5F1KA

Human cd38 in complex with nanobody mu1053
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
248
structure length
244
Chain Sequence
TWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGGRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
publication title Immuno-targeting the multifunctional CD38 using nanobody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 80
structure length 244
sequence length 248
chains with identical sequence B
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 5f1kA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5f1kA02
4GGPA 4I5GA 3WYEA 5A06A 3W4JA 4O63O 4UAGA 3DHYA 2WM3A 1Y8QB 2CMDA 2Y99A 2DT5A 2O3SA 2P4HX 3JD2A 3WSVA 1T26A 5JY1A 1C1XB 1E1MA 5L7YA 2DPGA 4CMIB 1XU9A 1NVGA 1ZCJA 3BYZA 1AUPA 4JJIA 4BO3A 3DEYX 1FDSA 3AM4A 4Z3DA 3VZSA 3NEPX 2B37A 1NQTA 4TRMA 2P68A 3KSUA 1UUFA 3RUHA 4IXWA 2Q50A 2VUSA 4YVFA 5FYDA 1I01A 4UVIA 4YR9A 4CM4A 3INRA 4IINA 2BMAA 4B4UA 3ADOA 2E82A 2R00A 1SZJG 2EJVA 3JQ6A 3GVXA 3WBFA 1DB3A 3GEGA 4UULA 3AY6A 1B8UA 2EKLA 1YGYA 3UN1A 5I9NA 5FFFA 1HRDA 3C24A 4J2OA 3P7MA 2PGJA 2Q45A 1PQUA 2P5YA 4J1NA 3LSYA 4XR4A 3RCBA 2PY6A 3IJRA 4XQGA 2EG9A 4HNHA 1Z7EA 2DUUA 3GVPA 1UJMA 4DC1A 2DU8A 1LRLA 3LZ6A 4P4GA 1PL8A 4GQAA 1X7DA 2VTDA 3MJVA 1N1EA 5T5QA 4GL4A 4BB5A 5A04A 1I36A 3PQFA 3DOCA 4RGBA 1LI4A 4RCVA 4INAA 4IZIA 4L4XA 4AJLA 1I2CA 3L6DA 1PR3A 1ENPA 5AOVA 2BGMA 3IQDB 1DFHA 1QYCA 2BFOA 4K9DA 1HKUA 1VL0A 1DIBA 1O95A 4GPD1 4YRDA 2O4CA 4DTIA 4CM7A 2B4TO 1R4NB 2O7SA 3UGKA 1NPTO 1GZ4A 3D3EA 2XPCA 2PZJA 4CMAA 2Q2WA 5GZ6A 4GX2A 4CM5A 2FHSA 2VYNA 1YO6A 4R68A 1LSSA 1BSVA 4ZN6A 3KYDA 4OKNA 3FF4A 4G81A 4YAJA 5IAAA 1BRMA 2PD6A 3H2ZA 5DF1A 1ZSYA 4OIMA 1EMDA 3ZWWA 1T2FA 1ZK3A 4IQ0A 1B14A 2QYTA 3SXPA 4CV3A 1U3WA 2BI7A 1JN0A 1XSEA 5EPOA 1NPYA 2YFQA 4J49A 5KKAA 3CMMA 1FMCA 3U4DA 4XRGA 2WD7A 3ZW8A 1E7MA 5THQA 2X6TA 3D64A 3GEMA 2CSUA 2Y1EA 4DQUA 2V6MA 4CLOB 4B4VA 5BSFA 5JYEA 1ZFNA 1MC5A 3RKUA 1IHYA 2D59A 4N54A 5EIOA 4PZDA 2IEDA 1SB8A 2X1HA 2UUPA 1M76A 4IZHA 3KB6A 2ZB8A 4BNNA 1NWCA 1GU7A 3AY7A 2QYSA 4BKUA 1ZJZA 2A94A 4WECA 4NBVA 3JQDA 4CUZA 3GNTA 4BNVA 3JYNA 2AG5A 3RBZA 4GKVA 4YJFB 3EZYA 4E2ZA 4PG8A 2VYVA 3PWKA 4D46A 1PGQA 3ZWOA 3OIDA 1PGJA 2EP5A 2AHRA 3JQFA 3ZNOA 4JNKA 1H6CA 4U8GA 4BGEA 4OXNA 3V2HA 3F5QA 3CTMA 1Q0QA 1DOHA 3GUYA 4XDYA 1JKFA 1P1IA 2VHVA 3DOOA 1DC5A 4R54A 3TQHA 3UAGA 5CDYA 2VWPA 1F0YA 4BMVA 3NGLA 3G49A 3HN7A 3GZNA 3C7CB 4LCEA 4UVDA 2IZZA 5C5IA 2FZWA 3INTA 3Q2KA 3DO5A 5DCWA 3VPHA 3ZHXA 1ISHA 3ZNPA 2GGSA 4IIUA 3CKYA 4NH4A 2Y1DA 1UAGA 4CLRB 2J3HA 4RDIA 3GAFA 4FCCA 1C1DA 1HYGA 1XELA 4ZA2A 1B3BA 5EMHA 4DXHA 1Z82A 5CAEA 3KXDA 2VRBA 4KDFA 2Y1GA 4ZJUA 1MUUA 4WE3A 4ZRNA 5CEFA 4UUMA 2BLLA 5BR7A 3O9ZA 2J5RA 4TQGA 3VC7A 1YE3A 5L40A 4NBWA 3A06A 3B1FA 4TWRA 2YDYA 3RFXA 4BMNA 1NX6A 1UP6A 1ARZA 4YAEA 3IKTA 1U7HA 4K1LA 3W4IA 3OIGA 3ZV5A 3FWZA 1T2AA 4XIJA 3SEFA 1DRUA 2PD4A 4LMPA 5JDIA 4RVSA 4B8WA 3RC1A 3LT1A 3GT0A 1NXQA 2HO5A 2VQ3A 4RO0A 1Z45A 4BNIA 4YJGB 4B7UA 1SCUA 2P9CA 3VPXA 3BMOA 1GQQA 3H9JA 2AEMA 4FSHA 1PJ4A 1ONOA 3NT2A 4XJSA 1WPQA 4NJMB 4XIYA 3GVIA 3AUSA 3G0OA 1LDBA 1JDJA 4U6SA 5ILGA 4EITA 3ROPA 2WE7A 3NV9A 4DLLA 5F5LA 4J90A 2FP4A 2VUTA 2NV6A 1ZSNA 1A5ZA 1QYVA 2RH8A 3BHJA 3RJ9A 4J91A 1Y8RA 3C1OA 2NQ8A 2RAFA 1YKFA 1A72A 1OOEA 3AUTA 4GMGA 1ORRA 2H5LA 3KSZO 3PLNA 5T67A 1YWGO 2ZTUA 4D44A 4Z9FA 4EJMA 4F6LA 3M1LA 2NSDA 1QKIA 4Z9YA 4ZVVA 3EK2A 4R51A 1ISGA 1TT5A 4G65A 2W4QA 3DDNA 1K3TA 3X2EA 4E3ZA 4Q3EA 5CG1A 3KYBA 5KNLA 1DSSG 3I6QA 5F1KA 2X4GA 3MJCA 4J1SA 4N5NA 2FPPA 1UH5A 9LDBA 4LK3A 4H15A 3H9EO 3H9GA 3ZDFA 1T2DA 4ZQFA 4Q3CA 4DQVA 4WOJA 1PQPA 2WWRA 3KSDO 4XWYA 5DOZA 2IEBA 4CL3A 3ICPA 1HE5A 1Z6ZA 2YZ7A 1O8CA 4BOYA 1C0PA 5JO0A 1C14A 4AJEA 1JKIA 2NU8A 1P1HA 1WMAA 2C7GA 3EVNA 3WDSA 1EUCA 2J8ZA 4JBHA 1U5CA 2Y93A 4C4OA 5G4KA 4WASA 2AW5A 3K31A 2P9EA 4YJHB 2VZ8A 2ILTA 3LF2A 4BKPA 2X0NA 4GX0A 3JTMA 3DAGA 1EVZA 2PNFA 3D1LA 4JROA 3TZCA 5IFLA 4J16A 5IDWA 1LLQA 1T1RA 2V6BA 4OJNA 1UZNA 4KWIA 2EWMA 2B36A 3L77A 3FR8A 1D3AA 2FPGA 1K5HA 1BW9A 1FDTA 4CMEC 4W4TA 3JQ9A 2OOSA 4GVXA 1ISFA 3HE3A 3GUCA 3P2YA 3ADPA 2I5PO 4FPXA 1BVUA 2OUIA 4MIYA 3HG7A 3P19A 5BSGA 3GN2A 5H82A 4MVJH 5A5FA 2ET6A 1AXEA 4DA9A 2W2KB 2ZB3A 4BO2A 3ETGA 3KZVA 3ZV6A 3AOGA 5HTOA 3U4HA 3OHSX 1ZBQA 4D79A 2DTEA 4ITUA 1NP3A 5K9ZA 3H6KA 2GPTA 5TJHA 1U5AA 5L45A 2ZB7A 2P9GA 5CEEA 3WTCA 1KVQA 2EW8A 2ZCVA 4NU5A 3U9LA 1ZH8A 2YV3A 