2WWXA 1XB2A 2BBSA 4OKSA 2VBCA 1HV8A 2FSIA 4PPFA 4TMTA 4URWR 2BM0A 1EK0A 1RRFA 4HZUB 4LPSA 2BC9A 3U6KA 1G8GA 1N6KA 4D2IA 4DB4A 4PC1A 3U7EB 4DC9A 4A9AA 2J5XA 4UKDA 3C5HA 3TBKA 5EQTA 4ILEA 1NVWQ 5JECA 1E2DA 3BC1A 1XDBA 3WP0A 2XEXA 4GZMA 4TLEA 1ELOA 4C0HA 5D3QA 5A4JA 2AK2A 1T3LA 4HAXA 1CJKC 5FUWA 4B32A 1DO0A 2N1BA 3DL0A 4D81A 1S1MA 5JBQA 4WA7A 1ZVQA 5FBLB 1M1YE 1KGDA 1RIFA 4LC0A 3TSOA 1E2PA 1N5KA 3GJ4A 3TAUA 2JJ2D 4LJ7A 2VLIA 2HT1A 4IXMA 4JYCA 3WMEA 4E03A 1DPFA 1PLJA 2DWPA 3K1JA 5JI2E 4EPVA 2VH5R 3QKUA 1XD2B 5DI3B 1W49A 4W5JA 1YZNA 2OG2A 2GF9A 2J0UB 1XEWX 2RGBA 2SHKA 3CPHA 1NBME 1DVRA 2ZYUX 1P6XA 3E2IA 5B64A 4JLDA 4YMUA 4JT4A 1Q3HA 1R0XA 1OJLA 4BZPA 1NF3A 3GJ5A 3SHWA 2CLSA 2C8VA 1M8PA 1ZAKA 3FB4A 2QP4A 2WZQA 1WE2A 5JRJA 1UDWA 5AWFC 3SJAA 1CR2A 3BFKA 3L0PA 1F2UA 3G5UA 1YR8A 1AN0A 4JS0A 5CIQA 4EPRA 1NIJA 2AKYA 5CM9C 3SZRA 5FH9A 2G1KA 3CF6R 5FL7D 4DLYA 3Q72A 2XX3A 2FSHA 1T8UA 1XZQA 1KY2A 4HDQB 4DBLC 3Q85A 3KQHA 2CK3A 2QU8A 2NZ8A 3I1FA 3NG1A 4TLDA 2ODEA 4P32A 1MO6A 3VKGA 3ZLJA 2IF0A 2XNDA 4EPYA 2HV8A 4HLQB 2J3EA 3M6AA 5DGXA 1N6RA 2WBLC 5JSZA 1W47A 1G7TA 2D2EA 2ODWA 2WJHA 3WRYC 4PX9A 1N25A 4LJ5A 1HE8B 4ITRC 4JL8A 1Q12A 4AK9A 2OESA 4PHGA 1U99A 2ZI7A 1CU1A 3IGFA 1MO5A 2ANBA 4YXWD 2DWQA 1HYQA 4XWAA 3J81k 1XEWY 1OE0A 5EP1A 2AWNA 3FYHA 1Z2CA 3UPUA 1D5CA 3B82A 4LI0A 4KVAA 2I1QA 4LRWA 3ZS8A 3LDAA 1EFUA 1ZM7A 4KLNA 4NYMQ 2HDNB 1WP9A 4BFWA 4QKQA 3R8CA 3AVTA 4PXAA 3T34A 3NH6A 1DEKA 3MG9A 2B92A 2BMDA 5DN6D 1RPZA 2FOLA 4B43A 1QHHA 2EFEB 3W5JA 4ARZB 1V43A 1ETUA 2NO6A 2FNAA 1UKVY 3F3YA 5FBVB 2NMVA 3AKEA 2OV2A 4FMDF 2KE5A 1KJWA 2OBLA 2W0MA 1GZSA 3QXCA 2CL7X 4Q03A 4OK3A 4BFTA 1KZGB 1XP8A 4EQ6A 3VKWA 4B2LA 2P67A 3NWJA 1D2NA 3UXMA 3TUZC 3EIQA 1DAEA 1Z0KA 3AUYA 4PR0A 3W90A 3BD9A 2GZAA 2WHXA 3MCAA 3AVVA 3U7FB 1EXMA 3EPHA 1YE8A 2R6GA 1TQ4A 2J46A 3K0CA 1DAIA 1DAMA 4ZDJA 1KNXA 1S8FA 1JQLB 3IO5A 3HP1A 3OESA 4ZDIA 3IIKA 3PQCA 3B1XA 2ORWA 4FIDA 3KXIA 4LV5B 1R2QA
chains in the Genus database with same CATH superfamily
1Z2NX 2XTJA 4HN2A 2GN6A 2HQ1A 2I2FA 2XRZA 2PNFA 5IULC 1IK4A 1BMFD 2BZGA 4XB6B 4MEBA 3RBZA 2C54A 3VDXA 4N1AA 4NBSA 4HVLA 1LNQA 2FCAA 5CITA 1VLZA 3BXFA 3JVIA 2WMNB 3R4VA 4G4GA 4HQNA 1BCRB 1JQ5A 2Q3EA 4GE3A 2J0EA 3I9V1 1G7RA 4TTIA 3ECAA 4CCYB 2X58A 3ZEIA 1QQ7A 2E1PA 4LNUB 3FGPA 3WLFA 4M8SA 3Q15C 3BEOA 3EDOA 3O3NB 4TYWA 3DCYA 1NVGA 3WWDA 1Z4MA 1GQSA 1XL1A 4BGVA 1ODIA 3JWEA 3WBBA 4ZGGA 3F6CA 5ITWA 3IDFA 1U28A 4P5EA 1V6CA 5IUNC 5A4AA 