5ER6A 2AEFA 1V3UA 2GLXA 3P5SA 4WKGA 3M1AA 2DC1A 2Z1MA 3O8QB 2DAPA 4OL9A 4E2WA 4CJXA 3BMQB 4NDNE 3CUKA 1WDLA 4R3WA 3NTRA 2OP1A 1RM0A 5JAMA 1VLLA 3NX4A 4NMHA 4OOFA 3AI2A 3I5MA 5THKA 3OSUA 3PJDA 4J2HA 2W2KA 1UXGA 3C7AA 1GUFA 5DCUA 3OIFA 3OICA 3RVDA 1MGOA 3TZ6A 2G17A 3PGXA 3GGPA 2GASA 2AQHA 2JHGA 3ONFA 3GDFA 4CV2A 2X5KO 4L75A 3UCEA 1WZEA 2JFFA 4AVYA 3I4CA 1AE1A 1PJSA 4NZ9A 3WGGA 1I3KA 1CETA 3FSRA 4XB2A 5AVOA 2X0RA 4YAKA 1HTBA 4ZQEA 2GN8A 3VPSA 2ZCUA 3PLRA 3GRKA 3CZMA 1FXSA 1ULUA 3FPLA 3ETDA 2UVDA 5TLSA 4W9NC 3I4FA 1V8BA 2HMWA 2CF6A 2PKQP 2NVUA 3LF1A 3WG9A 1LDMA 3V1YA 4QFCA 4IDAA 3V5NA 1I10A 4CLXA 5TIIA 1GTMA 1R4NA 2NU9A 3QWFA 5H83A 1KY5A 1EVIA 2Y67A 3I9NA 1BHSA 1GADO 3TOXA 4MVJM 1CWUA 3A28A 4DBVO 3NTOA 4UEOA 1EK6A 2X86A 4ZHSA 3H5AA 4KMSA 3LC1O 2YDXA 4J9UE 4XGIA 3LT0A 1VI2A 1XLTA 2WDZA 4FS3A 3TZQA 5L4NA 3F1LA 4WNCA 2D8AA 3GGGA 5C7OO 5DZSA 4IGEA 3QWIA 4RPGA 1JKJA 3WYCA 2HK7A 1NWHA 3PQDA 3DB2A 3ABIA 4DPKA 1T2EA 4ALNA 2IXBA 1E77A 1K6IA 1QLHA 2JCXA 4BQPA 4EJ0A 3D3WB 3JYPA 3ZWMA 4CM1A 3OBBA 3HFGA 3OJOA 3F4LA 3FNEA 3WFJA 3H65A 2W8ZA 1U2DA 3CEAA 4B3IA 2NNLD 1K6JA 2ZB4A 5HS6A 4XYLA 1NVMB 4AL4A 2YUTA 3IKVA 4I08A 3ZNNA 2FWMX 2X7HA 4FFPA 3ZV4A 5L95A 3FCOA 2AG8A 4GI2A 4M8SA 3AI1A 1I32A 4BO6A 3UHAA 4NU6A 3GN1A 4EUEA 2BD0A 1RM4A 2OHXA 1DJNA 3D5TA 3R0IA 4J4HA 4II2A 4O5OA 4RF5A 1KC3A 1Z74A 2YHIB 1NFFA 2ZQZA 1CDOA 1P0FA 9LDTA 2GZ3A 3TPCA 3UH1A 2UYYA 3PIIA 1YL6A 4N18A 3I9LA 3TFOA 1R15A 4M49A 1IPEA 4GH5A 4BNUA 3OEYA 4I5DA 5TGDA 1LEHA 4HXYA 2DPHA 3AW9A 5IDXA 2BF7A 4MP3A 5IN5A 2G82A 4CLRA 5G0SA 1VRWA 1YRLA 1RPNA 4PRLA 3DHNA 4W7HA 3ZU3A 3VVCA 2OL4A 4CM8B 1CRWG 3RBXA 5KVCA 1PX0A 3KYCA 2JAPA 2RHCA 2IYOA 2UV8A 5KKCA 4DBZA 3LQFA 3WJAA 2CFCA 3INGA 4B7XA 1A9YA 3HB4X 4BS9A 2WJPA 4B79A 2BRUA 2GYYA 1Y6JA 2CVQA 4NIMA 2D4AA 2UUOA 1NYTA 2BGKA 3H5RA 4PLZA 2LDBA 3I6IA 3WFIA 1LRJA 3AI3A 3F3SA 3HNPA 4I8XA 3E1KA 5CPBA 1NBOA 4QSMA 3HDQA 1Y8QA 4XGKA 1HSOA 3D4PA 4Q3NA 3ZH2A 1ZIDA 4BKRA 3MJEA 4R9RA 1QXSA 4NPCA 1ZK2A 3ONEA 4LRTB 3FRJA 3RJ5A 4D42A 1SPXA 1CIVA 3IDSA 4IY1A 1PS8A 3DBVO 2B83A 4J9VA 1H6BA 4WLFA 5ICSA 2Q2VA 3I1JA 4HFJA 3WGOA 4IDFA 4FGSA 4FOSA 1TLTA 2NACA 1DXYA 3H3JA 3ZWXA 1GUZA 2GF2A 5FEUA 4DGSA 1DHTA 2PZMA 2EJWA 3U09A 3VH1A 1FDUA 3FWNA 1PJTA 3SJUA 4J1TA 3E03A 1T2CA 1BXZA 3AK4A 4I9UA 2VHWA 3NUGA 4OQZA 4CMBA 5JE8A 2B5WA 3WS7A 4ROSA 3QE3A 4LISA 1NTOA 4DIFA 1GYRA 1E7YA 1DEHA 4L73A 5IXSA 3WLEA 4DMMA 4F46A 4J6FA 4BO0A 4WCFB 5TT1A 1KYQA 3ZV3A 3ASVA 2QIOA 1R0SA 2O2YA 1NVTA 1ADGA 1LDYA 3OJ0A 8LDHA 4JBIA 2ZTVA 2VOJA 2O2SA 1GQ2A 4E5KA 3X2FA 5L51A 1HT0A 5G4KB 5I8ZA 3OFSA 1ML3A 4OHUA 3VTZA 3WQQA 4BL5A 1LQTA 4JIGA 4DWVA 5FF9A 5A3JA 2EW2A 1NM5A 5B4TA 3QLJA 1PSDA 4RVHA 3S2EA 4CMIA 2FR0A 2WD8A 2Q3EA 3PGJA 4ND5A 3KEQA 4BVAA 3D7LA 4IUYA 3ZHYA 1U8XX 3Q3CA 2EP7A 3U49A 1IPFA 4CMCA 2Q4EA 3RC7A 1OC4A 1MXFA 1XG5A 4Z0TA 2QZZA 7MDHA 3FR7A 3IC5A 3CSDA 3S2GA 5GZ3A 1I3MA 1WDKA 3FTNA 5JYDA 3PHIA 4XJTA 2JD0A 4J43A 2JD2A 1E3IA 2QRKA 5ILOA 4KUGA 4ONEA 1D8AA 2UDPA 1LSOA 4RPJA 3Q11A 4JJFA 3COSA 3JQ9C 3WBBA 1FDWA 1I2BA 1VJ1A 1FJHA 1OZAA 3TRIA 1ONNA 1GZ3A 2W90A 3NT4A 3BAZA 4LW8A 1JWAB 5EINA 2C5EA 3DONA 1ZEJA 4QTZA 1BTOA 2I76A 1M6HA 4HUJA 2PZKA 4WCFC 4B3JA 3L9WA 4XEHA 1BXGA 3GY0A 3ZW9A 2B5VA 2C0CA 3Q9UA 2LDXA 4IS3A 1LDGA 1MV8A 3JQAA 1H94A 4RZIA 3OEWA 4GX1A 4YA6A 2IYPA 4KWHA 5IDYA 3WR5A 4NR0A 4PLHA 1X7HA 3PPIA 5A05A 2TMDA 2FR1A 4E12A 3BTUA 3QVXA 1X7GA 4M89A 2G76A 2PH3A 2A9FA 3P2OA 2GNAA 1EE2A 5TNXA 4OGWA 2X23A 3QVTA 1KBZA 1XR3A 4J7XA 3WIDA 3JD0A 2G0TA 3QWBA 4OMUA 3JSAA 4L4RA 3DBLA 3VH4A 1GAEO 3PTZA 3KYDB 1KEWA 2YHUA 1Y9AA 4R5MA 5C37A 4Z0PA 2I9PA 3RFVA 1M6WA 4AJIA 1VM6A 3CH6A 1PJLA 5JAQA 4GSKA 5A4DA 4DREA 1FDVA 1XYGA 4FFMA 1ZK1A 4BO4A 5J23A 3LT4A 4RVFA 1LLUA 5KTKA 4BGIA 3GLQA 1MG0A 4MP8A 4WK6A 3GFBA 4DVJA 3IIEA 3KM0A 5KJCA 1P3DA 1U1IA 4GLOA 1Z75A 2F1KA 4CMJA 4MVJE 4CQLB 1L1FA 4PN3A 2XXBA 4LRSB 4OQYA 2A35A 4CODB 1WZIA 4WOKA 3GQVA 5DN9A 1G1AA 1ZZEA 2HU2A 5ITWA 1V35A 1O6ZA 1OAAA 3NJ8A 4D3DA 4W82A 3E9MA 5T8KC 2AEJA 4CL8A 4WEOA 2J3JA 5A3VA 3A4VA 3E9QA 2EKPA 1UXKA 1X1TA 1ZEMA 4XB1A 3Q0EA 4L74A 3FI9A 4S1VA 4ALKA 2OP0A 3RUEA 4A0SA 3DXFA 3GRPA 3F6YA 3TZKA 2GD1O 4GGOA 3QVWA 4Y6PA 3S1LA 2QX7A 1XDWA 4HADA 2VOEA 1YOVB 2FN7A 1F17A 2POQX 4IS2A 2VT2A 4U7WA 4RJTA 4LCJA 1Y1PA 2CDBA 4KUHA 3PYLA 2VUUA 2OORA 2Y1FA 5FWNA 1QSGA 1HLDA 1MXHA 2VRCD 3JYQA 4WJZA 4ALIA 4M54A 2O3QA 4FD3A 1NR1A 3MOGA 5JC8A 3T4XA 3K5PA 1KEPA 4MVJF 4M87A 3NDJA 3ULKA 1PL7A 4E6PA 1LDNA 4CMHA 3D4NA 1I33A 4PG4A 1PZGA 3AM3A 5JNLA 1G6KA 3PHJA 3K96A 5I8WA 3VTFA 4URFA 3GPIA 4MKRA 1A9ZA 3PDJA 4ND1A 1P77A 2Q1TA 5I9LA 2HK9A 2X22A 5DBIA 3ROQA 4E5MA 5JFOA 2NTNA 1Y5RA 4QECA 1X1EA 4K28A 4W6ZA 2GUGA 4BO8A 3W6ZA 5TX7A 3L07A 2R00C 1P45A 1DIAA 5A5EA 4NNJA 5A03A 3FD8A 1ZVMA 4YT8A 1VSVA 1AGNA 2VHZA 3E5RA 4RF4A 1HXHA 1PWXA 4XQCA 4DIBA 5L4SA 1KIFA 1LRKA 4Y8VA 3MEQA 1IZ9A 2DLDA 4IQ8A 1TI7A 4CM9A 4DLAA 1OC2A 3GFGA 3IUSA 1IYZA 3IS3A 3RUDA 3EW7A 4QO7A 1RYDA 3JQAB 3QP9A 3D4OA 5JCJD 1ZK0A 3O4RA 1R0KA 2VWHA 1FF9A 4R1UA 1MG5A 3G1UA 3N58A 4PCVA 5U9CA 3IOYA 1YL5A 2C59A 2JFGA 3RI3A 5KJ1A 1N7GA 3H9UA 3WMXA 1HDGO 3D5QA 4L4SA 1SEVA 4WCDA 5JXWA 1BXKA 3L4BC 4MVJI 3GNQA 1N2SA 2VNAA 6LDHA 2DFVA 3I3OA 1ZMTA 2Q1SA 1N7HA 2FR8A 5IJZA 2O3TA 4IJKA 1LC3A 4R1NA 5COBA 1ENYA 1F06A 1P44A 3DAFA 4O0LA 2D5CA 4CM6A 3JQFC 3JQ7B 3RQSA 2QHXA 2J3KA 3FNFA 1X0VA 2OGUA 3PHGA 4CQLA 1ISIA 3I23A 4Q9NA 1U8FO 4RZHA 1R12A 2ZIZA 4CLEA 2O3RA 1VL6A 1SAYA 5G0UA 5JS6A 3B20A 5BSEA 4D41A 4YT2A 4DYDA 3DZHA 1K0UA 3D3WA 1E3SA 3EAGA 3L0DA 2E48A 1ENZA 4CR7A 4BQRA 4AFNA 3U62A 1ISMA 4WEQA 2I99A 3PHHA 3GVHA 4M86A 3VH2A 1L7EA 2QW8A 3K30A 1SOWA 4TROA 3CZRA 2C29D 3SLGA 3TN7A 3WB9A 4LN1A 4E5YA 3K6JA 3S8MA 4CMKA 1XEAA 3NTQA 3UOGA 3GHYA 2ZYDA 1E5LA 3GG2A 3OECA 1DRVA 3OM9A 3EZLA 4XGNA 1BDMA 1HE4A 2VHXA 3I52A 1CERA 1TB4A 1ENOA 3T7CA 1NQ5A 2DUWA 2PTGA 1GPDG 1YOVA 2V6FA 3MWDB 4OH1A 5ES3A 1GV0A 1YB1A 2ZTLA 4MDHA 1Q7BA 3BXXA 2VHYA 4QXMA 3ZNQA 4FJ0A 4L76A 1XA0A 4YT4A 1H6DA 3IJPA 4OM8A 5KJFA 4O1MA 1ADFA 1H5QA 2DBVO 3QVOA 5ITVA 5KCZA 5CPFA 1Z73A 1PGOA 2W2LD 5JAZA 4AJKA 4LSMA 2YHIA 2FSVA 5U1PA 4NK5A 4YAGA 1J0XO 3EMKA 4ID9A 3NJ4A 3EDMA 5H81A 4LSWA 2Y68A 1HSZA 1E3EA 2VZ0A 3HFSA 3GNSA 4FFRA 5EESA 3U4CA 4P4LA 4X54A 4BGVA 1YQGA 4UVGA 1GEEA 2VYND 4OO3A 2P2SA 3Q6IA 4TVOA 4M1QA 2DVMA 1KC1A 3RAJA 4YB8A 1HZZA 2JCVA 3QJ5A 5DNAA 4J7UA 2O48X 4KOAA 1W8DA 4QFDA 5TQVA 2C5AA 3AY3A 1T4BA 4NJOA 4AJ2A 3MJTA 5JW6A 1JTVA 2X9NA 3PK0A 4I1IA 5TT0A 4CV1A 1TXGA 3G17A 1PZEA 1E0DA 3OJEA 4NFHA 1DPGA 2XF8A 3ANNA 1ISJA 4H3VA 1C0IA 3AU8A 3MOIA 4RVUA 4A10A 5ICMA 4MVJA 1LX6A 4BNWA 5JMWA 5JAIA 3M2TA 3JQBA 4XQEA 1D4FA 1WVGA 4CPDA 1A7AA 3ANLA 3WMWA 2GR9A 5DOVA 5EQFA 1GUYA 1ZKMA 3KTDA 2NWQA 3PFFA 1F14A 3KLMX 5AXAA 1U3TA 4E5PA 2Z5LA 3DC2A 3ENKA 4IJWA 4PIVA 2FOIA 1VC2A 3GAZA 4EYEA 2ZKLA 5A02A 4Q3AA 1RM3A 3FBTA 3N7UA 1VE9A 2PKRA 3VKUA 1CYDA 4UVHA 1LBEA 1PTJA 3CIFA 1MX3A 1TT5B 2Q46A 1XHLA 3VKVA 1HEUA 1QP8A 2EEZA 1LLDA 2AE1A 3ZU4A 3T4EA 1X0XA 3DBRA 3L4BA 4D7AA 3ASUA 4B8ZA 3HN2A 3NAQA 4XYGA 3VH3A 4NQZA 4NHEA 4QX6A 1B2LA 1YBMA 3HJAA 2IDZA 4YBZA 3MJSA 4XRRA 5CDSA 2I3GA 3RUAA 1I30A 2CY0A 3LK7A 5T64A 1RYEA 4R9SA 4OKIA 3WYBA 4QO8A 1EFLA 1U3VA 5CDUA 2H6EA 3JQEA 1BXGB 1E7SA 1I0ZA 1ZSVA 2IODA 4ZGWA 1BMDA 2WYUA 3ONDA 5I7VA 3BTOA 3OQ1A 1B3RA 2EKQA 2VWGA 1DRWA 3E18A 3TDKA 2X5OA 1E5QA 1P74A 3DQPA 3OJFA 4PZCA 1U2GA 2Y05A 8ADHA 1NQOA 2WSBA 4BNHA 5L7WA 4IDCA 1EVYA 3QQPA 1GL3A 4ND3A 4AJPA 1UZMA 4TMFA 1O5IA 3JQAD 2ZYAA 5B4VA 1SB9A 5HWSA 3MZ0A 1R0LA 3DFUA 4MVJD 1ZJYA 2DQ4A 4Z3KA 5G0WA 3WIEA 5AQ1A 3WGTA 1XU7A 1JLLA 1LTHR 4RVDA 1TEHA 3PZRA 2FMUA 4Y9DA 5I9MA 4CM3A 4K26A 4OXKA 1KOLA 4CM4B 3QSGA 3RKRA 1NAHA 1ADBA 4MPDA 3I9KA 2YW9A 4GKBA 5B4UA 3IP1A 4BNXA 2QG4A 1B7GO 3ZWPA 1W73A 2VNSA 3GDOA 3QIVA 3FN4A 4PRKA 2P5UA 3OP4A 4RORA 1HDCA 2O23A 4J1QA 3NRCA 5MDHA 4IGFA 1VPDA 4NI5A 3QWHA 3W8FA 1D7OA 2V65A 4H16A 2EF1A 4DYVA 1O89A 1CQIA 4WLUA 5COQA 2HRBA 3GHHA 4BO1A 1QR6A 3BA1A 1DIGA 4RF2A 2O7QA 2OBNA 2PR2A 2PGDA 2V6GA 3V2UA 3EYWA 5LDHA 3PVZA 2NQTA 3LC7O 1RKXA 3HDHA 2X0IA 1CQJA 1PS0A 1Q0LA 3DTYA 5C3MA 5AXDA 1B16A 4FJ1A 1VJ0A 4MIEA 1Q2XA 4FFOA 4Z9XA 1AHIA 1YDWA 4G5HA 2DM6A 3KRTA 4FW8A 5G0VA 3IAHA 3AOEC 1EBUA 2VN8A 3UW3A 2XAAA 1S6YA 3GDGA 4EEZA 3Q1LA 3UUWA 5KVQA 3QA9A 4R1SA 2P91A 3JYOA 2PWZA 2C07A 3KYCB 2I6TA 5TSDA 5KOIA 4R5HA 4IDGA 1U9JA 4HP8A 1JWBB 4XKJA 1E3WA 1Q7GA 3OQ6A 1LXCA 3KVOA 4PG7A 3DBLB 4TKMA 5A9SB 5I7SA 2NUAA 1DC3A 2EHDA 2X0JA 1DO8A 2C20A 1T25A 1HDOA 2ZTMA 3OF2A 2H9IA 2VWQA 3DR3A 3H8VA 4XQ9A 5DDIP 2EV9A 4JP2A 2ZK7A 1SO8A 1LDEA 3H5NA 2AQIA 4NFYA 3U4IA 4MVJP 5BNFA 4YACA 4L9RA 4TRRA 5DBFA 4CQMD 4MINA 1UXHA 1C3VA 1EK5A 3BMCA 1SBYA 1Y81A 4YRAA 5KJEA 4YJFA 1DLJA 3UICA 2ZJ0A 1TT7A 2CUKA 1SNYA 4JXKA 4Y6RA 4R41A 7ADHA 4CLHA 3EC7A 1AXGA 2DFDA 4WLNA 1E7WA 1EFKA 3PI7A 4OXYA 1O9BA 2G5CA 3C1AA 3OA0A 