4C5AA 3NVKI 1PJ4A 2CJYA 2O2EA 4QHSA 5CYOA 1LDGA 5J4KA 3RBAA 4RSHA 1JHUA 2CLOB 3VZDA 3UWPA 2A58A 4EYOA 4BRSA 2X8AA 2GTPA 1BX0A 3AFMA 1N2OA 3JPWA 1BXRA 2C5HA 3OE7A 2PFKA 1XZFA 1GADO 3H97A 3WJAA 1KPHA 2TRSB 4KZKA 4CTNA 3OM1A 1P2UA 5LFAA 1XDUA 4LF6B 2ADFA 4LBZA 1DQZA 3U26A 1W2WB 4L76A 5THQA 1XTJA 2HHAA 4UREA 4JQCA 4RKWA 3IA7A 4DCUA 2RHOA 1Z75A 1E79A 4RSGA 2PJUA 3RVKA 4D25A 1SC6A 1SXJA 1EFAA 3TNYA 2Q5JA 2REQB 3VO1A 5FPQA 3N2LA 2YWBA 5ABPA 2I03A 4PRZA 3UT6A 3HY6A 3DJYA 1XVLA 1UBSB 3AESB 4I1UA 1MC5A 1RLJA 3QQPA 4G01B 4A8PA 1B41A 4BS9A 2HF7A 4CBVA 2J9ZB 4M46A 2I4IA 1FFYA 3IVCA 4XM1A 5F73A 2IX3A 2OBYA 3KOWA 5AI5A 3ZD6A 3NV7A 3GLKA 3MCZA 1J90A 1P6QA 3GQBA 3R24A 4O1MA 4DLLA 4NAHA 5JEEA 2XY4A 2WSLA 2R8RA 4Q4JB 4BX3A 3FVRA 4ZV7A 2R00A 1GN9A 1TRHA 3AFGA 3RASA 3R20A 3ESBA 5C5DA 1DC4A 3PUWA 2AXPA 4TZ6A 3ETGA 2ZIUB 1COWA 1C1XA 4I6GA 4R1LA 1PQUA 2GUGA 2JRLA 1EFRA 1M2FA 2D06A 1ICEA 4UC0A 3LXRA 4ZU1X 5FULA 3SBOA 3V4PB 4A2QA 5J1SB 1KQNA 4CDGA 4ETNA 1R0WA 3K6SB 4M2LA 2GQ0A 1ZUWA 3HUDA 1NT2A 2NP6A 1ZRNA 3RSQA 1JTEA 1UBFA 3UAXA 5CCDA 4AMUA 3E2PA 1RP7A 4LJRA 5K8LA 3NHMA 4G0ZA 4H77A 4HUJA 4JJIA 1N78A 3IDSA 1KBQA 3TNDA 5FWDA 2VJQA 3EB9A 5EYPB 1QP8A 2JGNA 4Q21A 4H6XA 2GSWA 4RESA 2C9OA 1TX4B 4L16A 2V7EA 2BEKA 4EGJA 5M29A 3JQFC 3TVYA 2X8BA 4DA7A 4X7MA 4WNAB 1M6YA 4M8KA 4F0JA 4FSDA 2VCEA 1RZUA 4MWCA 3QLEA 3BL6A 1UAYA 4BQIA 2P3OA 2RDMA 3OCVA 2W4MA 1IPFA 5EHQA 2ZJOA 3RUDA 4CUKA 3OTGA 2QTRA 2IH2A 1F3LA 2X8WA 4OCZA 4WK2B 2ZYGA 2VO1A 2PD4A 1CRLA 1NU6A 3L7MA 1NBMA 1ZD1A 4RS3A 5KNCA 1GRRA 1KJYA 1SBYA 1AN9A 1X77A 1FDIA 3AWIA 1NATA 4P54A 4GM1A 5LWQA 1QHFA 4BBJA 3A7DA 4D8YA 2YYYA 4J3FA 4UVEA 5LKAA 5A3RA 3REOA 5EMNA 1L7VC 4YRRA 2X19A 1PEDA 4GOXA 3EWSA 4Q7JB 3G9UA 1JI3A 3HLTA 1C3XA 2GPAA 2PSFA 4Y6PA 1KS9A 5GPBA 4X20B 1XMIA 1PZNA 3AYZB 4ZMSA 3WLAA 2ZUVA 1OXMA 1LK5A 3QVTA 4GVPA 3EXEB 4IQ4A 4K9RA 4MA0A 3K70B 1V3QE 4EG5A 5KTPA 3O1LA 2Z08A 4IJKA 1PWXA 3VR5A 5CT6A 3JD4A 4L78A 5CEFA 5LLDA 1SZPA 4NCIA 1YE5A 3U39A 3FPJA 4IDPA 2NVWA 4O25A 3VDNB 3P5SA 4OMDA 3WBKA 4NZ9A 1GG9A 1UEIA 1B6TA 2IHVA 1YJAA 2PLWA 2Z3VA 3D2LA 4Z4HA 2OGUA 2Y8EA 3DAGA 1F8GA 1U5CA 3AP3A 3SJCA 1Y7TA 2BFDA 3RAJA 1W0KA 4DR4B 4J16A 4WN3A 3BHIA 3OFVA 2IBMA 2IP4A 4OLJA 4QM7A 5AM0A 4TMWA 1MG0A 5K6AC 4FYKA 1IN8A 4NMMA 3U19A 2Z3WA 1YOVA 2WK1A 3IIMA 4DA4A 2B4TO 3F3MA 1JHRA 5E2IA 1B26A 2W6ID 2EKDA 3VR2A 1W46A 3KETA 1ENPA 1ULTA 1L7MA 3BXPA 5LQCA 4RWEA 2UUAB 4Y2JA 3VKVA 2XIQA 4IHQA 4YAEA 4ZVKA 3SEZA 2Q6TA 