3E9NA 1YB4A 1KVTA 2CD9A 1B0AA 4W9NA 1XGKA 4GVLA 4YJHA 1HE2A 1K2WA 4R01A 4JBGA 1E3LA 1ZK4A 2HMTA 4BNJA 3L6OO 4R4JA 4FC7A 2Y1OA 4I9NA 5AYVA 5T57A 3DBHB 1I8TA 1DIRA 2PK3A 4HX5A 1BW9B 3PYMA 4FC6A 3WGHA 5EJ2A 3F46A 3RASA 4F45A 1JAXA 1GD1O 1B15A 4D0RA 2JAHA 1ZXBA 1Q0HA 4MO2A 1UR5A 2A4KA 3U0BA 4CQMA 5GZ1A 3O26A 3DTTA 3QVSA 4A26A 3WXBA 2YYYA 1LC0A 2RH4A 3C1TA 5TC4A 1IL0A 1ONPA 2NU7A 3AM5A 4RPLA 1I5RA 3WSWA 3T7EA 4GLLA 2YQ4A 2IZ0A 3PDUA 1I2ZA 4PLGA 1QRRA 3FNHA 3PP8A 1VSUA 4PVCA 3WQRA 3PJFA 4GAEA 1F8FA 4OOEA 1E6UA 1YQDA 1X14A 1PEDA 1RJWA 3K8ZA 4D45A 4E0BA 2JFHA 2DBZA 3DZIA 3ENNA 3PQEA 4Z0HO 6ADHA 3C8MA 3OQBA 2Y0EA 2QZ9A 1X13A 5LCXA 1IHXA 2PLAA 4EI2A 4DC0A 5KVSA 4ZQGA 3UVEA 1NQAO 3C3XA 3RUCA 3I9OA 1DIHA 4RDHA 3E82A 4WLEA 3KOUA 1U3UA 1PGPA 2VTEA 1CEQA 2CZCA 4AJOA 3WNVA 3DZKA 1V3TA 5JPIA 5T8KA 1HL3A 4RLSA 4BUCA 4CM8A 2HRZA 4CM9D 4PLTA 1LSJA 1UAYA 1B8PA 4YAIA 3M2PA 2AMFA 1W4ZA 2E4AA 3B1KA 5EL0A 1A27A 3SC4A 4A03A 2ZQYA 3GVCA 1DC4A 4FFLA 3GOHA 1HDYA 2VZ9A 1YB5A 2PGLA 4I5EA 2Z1NA 1DLIA 4AJ4A 2J5QA 3IUPA 4Z6KA 1JU9A 1PJBA 1R66A 4BNTA 1O94A 2Q4BA 2Q49A 3RU7A 3HB5X 4RQTA 4CR8A 4UUPA 4E33A 4PVDA 1UXJA 4YTEA 4R16A 4D3SA 1LLCA 1XQ6A 5KWEA 4TRJA 1EEHA 1M66A 1P0CA 3B1JA 1NPDA 2WYVA 1LA2A 1WMBA 4Q3BA 2NVBA 4BNLA 5G0TA 3BZUA 2CNBA 3KEOA 3OMLA 3PFWO 1I3NA 5JDCC 4J4BA 1BWSA 2X9VA 5B1YA 3MWEB 2HJRA 4GBJA 3VAZA 2XXJA 3IP3A 2VRCA 4DLBA 4P8RA 4BKQA 2SCUA 4XYEA 4UVEA 3NYWA 5ER9A 1E1KA 4RVGA 3R1IA 3EGOA 3HWRA 5AXBA 2R2GA 1U4OA 3VZPA 4W7IA 4DQXA 2HDHA 3ZWVA 4Q3DA 2EGHA 3FBGA 3RFTA 3VPGA 2OO5A 4GMFA 4E13A 5I7FA 3GH3A 2J6IA 2R6JA 3LVFO 3BIOA 3K92A 3BTSA 4XYMA 3DZFA 2GSDA 3NGXA 3GA0A 1P1JA 3JQ7A 1D1SA 1MA0A 3ZWNA 1EBFA 2NTVA 1KVUA 4MVJG 2D3TA 3CINA 3K9QO 3PIDA 3ROKA 1KS9A 4PLCA 1NFQA 4U5QA 3V1TC 4U0KA 2Q99A 4HFRA 4BGUA 2E37A 2V7PA 3ZGYA 4EGFA 2H63A 4A7PA 1P1FA 4WUVA 3W1VA 3ZU5A 1QV6A 1E7RA 1XQ1A 1PJQA 3EHEA 3WGZA 5BNTA 2NM0A 1UP7A 1H9AA 3WOHA 4ZD6A 4A2CA 1C0LA 3W8EA 2JL1A 4AICA 2YFHA 1KVSA 2HK8A 5JCJA 3GMSA 1WW8A 1FK8A 4NBUA 3ORFA 2Z95A 3AFMA 1PJ3A 1BDBA 3LU1A 3AU9A 3BMNB 5F1OA 4OYRA 3TJRA 2PFGA 4XR9A 4LMRA 3R3SA 2YV2A 4HV4A 1EUDA 1MB4A 4E5NA 2I66A 1KY4A 2D0IA 3K2BA 1N92A 1ZNQO 4RPKA 3OJLA 2BKAA 1MFZA 3TNLA 3F5SA 4EBFA 4TRNA 1ZO8A 1HWYA 4M55A 4ZU3A 3DMTC 5CDGA 5F21A 1DFGA 3SC6A 4BNGA 1GQYA 2WYWA 1JA9A 4BO7A 5JBIA 3BMQA 3JQGA 4QUKA 3JCZA 1KEVA 2C7VA 3ZWCA 3HQ4O 1R37A 3ETEA 1GV1A 1B26A 2BH9A 5JLAA 3KHUA 1YXMA 4MIOA 3W4KA 4YJGA 4BNZA 1E92A 3EY4A 2HCTA 5BNIA 5LC1A 3TSCA 4D3FA 3L9XA 4D0SA 3DZBA 3DL2A 4J3FA 4L8VA 1ZW1A 4JGBA 3N74A 4QQRA 5L9AA 3BMNA 2FSSA 2ZYGA 1E1LA 4ZRMA 1U7TA 4S3MA 3DHEA 3SLKA 3LLSA 2PH5A 3G79A 3JD1A 5L3ZA 4PFJA 3WICA 1KVRA 1ZUD1 4XD2A 2GCGA 1GEGA 2Y66A 5F3RA 1YVEI 1P1RA 2B69A 5DP2A 1QMGA 5DP1A 2C82A 4P4NA 2BHLA 4BB6A 3U3XA 4F3YA 4TZTA 5F5NA 2DBRA 1A7KA 4G2NA 1HDRA 1H0KA 3QHAA 4N5MA 4QEDA 1GY8A 3VVBA 1WDMA 2GN6A 4OSPA 3UCXA 4EDFA 2G1UA 4HKTA 4IDEA 4EEXA 4ALLA 4LVUA 3AJRA 4DUPA 4FN4A 5BQFA 1PS9A 2NVUB 1PGNA 2AQKA 2RHRA 4E30A 4W99A 2GO1A 1T4DA 4PLPA 5TRTA 2AA3A 3RSHA 4BNMA 3KUXA 3BMCB 5K6AC 1YONA 3L4SO 3DMYA 2JD1A 4JP3A 5KIAA 1I24A 4UEKA 3UXYA 1H2HA 2E6UX 2QQ5A 5B37A 1N5DA 4A27A 4IIVA 3ZWAA 2E49A 1PZHA 3HADA 5EN4A 2JKVA 4FDAA 4EJ6A 1EDOA 4KTVE 1R4MB 3LC2O 4NBRA 3ANMA 3DOJA 1F12A 1M67A 1YQXA 1A71A 1ZMOA 3LYLA 4J7CA 3ZCXA 2GN9A 1XWFA 1WAMA 2PD3A 4C7KA 2OZPA 3EVTA 3RBVA 3I9JA 1WNTA 3R3JA 5CDTA 2C2YA 2F00A 2B0JA 3D0OA 3PYXA 2FZEA 4IJUA 4OSOA 5EQDA 5B12A 3LT2A 3DFZA 4GX5A 3B6ZA 5IG2A 5L53A 1E6WA 3WQSB 2DTXA 4R3NA 1HZJA 4ND4A 3SJ7A 5A1TA 2GZ2A 4JK3A 2RIRA 3WJ7A 4PG6A 4KQWA 4CMGA 2HLPA 2CDCA 1BGVA 3ZHZA 2RCYA 2ZATA 2O3UA 1QYDA 2HUNA 3TL2A 2D2IA 2NADA 3TOZA 3HDJA 4BNYA 3JQCA 1XIVA 1Y7TA 3STHA 1LNQA 3NDRA 5CHEA 4ESOA 2EGGA 3PHLA 3JQ8B 4YXFA 3AUAA 5L7TA 2Q2QA 4IQGA 2I65A 2GZ1A 3PWSA 4MKXA 5U4QA 3UKOA 3BMOB 4KDEA 4JCOA 3C7DB 3S2IA 3TZHA 1KETA 5EERA 1BVRA 4FBGA 5KJ6A 1GYQA 1H2BA 3W6UA 5IZCA 3ITDA 3TFQA 1LQUA 3WTBA 1JVBA 1D1TA 1V0JA 3JQBC 3DMTA 4HBGA 2GRAA 3MTGA 4BV9A 4DIOA 3G1TA 4UUNA 1T1SA 2B4RO 3S55A 4WLVA 4H7PA 1K89A 3VDQA 2HJSA 1P9LA 1ID1A 4GWGA 4E2YA 2W2LA 1EQ2A 1SMKA 2OXIA 1TVEA 4FR5A 1CF2O 2DBQA 3MJ4A 2Y1CA 3GZ4A 3WWYA 1NHGA 3C85A 4YRBA 4KP7A 1NASA 4XA8A 3JQGB 1WLYA 1PZFA 5CEJA 1OFGA 1JW9B 1YJ8A 3BTVA 2BI8A 1PL6A 3V2GA 1IB6A 4NBTA 3ST7A 1RWBA 2UAGA 3QWAA 3QRWA 3OETA 5A9SA 3QV1A 3OH8A 1HDXA 2DKNA 1LSUA 3QW2A 3KETA 1V6AA 3ITKA 1YJQA 3UF0A 