5G1OA 5K0JA 3G8BA 5KJCA 2GEUA 1VKRA 1Z7YA 4OEHA 1ZM2A 3V7UA 4ETMA 2YVUA 3TLMA 4Z2YA 1X9IA 5FQOA 4CLEA 3S2YA 1C3VA 3HADA 4KR3A 4NV3A 3DTYA 1S8AA 2QSUA 3AM5A 1REQA 1PR5A 3KKKA 4CHTA 3KB1A 3VBCA 4MA5A 1JHQA 3LCUA 3PHGA 5TB5A 5TMDA 2B7LA 2WTEA 1ZU5A 5TT0A 1JG2A 1WTCA 2A5DA 4GICA 2QN8A 3JSAA 4N48A 4TV8F 1N0UA 4HX2A 5SV2A 4Y7DA 1PX2A 1UBRS 3TTWA 1XD9A 4II7A 4GI5A 4RTMA 2OFWA 4UM8B 3F7MA 2IEBA 2R66A 1IWOA 5F77A 2QN2A 1ZHFA 4MICA 2PGDA 1ZNQO 1SVIA 4B48A 3MYYA 2ATVA 3DE0X 4C5BA 3QLUC 3ACCA 3CMCO 4Q3BA 1GUFA 1YJ5A 4MUKA 1NUSA 2FN8A 4RCVA 1IAQA 2EFGA 3I0NA 4Q16A 5HZMA 1NI3A 4W6QA 1VLLA 1PEAA 3CM0A 4L51A 3AI2A 4OQ4A 2EYQA 5EP4A 3GLIB 4DGSA 1L4BA 1SOUA 3IMGA 5I9IA 4GL4A 1FXWF 3B6IA 1SAYA 4HDAA 4P38A 1GUBA 1IVYA 3C74A 1UADA 1KJQA 2D00A 3OJLA 1HKUA 3OY7A 1G6KA 2V0NA 2NSHA 3V4SA 4XFKA 1YB7A 5D2CA 1IEWA 1AHPA 1DHTA 1RAGA 1WD5A 3C6BA 1RFLA 3DLAA 3F6PA 3GN1A 5CVCA 2V8BA 4RD4A 4YUWA 2WOJA 2K87A 5TC4A 4C3ZA 2JW5A 4RFLA 5ALSA 3SYTA 3ZZUA 3WDSA 5LOVF 1JLLA 1PTJC 3G85A 4IHJA 1R0LA 1J0XO 4N0PA 4QPCA 3R74A 3UHJA 16PKA 3P8ZA 1XCMA 3BICA 3ZU3A 1CRZA 2PYZA 3DC7A 1NW5A 4LXHA 1A8SA 3NP9A 1ULHA 3AHCA 3EPPA 1JIXA 5D3KA 3ZQKA 2FSFA 2MDTA 3BWYA 4M0MA 3SVZA 3OX3A 1T4CB 1TC2A 4PAQA 3VYVA 3CN7A 3BIXA 3IUEA 1I3KA 4NEQA 4RD3A 2H06A 4FX5A 4MLZA 1FRQA 1WD7A 3NWOA 4LYEA 4MTLA 4Q39A 5FOVA 2OXFA 5TMEA 5G0WA 4HB3A 5CNIA 2R6FA 4RD1A 2O48X 1JQBA 2LZ0A 4BLOA 1RI5A 3EY4A 2CJPA 2FR1A 4COKA 4DA6A 2GT1A 2PLRA 3TTVA 2F8TA 4C7XA 2ZSKA 1GPDG 2DF8A 1NF8A 1JILA 2X3UA 1JB1A 2PY6A 3LLUA 3PHJA 3QX9A 4XTRA 2XLBA 2H1HA 2ZBGA 3KPJA 3MW8A 4C4OA 5H4HA 3W5CA 1RQNA 1L7AA 2R5WA 3QA3E 3B48A 4W63A 1W2HA 4ZAZA 2FSSA 3TQHA 4K46A 4F6CA 2RIRA 1CE8B 4IIJB 3HACA 1XR3A 3SF8A 3E9QA 1A4UA 3GJ0A 2BR3A 1BDMA 3KJGA 4GI7A 4V0OA 4D9FA 3ERCA 4PGGA 3CVJA 4MO2A 2P4UA 5FBHA 2BFFA 3D59A 4K26A 1E7MA 4MA4A 1IOZA 2V9PA 3NT5A 4RY2A 1YBMA 3LHDA 5A71A 1D9ZA 2BMVA 3STHA 4E1VA 1K9VF 2EGUA 2J33A 3PSHA 2ZRAA 4V2IA 1TDJA 4GP9A 1E7SA 3HLYA 3P32A 1F4VA 3HWX1 4UEKA 2Q5FA 3NHLA 3SM3A 4KO1S 3MVEA 1IMJA 2IOFA 2R4UA 1GT6A 4Z8YA 4E5YA 3Q3HA 4FFOA 1H05A 2WLSA 1XQ9A 5JAOA 2VSOA 4L5YA 5CXXA 1IDOA 4E88A 2ZIFA 5B5SA 4XQCA 1T4DA 2RHBA 2C4KA 3BX1A 3KYCA 3AQ4A 1FK8A 3LW7A 2W6CX 1OBHA 3PC6A 2BFDB 4FR5A 4P7GA 1G1AA 2HQRA 5DSTA 5EP2A 3R7BA 4GLOA 4GH5A 4DIEA 4WACA 1E4EA 2HWYA 1WV1A 2QN1A 1KWKA 1H6CA 1YCDA 2X86A 3WVNA 4BMOB 5C9ZA 3KUUA 4IIEA 1WULS 3CLSD 4TN5A 4F1WA 1X94A 1TUBA 1N6IA 1M66A 4PANA 1CUDA 2P7IA 1ZJ6A 3ZD7A 1PE0A 3M6VA 3NJ8A 3BILA 1PZGA 1JSRA 4DV0B 2BEUB 3NTUA 4M7PA 2A7QA 4C6SA 3FNGA 3HVUA 1KZ4A 3K0BA 2CXQA 3S7TA 3F4LA 4N3BA 3RWMB 4CMIA 1CY6A 5JHGB 2AOXA 2KLHA 4NMHA 4C20A 3H5WA 3ZE9A 2Q4DA 2LGJA 3SQDA 6YASA 4WOPA 2PKEA 4B45A 3VR1A 2WJVA 1S0UA 1RYYA 3B7GA 3FKSA 5IJ9B 3A25A 5ENDA 4BO8A 3I2JA 2C4HA 2G83A 3B1WA 1JLLB 4ARVA 3TLAA 3UWOA 5FOQA 1IQPA 2P9BA 2FHPA 3B12A 1MLDA 1YRLA 2B0JA 3GAFA 4G07A 5CCBA 5EJ4A 1NY5A 4MVCA 5TE9A 1G3MA 2WE7A 5K4AA 2CV1A 4LNHA 4M54A 1W5AA 1KEUA 2WPDA 1U2TA 3V32A 4EKIA 3DV0B 2QRKA 1YKGA 1Z56C 1EDDA 2ZT6A 1VKNA 1PK7A 1SHZA 4X3PA 3U44B 2CLCX 2OKCA 4C4PA 3O8RA 4MKGA 3ZWDA 4LZJA 5DIZA 3U7HB 1PJ3A 1XVAA 3WLKX 1ZIXA 4TUYB 3CX7A 4JA0A 2BDTA 5GOTA 1Y1LA 3MXOA 1WXXA 2VP3A 3M3DA 3GUCA 1W0JD 3R41A 2EJCA 4MCAA 3UA3A 3ZBQA 2C7OA 3GDOA 1DQYA 4YUYA 4DRYA 1JA1A 4OHZA 2C9BA 4CLHA 2SNIE 3IIJA 2FCRA 3SJUA 2Q7XA 1ZH0A 1FEZA 2Z4TA 3CNOA 4DYHA 5IXSA 1NG9A 2PMCA 1WSAA 2PWPA 2PZFA 5EZ6B 1IJBA 2PH3A 1N34B 1E1RD 1VPLA 1B00A 4F2DA 3S6JA 1ADJA 2MSNA 2ZIXA 1B8OA 3GW8A 2A3RA 2CXRA 3VKHA 3CPSA 1OLSA 5IYZA 1ID1A 1XMJA 2KB0A 1GNQA 1STOA 1D04A 5BN3A 3OZ7A 2IDZA 3RS3A 4O29A 3A9CA 1THMA 2P9QA 1O87A 3ABQB 3EK2A 3V3KA 3V8RA 3ZEAA 3DP7A 4DEVA 4HB4A 5HJ7A 1U04A 3H1TA 2H48A 5J2UB 2DUMA 3PDIB 1NMEA 1M6VB 2NUTA 2W7TA 1UMBA 4ESEA 3MMXA 2IHBA 3AFNA 3SDSA 4F2WA 2HLDD 3T4PA 2AMYA 1YCFA 2HCTA 3OOJA 2ZYVX 3QE2A 4HDKA 1CYDA 1ZGBA 2ATCA 2Z5VA 3Q7QA 4V0MA 1ZQ9A 2OHJA 3PF8A 5DFAA 4F5EA 3CJTA 2D1YA 4C2AA 1QOQB 3DDNA 3FDJA 3A3NA 1PNOA 3W78A 3E8SA 2FOXA 1Q17A 4I6EA 1I4EB 1U7OA 4JA2A 5BN1A 4PCLA 2PJDA 2QRGA 4MCJA 1XELA 1E59A 3GEDA 4PFKA 4QU8A 4U5XA 2ZB8A 4PNZA 1EP3B 1FMJA 1UANA 2BGLA 1O2DA 2NSDA 2QF7A 4ARBA 2A9KA 4B0OA 1NY6A 1ISGA 4CMEA 1ESMA 2R1VB 1ATIA 1DG1G 2G4CA 3QPAA 1GA4A 3ZE6A 8AT1A 1QPBA 1I24A 1I51A 3DBVO 3H8JA 1ZM9A 2IYLD 5L4SA 1M0WA 2VHEA 3QH4A 3U37A 1JLKA 3SG0A 2Z6VA 4V02A 3LCCA 4BBAA 5TVKA 1SQFA 4A10A 1LI7A 1JJIA 1M34E 3L06A 4FFWA 3EPJA 3AUUA 1QGZA 3I6MA 3SYLA 1DRJA 3LCRA 3RSSA 2JVJA 1PS8A 3WI7A 3FWHA 4EPXA 5CB6A 3TZKA 3BD8A 2QLTA 1PYDA 3C3AA 4OFXA 5FT9A 1T1IA 5EPOA 1J0BA 3FIJA 2O2HA 4I4IA 1W76A 4L3OA 4OQEA 1USKA 4EGCB 4XZ3A 1DBQA 4BO7A 1CB0A 4AXBA 4POAA 4AIRA 4RTLA 3W1VA 5JZSA 3ANTA 3AIKA 3PHBE 1JJ7A 5G4LA 5CHYA 3ER6A 3GRCA 3FCUB 2X77A 4AWAA 1KK3A 1P8JA 2EC5A 2IVZA 3V8MA 1C9KA 1EEHA 1D5WA 1XPUA 1BS2A 3I2IA 5DWVA 1P9RA 3LA6A 4XRRA 1PG2A 5LMCA 2PZKA 4P3PA 1ZD2P 2W2TA 2ZYDA 3NB0A 4HDRA 5KQLA 5TEVA 1J0AA 1I36A 2PR2A 1IWBB 2XKAA 3H4TA 3GAMA 1Z0SA 