5G2OA 1IOLA 1LJ8A 2EIHA 3E5MA 4MJLA 1GR0A 1UXIA 1IY8A 3QY9A 1EUZA 5TS3A 1QYXA 2I67A 4CUKA 3WLFA 3DBHA 1HE3A 5FI3A 3WGYA 1E3WB 4I9HA 2I3AA 3MTJA 4JX8A 5BSHA 3FPCA 5COAA 1EE9A 2C54A 2O3JA 1YL7A 4R1TA 2AE2A 4RF3A 4IDDA 1DDOA 5K6AA 3DZGA 1QLJA 2HMUA 3LLVA 4FOOA 3DBRB 1N9GA 4YPOA 4XZ3A 1JQBA 3KV3O 5HBRA 1MC4A 1R6DA 4A5OA 4KTTE 4BKOA 1ULSA 3CMCO 1HLPA 4NK4A 2NVWA 1UDAA 4Y67A 3LDHA 3R6DA 4WGGA 4XYBA 5CP8A 5DT9A 2J3IA 4IXTA 4FQ8A 3F4BA 2HAEA 2WMDA 3ZZNA 4BNFA 5JY6A 1Z7BA 5IF3A 1YDEA 3GK3A 2D1YA 3TF5A 4UEJA 1H6AA 5BT9A 3AFNA 3RUIA 5LDGA 1GFSA 4F6CA 3JYLA 2W98A 4YT5A 4CMEA 3EUWA 4XX0A 2PV7A 1NHWA 3JQ8A 5KVVA 4K6CA 3GF4A 1U28A 3HUDA 1OMOA 3E6AA 1J49A 1QG6A 1P1KA 3O8QA 3Q2IA 4IPTA 1KEUA 4Q39A 4PGFA 5I7EA 1MLDA 4QT0A 5JC1A 4WPGA 1QYWA 2AQ8A 2OMEA 4JJGA 3HZZA 5IN4A 1OI7A 2FRDA 5CG2A 2O4UX 2HMVA 5DBGA 3PZBA 1O0SA 2Y0CA 4D43A 1J5PA 4PLWA 4CUJA 2A92A 3VPFA 3RROA 4PLVA 2H1SA 2YY7A 3DWFA 1NR7A 3G3EA 3ZWYA 4CR6A 1MP0A 2AXQA 2NTJA 4ZICA 2FY8A 4MOWA 2PA3A 1NAIA 1BG6A 4R69A 2JHFA 1PWZA 1LU9A 4MKZA 3K2EA 1R16A 3CE6A 2Q1WA 4E2XA 5JDCA 2DTDA 4Y6SA 2BFPA 4JLWA 3ZN2A 3PRJA 5JO9A 1DAPA 3RC9A 1PJCA 2TMGA 2XOXA 2HKIA 3MCVA 2C2XA 1HYHA 4NFSA 3VHRA 3GGOA 3E48A 4DPLA 3GC6A 1H93A 1XCBA 1PU2A 2BFMA 5HRUA 3BHIA 3RD5A 3DAPA 5C7LO 1SEPA 5HM8A 1JVSA 4P38A 5A9TA 3JV7A 4N7RA 3H2SA 2CDAA 2QRLA 4RLHA 1EDZA 4GWKA 2NLOA 4LVCA 3ZU2A 5A9RA 1P33A 3KLPX 4NG5A 1QV7A 4HFNA 1J6UA 4BO5A 3NT5A 2EXXA 5F1PA 1MFPA 1GDHA 4N5LA 4YCAA 4AJHA 1G0NA 5JSFA 3PJGA 4TZKA 3RC2A 1Y5MA 1DHRA 4C7JA 4WNIA 4RPHA 5T6BA 5JCXA 4II3A 4OAQA 1N1GA 2WEKA 4BHTA 4E21A 2OBYA 4YQZA 2BELA 4FIZA 5K0ZA 4RL6A 2IZ1A 4PZEA 1GCOA 5L4LA 4AJJA 4JN6B 3HDYA 1YS4A 4YWJA 3GPDG 4EUHA 4UUOA 3K73O 3VZRA 3I83A 4TVBA 1PQWA 3HSKA 5DCYA 3HHPA 2B35A 4BO9A 4RQUA 3F47A 3PWZA 4IMRA 3SVTA 5G4LA 1HF3A 2VYVD 4ND2A 4KUEA 3WGIA 3AUUA 5HA5A 3O38A 1Q7CA 1RM5A 2X58A 2NU6A 2IE0A 4B4OA 3E8XA 1C1XA 2WE8A 4KQXA 3F1KA 5GY7A 1T24A 3JD3A 5C7IO 1W6UA 4RV9A 3SX2A 1DJQA 4IMPA 4EW6A 1L7DA 3VOSA 5IZCC 1V9LA 1N9GB 4PG5A 3NDIA 3IL2A 1TA4A 4DMLA 5HS4A 3GZNB 1I3LA 1EQUA 1YBAA 3AOEA 4PLFA 4TSKA 4GSLA 2WTBA 4DPMA 4BMSA 4XDZA 1M2WA 4BV8A 1SOVA 3JD4A 3ZI0A 1YBVA 2YV1A 2ZJ1A 1WWKA 3WX0A 4E32A 5AXCA 3W8DA 4XCVA 1GCUA 3AWDA 4I5FA 4HY3A 2Q1UA 3Q9NA 4IJVA 1K6XA 1SC6A 3RU9A 4B7CA 4YYZA 2RBEA 5FI5A 2X9GA 1GYPA 5JMPA 2CF5A 1VJTA 4K6FA 4O59O 1H9BA 3WNQA 4AJ1A 2FPIA 1UP4A 3H4VA 5IXYA 2IRWA 1VL8A 2HQ1A 4FFNA 4AJNA 3GMDA 1IE3A 4NJMA 2HSDA 4ALJA 4CV0A 3UFXA 2P4QA 3A14A 2OFPA 1E7QA 1C0KA 3CXRA 4DRYA 4E4YA 1U4SA 4CQMB 3F9IA 4BNKA 1X15A 3TL3A 2Y0DA 5ENDA 2BFAA 3V8BA 4E31A 1AHHA 5TF4A 2EERA 1KERA 1Y8RB 4LGVA 1YH3A 4AG3A 3U5TA 4FB5A 3IMFA 3ON5A 2O50A 3GR6A 3KBOA 1A4UA 4J0FA 4B4WA 4ALMA 3SBOA 1EZ4A 1HETA 3A9WA 3FHLA 1J4AA 2X5JO 1EVJA 3GEDA 3TWOA 1F8GA 3H7AA 1W0CA 2HMSA 1HYEA 3L6EA 4IBOA 3ZHBA 2J5KA 1XKQA 3RIHA 2QRJA 1DBVO 3BHMA 2VCYA 2JJYA 4Y98A 4J4TA 4HNGA 4P22A 4O6VA 4IDBA 1HDZA 4WLOA 3B70A 1C1DB 1UDCA 3RWBA 3DZJA 4U0JA 1E6EA 3OA2A 1GZ6A 3WWZA 5GMOA 3PJEA 1UZLA 4ZQHA 5CFZA 4YEDA 4A73A 3VDRA 1PIWA 4J0EA 1NNUA 4U6QA 4CLDA 1Q1NA 1DAOA 2PKQO 1DC6A 5MGBA 1WP4A 3WGQA 5ADHA 3H3FA 4L0QA 1PR9A 1ADCA 1Y9EA 3PEFA 1AN9A 2VT3A 5ENVA 3ZWBA 4ZQBA 3O03A 4EUFA 3A1NA 2CVZA 1VKNA 2GN4A 1V3VA 2IXAA 4JQCA 4PLYA 3KO8A 4YDRA 3ICCA 3PXXA 4BIIA 3FNGA 4IM7A 4YQYA 1A4IA 4YJDA 2X8LA 4TKLA 1OBFO 1B8VA 1LUAA 1VKOA 4KZPA 4B3HA 1IUKA 1G0OA 4WCFA 1N8KA 2PZLA 4ILKA 5IDQA 2WD7B 4MP6A 3FTPA 1E1NA 1IZ0A 3H9QA 2YQ5A 1P31A 5TJ9A 1ZXLA 4EZBA 1S7CA 1WXDA 3I9MA 1DFIA 3RUFA 1JAYA 4CLOA 2BGLA 2JCYA 4FGWA 3UCFA 1NFRA 2YJZA 2GDZA 3CPSA 4UREA 1PJ2A 4HWKA 5DULA 5JDIC 3NKLA 2GERA 2D5AA 5IZ4A 3V1UA 1M75A 2B4QA 3M6IA 3S2FA 1E3JA 4FJ2A 1QORA 1CJCA 3VZQA 1IULA 1GPJA 3GG9A 4DL9A 3ROMA 4HFMA 1R4MA 1UDBA 2CVOA
chains in the Genus database with same CATH superfamily
1PKXA 3IUBA 3WYEA 5TB5A 5KOJB 1CFZA 1JSRA 5BQXA 3GLTA 2AZMA 4O63O 1KRWA 1V8OA 1UT5A 3HA2A 5FOQA 4MDEA 3NHKA 3WRWA 1YRHA 3JD2A 2XMGA 4BMZA 1TYEB 2OHJA 4C2AA 1C1XB 2GAJA 4NBLA 4TV9A 1IOVA 2DPGA 1XU4A 3DFIA 4CMIB 2GPNA 2W6ZA 5AKXA 2Q6LA 1SJ9A 2GYWA 2QN8A 2AD1A 3PE4A 4KR0A 1I7PA 3UXHA 1HDEA 3EHDA 1Q3TA 5EPEA 2N75A 5KQPA 2B37A 4H1HA 4TRMA 1OTYA 1NVXQ 1UUFA 2QPLA 1ODTC 4IXWA 5EIWA 3D6VA 5HILA 3ND5A 4PYQA 5A7HA 1B0ZA 3UH0A 4Q4LA 3INRA 4CM4A 3U2QA 4EUKA 4P36A 3KHSA 1TTQB 5HOQA 1UWLA 1O77A 2WAXA 2O52A 1VPLA 1IWOA 4N9QA 3JQ6A 5JTUA 1DB3A 1YZLA 2XBLA 2IU4A 3AY6A 5D51S 1WMDA 2VT7A 2HM7A 1EWKA 3M6LA 3FBWA 3UN1A 2CW5A 3GEBA 5FFFA 2H92A 1AT1A 3C24A 5I9NA 3C97A 1FFYA 3DO8A 1XTIA 1O8BA 1OX4B 1EHCA 5J2UA 5IX8A 1NY5A 4P7BA 3PF9A 2W43A 1ECGA 3LSYA 3RCBA 1QFMA 1UPXA 1NZDA 2WJ6A 3OX2A 3P0EA 3DE3X 4G4SP 4W9RA 5LIRA 4AG6A 1Y3HA 2DUUA 1UJMA 4OHYA 5DHQA 1TQ6A 2ONZA 3LZ6A 2IEGA 4PPGA 4LOAA 2BTQA 3OESA 2VPPA 5E8JA 4F5EA 2CNWD 4EYGA 5AIBA 3REQA 4GQAA 1MPTA 4HBZA 1OPRA 2VTDA 2WU1A 1AS0A 4QBIA 4RX1A 3MJVA 4CEHB 4LRXA 3PQFA 5TVGA 4RGBA 4G0WA 1RJ9A 4L4XA 4AJLA 1Z0JA 3KKLA 3QEMB 1U5BB 1WULS 1U04A 3UAYA 3G2QA 1ENPA 1NIJA 3CEHA 1F7UA 4DC9A 3QXXA 1OF1A 4FYVA 4K88A 2Q7OE 1JT9A 3P9PA 4IKOA 1VL0A 2QRQA 4HZUB 1E2LA 5K8UA 4CM7A 1JJVA 1R4NB 2B4TO 2YN0A 2PFSA 3A9VA 3UJDA 3UGKA 1T0UA 2J4FA 4MVYA 1OYYA 3ODGA 1JBKA 2ZPUA 3NPMA 5D87A 2YYAA 2UVPA 4JSRA 2PZJA 2CDNA 4FLFA 1Z4NA 1P5FA 6ABPA 2BSAA 2FHSA 2XW6A 3GZJA 1O03A 3GT7A 1C3OB 2QWXA 4R68A 4X7BA 2OCXA 4OREX 5KEIA 4ZN6A 3TR5A 4X7RA 2O2DA 4JI0B 1RWKA 2OQRA 2A3RA 5E6RA 1GNTA 3MVEA 5IT4A 2J0QA 3R3YA 3LYHA 5DF1A 2GZSA 1T2FA 5JHGB 2FWBA 3P2MA 1HL7A 2ZJ8A 3KEMA 1JN0A 4MJ7A 2BFEA 5HUHA 2RIPA 1Z6XA 1AQYA 5EHXA 1BYIA 3USZA 2PZBA 1LQ2A 5HZKA 3A3OA 1E7MA 3CVXA 2Y76A 4ZK6A 5H1YA 2CSUA 4KR9A 4F9FA 1F1BA 2HIHA 3RS4A 1SCKA 2G25A 5BSFA 1ZFNA 1O94C 5HKBA 1MC5A 3RKUA 1IN1A 4RXMA 1TTTA 2D59A 4YRCA 2VK2A 1YASA 3QJGA 2IEDA 4K9NA 3A4TA 1M76A 3R24A 4IZHA 2HHCA 2WYOA 1ST3A 2OZKA 3C3JA 2E1PA 1TD9A 3HHEA 4BJ6A 3BL6A 3IPRA 1M2EA 3Q41A 4G5SA 4N82A 1YRAA 4BKUA 2A94A 4WECA 3LNCA 2HJVA 4GXQA 2WVAA 2Q1YA 1F48A 3GA7A 3JQDA 2AG5A 3CEMA 4Y2QA 4YJFB 1XZMA 4PG8A 4F21A 3P27A 3CLHA 4TV9B 3IAAA 3U48A 1U9IA 3OTHA 1I4LD 1VE7A 3DF9A 1DVRA 4MDFA 2EP5A 1HEIA 3JQFA 3CLUD 1U1GA 4BGEA 4BFVA 4I1PA 4GE3A 3V2HA 4NMLA 3ZJ5A 3GUYA 4RETA 2B2NA 1S8FA 4KXUA 5H4GA 1TO1E 1JKFA 1CR2A 1P1IA 3WLMA 4AZVA 4TMXA 3E7PA 3CKLA 2Q9BA 1NDQA 3BL8A 4FDLA 5BORA 1YRYE 4BMVA 3E8MA 3LPLA 3NGLA 4PQYA 4ZC8A 2HV8A 3E2MA 5BQPA 3EXHB 1DWUA 4UVDA 2NYRA 2YBDA 1A2QA 1PUIA 3B2QA 5C5IA 2FPGB 1GL7A 5DCWA 3ZHCA 4NULA 4RD3A 1S8NA 3HBNA 1XHEA 3LL4A 5AUOB 2UXDB 4ZI5A 2IDMA 1TGVA 4IIUA 1KI3A 5EZSA 5IYZA 3OMWA 2QX4A 3EXEB 2FGKA 4B3CA 4CLRB 5LU9A 2IW1A 1J25A 1HYGA 2QN1A 1D6NA 1AUQA 1B3BA 1G9SA 4BLPA 1A77A 3EXIB 1SU6A 5IUJC 5SYAA 2X8JB 4HN9A 4ZT3A 1JQJC 2BZSA 4CU2A 4V1CB 1GPYA 4QVIA 4TTAA 3VNBA 2WMNB 4ZJUA 5KNCD 1XJCA 2FLKA 3CUUA 4EO9A 4UUMA 2ETVA 2BLLA 5BR7A 2J5RA 2PLNA 3CKKA 3GDHA 4NBWA 4E22A 4DY4A 3K0SA 3U3KA 1FUUA 2W6QA 4URWR 3U7EB 4W5WA 2O5EA 4LC9A 3E5NA 1RYHA 3OIGA 3W4IA 3GJ4A 5DXFA 3FWZA 4ETWA 4JL8A 2BN4A 4XUCA 5I4BA 5KWIA 3UY4A 5TMPA 4LMPA 2JGMA 3LCUA 1DWOA 3RC1A 5ICCA 3HUFA 4TYMA 3QY0A 3TLMA 4RO0A 3X44A 4M1ZA 1VJRA 3ISTA 4B7UA 1T9GS 1Z4JA 1SCUA 3OC6A 4MCIA 3ZOZA 1YS6A 1GQQA 3ACBA 4RPCA 4GI1A 1DQYA 4HB4A 4U00A 1UMDB 1Z6YA 2HFJA 3R4VA 4NJMB 4XIYA 3GVIA 4F4DA 2BGUA 3T54A 1FNNA 4X20A 1M1YB 2RH9B 5M3BA 3ROPA 1OBCA 3GLSA 3NV9A 3S40A 3VPCA 5GIPE 4Z4EA 4QJ4A 2FOLA 3U4AA 1ZI6A 3ZJTA 2HEGA 3D7NA 1ZSNA 4MS4A 1HQYE 4K40A 1TZCA 2IYZA 2RH8A 4KACA 4UHFA 4ZCSA 1U4NA 4MH0R 3RJ9A 1KZYC 1PE0A 3C1OA 5DYIA 3BWBA 3BDIA 1YKFA 4KO1S 5DJ5A 3AUTA 1XVTA 1T5TA 1W5TA 4GMGA 3QXHA 1ORRA 2GJ9A 3KSZO 1E2QA 4YRFA 3BFPA 3I37X 4D44A 2YWGA 4MPJA 2PCJA 3M1LA 1TX4B 2JPDA 1AQUA 4G5OA 3EK2A 5CH5A 3V8EA 1JIUA 4Z54A 3BG5A 4ZREA 4ZV7A 4X62B 1JR3D 2W4QA 5FADA 4Y2PA 4IJMA 4GOXA 1PWEA 4IP0A 3KZNA 1W48A 3S68A 3X2EA 1C7RA 1AS3A 1CPYA 5CG1A 1KNXA 2QTVA 4ABTA 2BFCA 2BKUA 1B74A 3TOVA 3G6WA 1F0PA 2EATA 2FPPA 1UH5A 4JJAA 4PNEA 3L5KA 3L0IB 5BSKA 3CSSA 1E63A 3GJQA 3H9EO 4QYIA 1U8UA 1Z2EA 1ORVA 3LQKA 4L15A 4AKSA 1JUDA 4EA6A 2OHIA 1M2OB 1Q0PA 4L2IA 4BB9A 2BFCB 4WOJA 4BRWA 4GYYA 4PE5B 4PYIA 3GBPA 5HUQA 3WLSA 1BGXT 2VJMA 2WPDD 4XWYA 3BXPA 4GKAA 2QV7A 4CIWA 4DJTA 3T3GA 4KL8S 4KYUA 3PXDA 4X63A 2YZ7A 1M9NA 3CRNA 3PUVA 3RYTC 1O8CA 4B6QA 5HIJA 1JMYA 3LBFA 3VBEA 3FB4A 2NU8A 1P1HA 5BN4B 3SC3A 2C7GA 5HIMA 2WKSA 4Z51A 3GLKA 4M7RA 2J8ZA 5T4FA 2Y93A 4C4OA 3ORYA 4WASA 3G2PA 3K31A 1M2JA 4P7GA 4TTQA 1XTRA 4M83A 2VZ8A 2G0NA 4Q1DA 2R7LA 2EGUA 1EVZA 3D1LA 3DAGA 5AI4A 5IFLA 1YUMA 4CETA 2ZSAA 1MORA 1H22A 1W1UA 2LWIA 4OJNA 1F5NA 1UZNA 2EJUA 4P54A 2DQZA 5DLYA 5CITA 1NMXA 5E6UB 5IDVA 5FDFA 5J2TA 4I50B 1KU0A 2OHHA 1BE1A 3OLYA 4YJ3F 3K5IA 3AG5A 2YWHA 4H0FA 4DLWA 1WLSA 1UMCB 2SKEA 4CFSA 2OOSA 5DNVA 1SKYB 2FG5A 4R05A 4QARA 4C4YA 4OEHA 3GGJA 2O6LA 3N9IA 3OE4A 5E9WA 4RD4A 3RG8A 4Z1OA 3HE3A 1C1HA 3GUCA 3NEYA 