1HMPA 3P9XA 9ABPA 1CR0A 1JDUA 1DFGA 2XWBF 2DUWA 3PNVA 1NQTA 1OFHA 3GJYA 4JOBA 4S1VA 1OYYA 1P7VA 1PCXA 2TMKA 1SXJB 1ATZA 4HFMA 5KYTA 2JIBA 4J07A 1EG2A 4IIGA 4L57A 1UKYA 5K0GA 2YRWA 1X2EA 2A1UB 3H0KA 3OSUA 4WZZA 3T7EA 3UBTA 1SC9A 2FRDA 4G24A 4M21A 3TAXA 2IY7A 4OJKA 2VBIA 3FJOA 1T3SA 5LMNB 2Q4RA 3PPWA 4NCNA 2OENG 1RI4A 3BQMB 1SN7A 3DF7A 1GPJA 2FY8A 1QIIA 3ZDZB 1HRDA 1FSGA 3GQBB 4D4MA 5JSHA 1V9SA 4BLPA 4IKPA 3RRYA 2C0PA 3H83A 4AN1A 1NLYA 3KQNA 1BU8A 1OLXA 1AZWA 5P21A 2B83A 3X1WA 3H8WA 3EXFA 3GBSA 4GP6A 4LAFA 1BJTA 3DAFA 1T2FA 3M49A 1CZNA 3FPAA 3ONDA 4QDUA 2F1JA 2XHZA 4YX9A 3WWPA 1YRQA 3AVOA 4P53A 1JHYA 2VF5X 3AV0B 3CH6A 3HVHA 3I9FA 4H0CA 4LJSA 1K5GA 3L8FA 1T8WA 4QQFA 3CN9A 4RVOA 4AT1A 4MQFB 4TL9A 4XGQA 1LS6A 4DWVA 5A2GA 3EVCA 2BBWA 4O08A 4YMVA 1OI7A 3FOBA 3OFJA 2XMRA 1U1IA 3DZIA 5CT5A 2FA9A 1D8TA 1IMOA 4FFBB 5FBKA 2WSIA 3DEJA 4NFHA 4Z3DA 1NVBA 5J59A 3GRVA 3HPRA 1LPMA 4H1VA 3SXUB 5EYPA 3TOXA 3VC7A 3QVOA 1F2DA 3AF4A 2HN9A 3HYRA 1ZXXA 4PYNA 2RAPA 4DOMA 2KX7A 3LJKA 3TSCA 2EFDB 3FWPA 3EVZA 3DE7X 2YS6A 4LHXA 4H3HB 2JGMA 3ADBA 5A62A 3NONA 1PJCA 3AY7A 1FLNA 1ZN2A 1KBZA 1WKBA 3OFND 4O3FA 1V8DA 2JFUA 3SYNA 1BJKA 1FDWA 1I2AA 1HE5A 1P7YA 1ZVMA 1QKIA 2IXDA 2YHSA 2YRXA 4IYRA 5CBPA 1TTHA 4J1SA 1DWPA 5J1TB 2E4ZA 3I6ZA 1JR3E 2CYBA 5DP2A 4B31A 2QM0A 2Q45A 4AKSA 4ECEA 5IM4F 4IH1A 1H4TA 5I3CA 3ZJYA 4H0NA 4CG2A 4OL9A 4UBLA 4JGBA 1XTUA 2CBXA 4Q3EA 3ZDCA 2Y9MB 2DPYA 1A27A 3HGQA 2I4OA 3H9GA 3CRMA 4JLOA 1O89A 1M2WA 3QVSA 5C5IA 4YBZA 5D5HA 4HL6A 4MGEA 3TS1A 3OU6A 2W8BB 2GCNA 4OP3A 2DBZA 4AUNA 3GT0A 4B8YA 1IC6A 1AQNA 1XMOB 2CXTA 4Q66C 1KC3A 2GXAA 2PUBA 3ZGXA 4DMGA 2X0RA 3OIDA 2ACEA 2CHVA 1SB9A 2XNSA 3JU3A 2NU8B 2E89A 3GV0A 1Q7EA 4PYRA 4XUDA 3LT1A 1OKKD 6REQA 3L1IA 5BV7A 4WCFB 3D7MA 1MAAA 3G8YA 4X7BA 4RVGA 1QX3A 3F97A 4YRJA 1JWAB 3IXLA 1FP7A 3EDCA 5BT8A 4WLEA 3PXGA 5AUOB 3I9V6 1JSZA 2I2AA 2VP9A 2WM8A 1KI2A 3AJ9A 4IZOA 4LBWA 4D74A 2RHTA 4I46A 1BMDA 4PQFA 1T36B 1C9NA 2CL6X 4FSXA 4AMGA 1L6IA 1DX9A 4MW0A 5KYYB 5BSHA 2R8YA 4B73A 1GSAA 1VQ1A 4QFBA 1WCWA 1C0IA 1XMXA 5I7HA 1RSZA 2X15A 3S5JA 1N5LA 3PD7A 3QI7A 1ESNA 1O58A 3TLBA 3RVRA 5DT2A 5E2BA 3DZFA 3IAS1 2ZPAA 5C31A 5YASA 3EXFB 4CKZA 2VI5A 3RSOA 3PT5A 3HEMA 4YFYA 1ABEA 4PCVA 3V4OA 4PZDA 3C70A 1NVAA 1NL3A 4RL6A 1QVVA 5ICFA 3ZR4B 5CDTA 3ZH9B 2I3GA 2Q8QA 3GHHA 3HSKA 2AFRA 3I09A 3RSHA 3GVIA 3HVRA 1IBSA 3MBOA 3A2KA 2L0XA 1WM1A 1E9VA 2WF9A 1L5MA 2FMFA 4MV6A 3H9CA 5BMVA 4RY0A 4JP8A 2C7RA 1IOLA 3NYWA 