3ADPA 2BUCA 2I5PO 2PVPA 3BORA 1GTSA 4PYJA 1XT6A 2C00A 3UAXA 3VYWA 3HG7A 3P0IA 4M9XA 4I19A 5EFZA 5A4MS 1X3SA 4MVJH 5KZMB 3LUDA 1CF4A 3EVZA 2W2KB 1QFXA 2ZB3A 2YVQA 3JZMA 3C7KA 3ZV6A 1YUNA 2DTEA 1U0OC 3EZXA 2ZPTX 2QMEA 4DVGA 2EQAA 1PJAA 5K9ZA 3H6KA 4TWBA 1JR6A 2HH9A 2JLQA 4K0RA 4YROA 5TJHA 2V3WA 3B1YA 4R9VA 2DYKA 3U3OA 4MITA 4BTEA 1U5AA 2ZB7A 4BFSA 2P9GA 3AR8A 4G0UA 2H9AA 3G8DA 3WTCA 1W0KA 3A6ZA 3KEGA 1XKTA 3O94A 3QFCA 2ZCVA 4NU5A 5AW1A 1Q1GA 2PXHA 2HWUA 3G68A 3HRIA 1JR4A 2O8CA 2VFAA 3NHLA 2VDLB 2ZS7A 4QDXA 4D9FA 4HDSA 4LE1A 1QQTA 4ARZB 4ZGBA 1JIKA 2Q8NA 3VMFA 1VQ1A 3P5SA 1SA0A 3UMJA 4DXAA 3M1AA 4EF4A 3OSZA 2MSWA 2BDTA 2Z1MA 4XUEA 2VK1A 5GTDA 3O8QB 5CT8A 5DI3B 1SULA 2ZT7A 4GQBA 4CJXA 3WWDA 1YMUA 1N6IA 2GKGA 1WDLA 1J99A 3OT4A 3B13B 3RS2A 1VA4A 1D2MA 1AGPA 1YR1A 5JAMA 1BIFA 4H0CA 3F49S 4AKGA 3AI2A 5CDFE 1WPRA 3TX2A 4TYPA 5TQ0B 2ZWIA 4I7EA 3P0FA 2RGNA 4B3FX 1TPYA 1BCRB 1GUFA 2IHBA 2H9YA 2YYZA 3QHPA 2DETA 5IWCA 4QODA 2FJPA 2HIGA 1DG3A 4PZ9A 2GASA 3ONFA 2X1MA 4R9NA 4AB1A 4BZZA 4ZHQF 1S2GA 4H6VA 4OHMA 1UK9A 3EQ9A 3UCEA 3WB1A 5JANA 4LF9B 3MHPA 1P18A 2RC6A 3I4CA 1AE1A 5BMVA 1PJSA 3WGGA 5IH7A 3GFVA 5AVRA 1CETA 1WKCA 1VJGA 1L5WA 1PNOA 1B43A 5AVOA 4M8KA 2R97A 2FUG1 2GN0A 1HTBA 1R8JA 1T3HA 4NTZA 4ZQEA 1H69A 3OIWA 2RDMA 5FHRA 4DSAA 5DSZA 3J7TA 4QYTA 4OXXA 4O2AF 1OY1A 1T5HX 2IXTA 5JSYA 2YWFA 2ZRCA 1FXSA 1K8YB 3CZMA 3FPJA 3QXGA 4ON9A 3G9ZA 1ZITA 5KYUB 1LBIA 3RSOA 4MA0A 3RDPA 3Q88A 5FUYA 4E09A 2CF6A 1RCTE 1HNXB 3AF1A 3B2NA 4EMTA 3WG9A 3L4KA 3RTBA 3KQLA 3V1YA 3V5NA 1DJLA 4CLXA 4AY4A 3W3ZB 4NOJA 2C4UA 1EVIA 2Y67A 4MVJM 1JFTA 1CWUA 1WXXA 4DMFA 721PA 4BAGA 3DS8A 4R1OA 4XARA 1Y37A 3KDSE 4UEOA 2E9SA 1EK6A 1S4QA 2I3BA 1UEJA 3IH5A 4A6PA 1DEKA 3H5AA 4KMSA 3LC1O 1YMVA 4UCFA 4LSGA 5C53B 2E2WA 3EUEA 1RAEA 1SXGA 1XLTA 3BM5A 1C30B 5INTA 1E2GA 1NN1A 2ZI5A 5C7OO 4D9GA 2CXRA 2AOUA 4YS6A 5DZSA 5K8LA 4QNRA 1W75A 3QWIA 3R4CA 4IGEA 1NWHA 1C9NA 1U0NA 4Q4DA 3HCCA 3ABIA 5LM3A 1T2EA 5IAGA 5KX5B 3AVYA 1E77A 3IT1A 5MGNA 3FPGA 5DWQA 3FPSA 4WV3A 1DAKA 4MARA 1VHTA 3JYPA 1VE5A 3HFGA 2V54A 5JSHA 1FTSA 1EFVA 1SBZA 1YFLA 1KFJB 1T6BY 1U2DA 2BUBA 2OXRA 2VDUE 3FRIA 4JKYA 2B4KA 5HS6A 4BC0A 1NVMB 1R0RE 2HA2A 3IKVA 4I08A 5FPPA 3ZNNA 1V8ZA 5LWQA 4TM8A 1AMNA 3FCOA 2PWAA 4GI2A 5D3KA 3AI1A 3BGIA 2BBOA 3OZAA 5KU7A 1DUSA 3GN1A 4RELA 4MX8A 1JXAA 3QMPA 2BD0A 2OKGA 1LNSA 1GFWA 1TADA 4II2A 3B3AA 3V2IA 1Z08A 2YHIB 1ZH4A 1ZNZA 2Q0HA 1FB5A 2KPOA 4RC9A 3VC2A 2ZQZA 4IJ5A 2ECKA 3JAMA 5GONA 4AQ7A 3QXSA 3HA3A 4US1R 3MPUA 3AYZB 3UH1A 5ARBA 1JQKA 1RXVA 1YL6A 3O73A 1DNPA 2BTQB 4X66B 1J7JA 4N18A 3I9LA 2Y0PA 3G23A 1WZ2A 1R15A 1C81A 1RZUA 1X19A 2QM7A 1H2RS 4GH5A 4D8YA 2B61A 1L8LA 2ZANA 4NCXA 4AW9A 5TGDA 4IX1A 4HLCA 5EJ5A 2RGAA 3EG9B 1LEHA 2HQSA 2DLCX 1I2MA 1TLFA 1FFWA 1XBTA 5IDXA 4OLJA 3CLVA 3O1JC 1GWNA 3MBKA 4MP3A 2VEDA 4DANA 4FILA 3BDAA 2GCOB 4HEJA 3PI6A 1RPNA 1TVMA 3DHNA 2RI1A 5PNTA 4CM8B 1IDN1 5BVHA 1CRWG 3RBXA 8ATCA 4B85A 1PVOA 4L7VA 4MWZA 3S2UA 3KYCA 2JAPA 2RHCA 2YJTD 2I80A 1THMA 2UV8A 4UHDA 4DBZA 2G6TA 1FNMA 2I6FA 4MWSA 5SY4A 1L4MA 3M83A 3TLCA 1C3OA 3PD7A 3OLVA 3WJAA 3INGA 4YBRA 2ZGVA 3VJKA 4IDQA 4BS9A 1NKVA 2WJPA 3IQFA 2VDWA 4LWOA 3EXG1 2QUBA 5JEDA 1Y6JA 2CVQA 1GL6A 5ES4B 3NYQA 4UNIA 1Q1QA 4XSGA 4X1OA 1MIHA 3B51X 2BGKA 3QKSB 3ZXIA 3FETA 3FXAA 1QIFA 1IXSB 2R6DA 3F3SA 1YDGA 1RMTA 3R9IA 3HDQA 3LLMA 3QQ5A 3SNKA 3LOQA 4GI7A 2OC9A 1ZIDA 1R88A 3PPXA 1T2UA 4R9RA 4OMCA 4NPCA 1ZK2A 4X1IA 5BYKA 5ED4A 4D42A 1G2IA 4WMLA 5LP6B 2ORYA 3DBVO 4KZKA 5DVZA 1DKRA 2I4NA 3DG9A 4HFJA 4OQLA 5M7EA 4IDFA 1BWRA 3RYHB 3UMVA 3O8OB 5KHOC 2GBLC 4OQEA 2DEUA 2O7RA 3LP6A 3PLAE 4OGKA 3P94A 4DGSA 4FX5A 2DQSA 3SJ7A 3THWB 3KALA 4LCBA 2D2XA 4LJ6A 1OROA 3GIDA 3U09A 1Z88A 1M83A 4ZAFA 1ZN8A 1QC5A 1BQ3A 3D2AA 4I8IA 1KQNA 1P7VA 4C3VA 3MCWA 1NJ8A 5IMSA 5ITZA 3GUZA 3L4JA 4CMBA 4QEZA 1S2NA 1OYVA 2B5WA 2WMOB 1YD7A 2BY4A 3OIVA 4ROSA 3TXYA 1NTOA 5A4AA 4DIFA 1UJBA 1E7YA 2POCA 1EIWA 3WLEA 4F46A 4FZ5A 4QOIA 3ZD9A 4BO0A 3ND8A 2HLHA 4X71A 4X8LA 3IAEA 1KYQA 4LZOA 4AZWA 4L1KA 5FBWB 3ROXA 4AUNA 2ECOA 5KX5A 2HZ7A 3IKMB 4MA4A 1R8SA 1ZZGA 2GFHA 3SICE 1H2AS 3AKDA 1NW4A 4HNSA 4J0KA 5JYCA 5A5DA 5JSZB 3DSRA 1XZIA 5L51A 2QRMA 4O4HF 1Z4PX 5TQ2B 3OFSA 1JAHA 1QFYA 3DTVB 1G63A 3LSTA 3MUOA 2XVMA 1SR8A 4H1TA 4OHUA 3VTZA 3WQQA 4ABYA 5KMGB 4JIGA 5KYWA 2QVYX 4KN5A 4BCBA 3UAOA 2LTAA 4HN4B 1OXSC 5A0FA 4OA8A 1PSDA 4KLRA 4RFSB 4CMIA 3S2EA 2X8AA 2FKNA 4BXOB 