4CW7A 1YF3A 2PEYA 5KYNA 4CL3A 4XX0B 3P0IA 5K5EA 1SOMA 2BFWA 3MJSA 3K1ZA 3QMPA 4HSEA 3E61A 1WWKA 2CDNA 5DM60 5JC8A 5GIOE 5K3EA 3PDUA 3GFOA 5GY7A 5B53A 1FDTA 1P2FA 4HI0E 1U8AA 4B3DA 4CI9A 2FWPA 1NJ2A 3KQSA 1KE1A 2H52A 4NOKA 4ZWNA 4C4XA 2GWHA 1T26A 5TRTA 5H9WA 3BWVA 3N3BC 1QNFA 3B3FA 3CPEA 3DYBA 1LRJA 1TW3A 1UDRA 1X80B 2IDMA 2EP5A 4TVKA 3OLQA 5CT8A 1MB4A 2H85A 3QTBA 4YV1A 2ES4A 1Q7GA 3KZMA 5BWOA 1J9ZA 1SC4A 3D7NA 3FPFA 1EZ1A 1QHXA 1BEUB 2EHJA 2O3TA 4D92A 1AQ6A 1GQOA 1POXA 1XHLA 3BH6A 1YC5A 4GM4A 1ENYA 4NCHA 1RPNA 1NQAO 1PHPA 2PXAA 4Q01A 5G02A 5AXBA 1CEEA 1HXHA 2FEMA 5GQSA 5HMMA 1H66A 3TM5A 4CEHB 3L2OB 4Q3OA 3I8XA 5DHTA 4EO9A 4LYYA 1UJ5A 1HK7A 4REQB 3S2SA 2GVNA 1M6EX 3L6EA 4PGAA 3V7NA 2GAIA 5KSZA 5KTOA 2NWQA 1QPGA 1BDHA 5DGDA 1AKQA 5LU9A 3RS9A 3WGYA 4E13A 2JJ1D 1SZJG 1N9GB 4OBXA 1DQPA 4P5PA 2J9FA 1QTQA 1EVLA 2XGJA 5AVVA 2ZCVA 1UQTA 1Z2OX 3NUZA 3GLFE 1XU9A 2EFCB 4MW9A 3UMJA 2I3DA 5AM4A 4E2FA 2OXRA 3R0QA 2UKDA 4FIZA 5EHNA 1ODFA 4FJ2A 4UVGA 2A9OA 4K86A 3ZIUA 1JKJB 5F1KA 1DBVO 3CF0A 4QGGA 3SU8A 3UENA 4C4TA 1J7JA 2F9FA 4ZTUB 5DCUA 4ZKDA 5KYYA 1GM5A 1TYAE 3MTDA 1VGRA 2COEA 3JYLA 4LQ4A 3U40A 1KRWA 2PMEA 3PXDA 1Y9ZA 4X1YA 1RM0A 3LBNA 1VE6A 4LNUA 2FPGB 2OPBA 3IAFA 1SXHA 2QAIA 3Q7PA 3RUHA 4G0PA 2CXOA 1SCDA 4X63A 5HZKA 3C24A 4JL6A 3IUBA 1MJGA 1QYIA 3I12A 3IAAA 1CRWG 1NVUQ 3LCMA 3LX6A 3WDMA 5CBPB 2RGAA 4MROA 3QPUA 2FW7A 1G42A 2VRCD 3DM9B 1Z8FA 3CT6A 3HNOA 3HRIA 4C01A 2CFRA 3EGIA 4XCVA 4NAVA 1YHNA 4RD2A 2Z9BA 3OHPA 3KXLA 2PAFA 3NEYA 2G09A 5BP7A 1F9AA 1D4ZA 2OD9A 3RTCA 1ISPA 3N53A 4Y6RA 2JIMA 1CP3A 4GMKA 2V59A 4F5ZA 3KSBC 1HWYA 4DT1A 2VIIA 2QRMA 2HD4A 2XGOA 4BVFA 1PN3A 4I1SA 3ER8A 5DNYB 4JB3A 2P6OA 3ZVNA 4W5HA 2B1QA 3FMFA 1OC2A 4DTCA 4I9FA 3JWHA 2OT3B 3PUJA 2AVDA 1K6XA 1Y5NA 4K6FA 2AFIA 3RYFB 4X7PA 2R1ZA 1E92A 2ZRFA 2QE6A 2CVPA 4IDGA 4GMFA 1OGYA 2IXGA 2IITA 1Z5ZA 4FLEA 2WFLA 1CXZA 2VG8A 3I0MA 1FTYA 1OFTA 2WWIA 4J7AA 2IYEA 5CVEA 2O8FA 4EJSC 3RS8A 3KZXA 1EZ4A 4BNYA 4CUZA 1X42A 3KZ1E 4DNPA 2IUUA 4OP2A 3DLPX 2FN9A 2MYTA 2WDPA 4I9HA 1NN0A 3A4NA 4D9GA 3KYCB 1O77A 3MCWA 2QAJA 1CQJB 2BL4A 4IS2A 2P5TB 2ID8A 2XZDA 4UMEA 1HDZA 1L5RA 4JB2A 1BHQ1 4TM8A 5EGSA 4BV3A 2P2GA 4IL5A 1UODA 4MS4A 4IW3B 5A03A 2YMQA 4IDQA 2WRZA 4IRXA 3M34A 1O95A 4AUMA 3GCZA 1O4VA 1NLZA 3CF4A 1W88B 3BRSA 3S8EA 2UU9B 1A8PA 1G19A 3UV7A 2ZTSA 3LC0A 2EL7A 1OXTA 1QF6A 3K4HA 2ZLBA 1RLUA 3VAAA 4S0XA 2X2EA 2VF4X 1L4LA 2ZYTX 3CZQA 1T2DA 3SBXA 5DCLA 4I1PA 1NVKA 4JJ8A 4A8JB 4YR9A 3ANSA 4GI1A 5AJTA 2VDWA 4CPDA 2IYZA 3C8DA 3I9OA 3R09A 1FOEB 4HC4A 5EG5A 2WD7A 3IESA 2V8OA 2WWHA 5DN6A 2B8TA 4ARSA 1F0NA 4YDRA 2BUAA 4AZSA 5A4FS 2ABWA 3E1GA 4K5QA 3JAKB 5ICEA 1N75A 4F1KA 1IATA 3HB7A 2Q2VA 3DEYX 2NZ2A 4N01A 2ZCUA 1XZHA 1CNEA 4CLOB 2XXBA 2QU7A 1KK0A 4GR4A 1ZR2A 1G3IA 1L4YA 2Z8XA 1V8ZA 2HJSA 2JGDB 1C1YA 4NMLA 3S81A 3T3GA 2B4YA 2I9KA 4PWZA 3KFLA 5AOBA 1HMYA 1X7ZA 3KKQA 2IOQA 4CMKA 4BYGA 4DDKA 4OOFA 4LHYA 1WBJB 5AHWA 5IDXA 2ADMA 3BTSA 1DKLA 5JAQA 1Y1RA 4CKCB 4X6XA 2ZE5A 4ZMRA 1EDBA 1GFZA 2CK3D 2ZAGA 3HCFA 3GHYA 4FKMA 3T1HB 2CZQA 1L5VA 1O5TA 2Q8NA 5C1IA 2IYXA 2K7FA 4R84A 1N2EA 1G21B 4JASB 4MJLA 1KETA 1Z2AA 1HYEA 4IVNA 3WLRA 1LX6A 1OFVA 1XF9A 1ABBA 3IEXA 4OJQA 1SU4A 3U4CA 3KCNA 2GLXA 3W06A 2FUG1 2Q4OA 3QKIA 4JXJA 4UMDA 1Y3FE 1J70A 2GRUA 4CM9A 4E2YA 1U7TA 4QULA 3PL1A 5DTMA 4QLBA 4YT4A 1SKQA 5K03A 3MEQA 3L8ZA 3ZWWA 4OYRA 3DT6A 4KQGA 1AO3A 2CNNA 3WIUA 3N76A 2P1ZA 4Q02A 1VGVA 4JEMA 4ZQFA 2FFBA 3PXEA 1PD1A 3PEEA 2PLNA 1SEPA 2DR2A 4QBHA 4TUYF 4FGUA 2G77B 3IAUA 4QGHA 5C53B 4TTRA 1P60A 3UJNA 1SXGA 2C5EA 3SHTA 2YN2A 3FPEA 1D3AA 5JCXA 5KNDH 2O8FB 1N2XA 4M1WA 1YRWA 2A1TR 4RZHA 2EERA 4I55A 5IZCA 2WSBA 1PNQA 1T3ZA 4RIFA 4H27A 4X5OA 5BUSA 4E08A 3U7JA 4B83A 8ADHA 3O73A 1H94A 3FH0A 2QTLA 4IBOA 4MIKA 3NTXA 5DASA 1B2RA 2CFOA 1UC8A 2FPGA 3H6HA 2N46A 3DVQX 3MAGA 4P4TA 1JG4A 1S2GA 1TCVA 2JC3A 4Q12A 2G72A 1KR2A 2YFYA 3GLHA 4Q9KA 1BRTA 2P68A 3LQYA 3THWB 1VG8A 4J7XA 5BSVA 4Q1FA 4RNCA 4L4ZA 3SC6A 1CERA 1PZXA 5KWJA 2Z6QA 3ZCRA 3E8XA 4ZICA 2G08A 3TSZA 3DMGA 1VJRA 3GJZA 2ENWA 4OGGA 3SOPA 3LSTA 2ANCA 3N70A 4GI2A 4LF5B 2G88A 1KK2A 1SIBE 3F78A 4BNJA 2YZ7A 1MVNA 3RHSA 2P9EA 4F12A 2RHLA 1PJSA 2WF5A 2VPQA 5B4VA 1GZHB 1BVRA 1A4RA 3VPXA 1YZ3A 3BGOS 2W6ZA 4N39A 1KARA 3U7IA 1J7KA 1TB4A 3EAGA 4MRSA 1EVEA 3I04A 2ZJ8A 5BYKA 4AO6A 4Z54A 3NHRA 3PL5A 4PC3A 5AJHA 1ORHA 3P2IA 2K2WA 3FXAA 3RDPA 2XGGA 4FGLA 4TV8A 3TL3A 1A8HA 1LVGA 1MB0A 4UD2A 3COVA 3LUBA 4LE2A 5EXPA 5KREA 3GNLA 2GXSA 2PVSA 2VDOB 3QUSA 3PRKE 1DCFA 3BSSA 5I6DA 5LIPA 1KMCA 1NVTA 2HSEA 2C57A 4OV6B 4XH9B 3STYA 4ZYYA 2QUZA 3H0CA 2IHJA 1RHJA 2FP4B 3B51X 4XVCA 2V3VA 1O97C 1E60A 1B74A 4JQZA 4BKQA 1Z0DA 3IVAA 1UDAA 4RFVA 4BNDB 1IBLB 2W8ZA 1NSFA 2OK7A 2ZSHA 2V96A 1M2VB 3KEQA 3WDKA 4EARA 4QPNA 3JATA 2WHPB 2X5OA 1QZXA 1G8MA 1BKSB 5A5FA 4OYHA 2YQ4A 5JJKA 1Q57A 1P7WA 2J45A 3HJAA 3WLHA 3RTDA 1QE3A 2HWKA 3C6KA 1VMAA 2PRYA 4V1CI 1WY7A 3ZIAD 3EIFA 3MWFA 4M38A 3D0QA 4NFYA 2GEBA 2M1XA 3GJTA 3I2YX 4QZVA 3EEFA 2DUUA 3BE4A 4J94A 3F5SA 4GPEA 4WLOA 2J08A 3DP9A 3LPMA 4MJ3A 1K6IA 2RJNA 1FFCA 4LOKA 5K0EA 1B1AA 4ZQGA 4C3VA 1QK5A 5HS6A 1H8EA 2ECPA 5BYJA 5T3UA 1JIKA 2YHIA 1R5OA 2YOFA 1ZONA 2R8BA 3G9ZA 5AR1A 1L4HA 1C8LA 5LA6A 3KUKA 3T1YB 3W5IA 3CV3A 1ZX1A 2G8LA 4DC0A 3FUXA 1ZMXA 2GRAA 3EN0A 4GR9A 5G0SA 3GPDG 5IJWA 2Q3MA 5AIBA 1CJUC 3O84A 4CKCA 5J5VA 4U6NA 3RIEA 2ZTVA 4GP7A 5JU6A 1PYOA 1Q83A 4GO1A 5IVHA 5DI9A 2YY5A 5A0FA 3BVPA 2HAEA 4M49A 4O0LA 1ZD9A 4PGMA 3KS9A 3M81A 3DFZA 2IS6A 4ZKEA 1W4BA 1Z36A 4I1YA 5CP8A 4RY8A 1XROA 3SXUA 1ADCA 4B3BA 1EAMA 2Z9DA 4ZO8A 4MSUA 1MC1A 1BMTA 1U3FA 2XMPA 4EGSA 2ZSJA 4DDHA 3NBMA 4XJVA 1JQ3A 1SBQA 1NURA 1ZN7A 1PJQA 2FLVA 4IOKA 4YCAA 5AVUA 1U0BB 3GRUA 1CUUA 1ZOIA 1CE8A 3EZ6A 4JJFA 4RTQA 2RE8A 2D7CA 3SGLA 1XZMA 3JVDA 2WYUA 2BGJA 2FUEA 3DKVA 3PCTA 4EFNA 2O2YA 3E84A 4K8RB 4M83A 4MZXA 4TMXA 4WEQA 2WG1A 1WP4A 5KAPA 1TEZA 2RHGB 2G5TA 2P75A 1J07A 2ZAYA 1PUJA 4HN9A 1DMSA 1VPTA 5LL6P 4KXYA 3PP8A 4YASA 1PDWA 3OZVA 5ALNA 1Z3IX 5FO1A 1WS6A 3CKYA 3GLVA 1EFDN 1LLFA 1YS7A 2PCJA 4OFWA 3L1HA 4Q1AA 3IXMA 4YGXB 1U0LA 1S2IA 1OH7A 2WJ4A 3OLYA 4IP0A 1WSWA 3RYIB 1SBNE 4X41A 4I9NA 2G1JA 2HQOA 1TAGA 3AHFA 1SCIA 3TRJA 2JCXA 5EUQB 4L4RA 4NMXB 3UH1A 4XSVA 2G9RA 4PLFA 4ACAA 3R75A 2VJMA 3T35A 2QV7A 3HDGA 3RIXA 4QT0A 5LKRA 5KQGA 2IHNA 4FE3A 1HQCA 2N0SA 3UKDA 121PA 1P18A 2IYUA 1ORVA 3IAHA 5J5CA 5B57C 3QPWA 4C0JA 3A0RB 3N74A 1X86B 2I91A 4RZ3A 3NXKA 4IVRA 5ESXA 3PNKA 3HFRA 4NBNA 3NHWA 1JDBC 3BFXA 2CFIA 5JJCA 5AVOA 3WLJA 2EXXA 1JU3A 1T0IA 3GGSA 4HGQA 4JC8A 1RYHA 4O4IF 1VLMA 3IEMA 4BPRA 4RQAA 1R0CA 3AW8A 3HKEA 5EZYF 3U7GA 5BQPA 1WUKS 4YMSA 1QDEA 3UWDA 5T67A 1PW5A 2O8DB 2BTQB 3G9TA 4IM7A 4YIKA 3ROMA 2A2ZA 2XQVA 1PS0A 1D6JA 3PCRB 2CLMB 3ANXA 3AUFA 1E77A 3PUZA 4JIMA 4BNFA 3P0EA 4RORA 3RVBA 6PFKA 4XWWA 1TO2E 1KTIA 3UWKA 1DQRA 5I3ZA 1JYEA 2YICA 4L9SA 4OB6A 5EWMB 3O4HA 3PNLA 2P6PA 4G26A 4G9EA 1PVDA 3DL4A 4BE9A 1BXZA 5AKHA 4DE5A 1NUUA 1VMKA 1HQYE 3D31A 4RTOA 3V5NA 3ECCA 1Y80A 5E95A 5TPZD 1PVVA 1P8AA 2IJGX 1JHMA 1QH1A 2P2YA 1QHGA 3B2NA 5JSYA 5INTA 5BWNA 2BKVA 3P4XA 2CD7A 3QE4A 4WKPA 1Q1AA 3FNHA 1Z29A 1H1LB 4PPNA 1KZ9A 4EFMA 1QJCA 5LP6F 3QWHA 5EXTA 4GOKA 3RRNA 2ZIXB 3ELDA 3FFBA 4DMLA 5CXUA 2QMOA 4HUTA 1H3FA 1OLSB 4L8YA 3NMUF 1SULA 3IODA 4GOOD 4Q4CA 5LLTA 3O2SB 3P1JA 3VR6A 4X24A 2TS1A 3WJ7A 2CVZA 3HU2A 4OOEA 3BD6A 4DBZA 4O4LF 3BE8A 3OKCA 1P73A 2LTAA 2RB4A 1XX6A 3QG1A 1X7WA 4X3CA 4BMXA 5BR4A 5CJPA 1XAIA 3WAGA 4CV3A 4Y2SA 4KRYA 3NCHA