1XCLA 4D4HA 2WD8A 1JEAA 1T1GA 3GEHA 2GKSA 4OB7A 1VJ5A 3TKLA 5IKMA 1Y5NA 3C48A 3R7BA 1WCV1 2GBCA 1R8YA 3UW3A 3ZHYA 2P78A 2RHOA 3WIBA 4U7GA 4F85A 1QO7A 1UMCA 5FB3A 2VQEB 2MSDB 1L1QA 1PLKA 1ZOPA 3NAGA 3Q6NA 3DQQA 5CYFA 2ID7A 1XG5A 2WG2A 4G0NA 3KB1A 3AHJA 3FR7A 3SOZA 1VSTA 1AZLA 1FBTA 3GROA 3OZIA 4IEFB 3WZ2A 2PH1A 4ZO8A 4Q1EA 4DDTA 2IDKA 2XD9A 1DG9A 2JGFA 1OB5A 2P6UA 3S2GA 3DT8A 5GZ3A 4MDYA 4L78A 1NVAA 5JYDA 1W1IA 7YASA 4XJTA 1FX0B 2NIPA 3E3OA 5IARA 6PFKA 3UTDA 3V32A 1E3IA 3EVDA 4JT8A 2H59A 3ZHQA 4EFNA 2NAFA 4DN6A 3BICA 4D0LB 2FNAA 3T9FA 3AVTA 1T1JA 3B1WA 1M5TA 4RPJA 4JJFA 2CXXA 3COSA 2G09A 3JQ9C 1L4NA 3CTPA 1K63A 5JJ5A 5KMGA 4EMSA 3HMKA 3H8WA 2Q9UA 4QM6A 5REQA 4LYFA 4AIIA 1CY8A 2BT4A 5K3AA 4NESA 2F8MA 4YJ2A 2HRCA 3BAZA 1NXOA 2ZVQX 1JWAB 5EINA 2IPXA 3B8EA 4EKYA 2C5EA 1DL5A 3FGNA 4RCZA 1ZEJA 4KG7A 3EVAA 4HUJA 4WCFC 3UG6A 5L3QA 2IHJA 2JZNA 2XCQA 3AHHA 3L9WA 1BXGA 4R7GA 4Q3KA 3ZW9A 5AWFC 1QONA 4DTCA 1N3LA 3SE7A 2LDXA 1Q84A 2AZ4A 2YUIA 3HBFA 1LPMA 5FLXA 2VJQA 4F06A 4XVHA 3DUFA 3WR5A 3DEKA 4NR0A 1TA0A 3AFGA 3SXUB 3RRZA 4G0MA 3V80A 4GOND 1VZ3A 2TMDA 2FR1A 4KXXA 4Q4JB 3BTUA 5IW8A 3VDNB 4DNPA 2G1KA 4L5BA 1A5TA 1UWVA 4E12A 4JXXA 2A9FA 3BE6A 5CFMA 2GNAA 3I0ZA 5FOUA 5TNXA 1OFUX 2Q5HA 3VNSA 3H2IA 3ZEAA 3VA7A 3VTKA 3TIIA 4FWIB 1KBZA 2AXNA 4IMIB 1UFOA 4AG5A 5DGIA 4EFDA 1CZOA 3KDPA 3G7SA 4LGCA 1QO9A 1OAKA 4OMUA 5KAMA 4FXOA 1J2EA 3VH4A 1J90A 4R5MA 2YHUA 4MXDA 3GD7A 5EHQA 1T6NA 1O1YA 3QJYA 4ZK2A 1XF9A 3UQYS 1I7LA 3MXTA 3HK2A 2IU0A 2VH1A 3EDOA 5HQTA 5A4DA 1V4NA 2Q7XA 1FDVA 4FFMA 3HL4A 5E4JA 1Z0KA 2VNHA 1N3IA 3OCJA 1LZLA 1SRRA 2ZBUA 4QHYA 4RVFA 1LLUA 3WISA 4KVFA 5KTKA 3VDXA 4Y2YA 1UKVY 4BGIA 5BV8A 3ILHA 3FCEA 2FMTA 4QRIA 4DVJA 2SKCA 4EL0A 5JVDB 5JNWA 3UJPA 5KJCA 1U1IA 4ZEWA 2DPLA 3NZEA 4CMJA 4HEA1 4MVJE 4P4UA 4K5QA 4KXFB 2YQZA 2QPOA 3SYLA 3UK1A 3W0LB 3JTEA 4CODB 2X4LA 3I04M 1N2CA 2EFCB 4GMHA 4QBGB 1FUEA 3K16A 5AVWA 3HP1A 1F8YA 4GSYA 2I2AA 1L9KA 3WL7A 1KAQA 3ICQB 1M0WA 1NZJA 1O6ZA 3G9QA 4CRWB 3T3NA 5A71A 5CD1A 1FPMA 3EPLA 4LI3X 5IM5A 1QUEA 2VG8A 4URUR 4JOBA 3A9CA 5AI8A 4NBKA 2GJ8A 4UU1A 4WEOA 2J3JA 2HF7A 5ALGA 1D03A 1GITA 3E9QA 3HGQA 2FLVA 4UFOA 4B33A 5B2EA 3PDCA 1GSAA 2PUJA 4G1BA 4XWKA 2A5FA 1G2QA 1UXKA 1ZEMA 4PS0A 4DIMA 3WO1A 4MS3B 4BLTA 1U65A 1W35A 3DXFA 3GX1A 3LUGA 2ZBGA 2HMAA 2ZJ6A 1M7BA 4GYWA 1ULHA 1GPUA 4PNZA 1NRXA 1ZL0A 4ARSA 1NF2A 1NVBA 5KWJA 1P62B 2HPHA 1EWRA 1FBNA 5C81A 3ZDQA 4MJXA 3S1LA 2ADOA 2XBUA 2V7QA 1RHKA 1RLJA 2VOEA 1GUBA 5C80A 5KBYA 1YOVB 4FYPA 1L7RA 2JBHA 1VMAA 3PCXA 3V9PA 3LUCA 5UKDA 3SSMA 1A88A 2BE9A 3ANSA 2NN3C 3GFTA 3T15A 3TTVA 1ZG3A 3WLIA 1YHYA 4KUHA 2QSYA 3PYLA 1Q2UA 2VUUA 2ODEA 4DYHA 4N0PA 4BCDA 4BMOB 5FWNA 3L84A 1MXHA 4ED9A 4WJZA 4W63A 4GXTA 1XQVA 3CNEA 2HU5A 3E05A 3LW7A 4FD3A 4O2BA 2VR1A 4WL0A 5JSKA 5C8YB 1JBQA 3IBCA 2UYOA 1F4LA 1USUA 5FPQA 5TARA 1RLTA 1R3UA 3K5PA 2R25B 3IAUA 5DLPA 3EXHA 4CMHA 2EJTA 4ZEVA 2JNWA 1PFYA 2AEEA 2FWJA 3DMFA 1I33A 2XNDD 4FX2A 1MPXA 4G5GA 4I8DA 1QZUA 1PZGA 2B78A 2RK4A 4L50A 4MB6A 5NULA 3V4VB 3K96A 1NVWQ 4D9KA 4MKRA 4HHEA 1QKKA 1RZVA 3KOMA 4RMNA 4AS1A 5DBIA 5FXMA 3K9WA 4PXSA 2PDAA 1U1EA 4QECA 3WLQA 1X1EA 2NXNA 5C4IA 2QNRA 5FPTA 1QQ5A 3R7NA 1RPAA 2BBSA 5FTWA 2UUBB 2XCOA 2XE4A 2B9VA 4JL6A 5JXHA 5IKXA 2V1XA 2R00C 3SYTA 1KR2A 1DIAA 1OFUA 3BH7A 4YT8A 3JAKA 4PBSA 4POOA 3SYMA 3CUWA 1JLHA 1OX6A 3HCFA 1ZYUA 4UM9D 3VZCA 5I48A 3E5RA 2FXVA 4FQ5A 2HTEA 2ZT8A 1Z5NA 4UTVA 1PWXA 1T34A 4FQ7A 4PSVA 1Q7RA 1O0BA 1T8RA 1LRKA 1KJJA 2B82A 3MEQA 4PZPA 4Y8VA 2DLDA 4S24A 1B76A 5E9JA 4CM9A 4EFLA 2H11A 1CVRA 2ZSUA 3DE4X 5FOXA 3FZGA 1NV8A 2HWWA 3RUDA 5FUXA 1B6TA 2HNBA 2P9JA 2NSLA 1E18A 4QO7A 2CXSA 3CONA 4ZAVA 4BLVA 4G0YA 1SBCA 5DK6A 3EXFB 4EMBA 3IOYA 1PSZA 1KYTA 4OAOA 3RI3A 5KJ1A 3G6KA 2YZMA 1N7GA 2G9ZA 1OLOA 3AKYA 3R3ZA 2WJYA 4WCDA 2FA9A 4NOLA 1UEIA 4V39A 2YHAA 4FMBB 4NDAA 1KU6A 1BXKA 2MSLA 3L4BC 1Q11A 2CCKA 4ADSG 3KKKA 1YE5A 5E9AA 4BNDA 2VNAA 1KKLA 1UPTA 4GKJB 4OV6B 3QYFA 2DFVA 2FJUA 4O4IB 5AKHA 2NPIA 3ZGNA 4HNRA 4JEIA 1UK6A 4EMUA 5B5SA 1R9NA 1R18A 1OWNA 221PA 3SLRA 3EGDA 4DQDA 121PA 1U80A 2I1WA 4R1NA 4K2AA 2EIXA 1N6PA 2V6IA 5COBA 4KE6A 4KFCA 4O0LA 5KHAA 2ZSBA 2WFMA 1R6BX 1JG6A 1IAVA 4X1KB 1H0RA 4QG3A 4K9RA 4TXMA 3FNFA 2JDIA 4QC2A 1NUUA 3PHGA 4M0PA 3OU6A 5KNBD 1H2ZA 2XB6A 2BH2A 1R12A 4A2PA 2PGNA 2O3RA 2WU3A 1VL6A 4XD7D 3RV4A 4B40A 1Q14A 1XD9A 4GYJA 4S2EA 5JS6A 5BSEA 1K06A 2I3ZA 4YT2A 4G4JA 1KHHA 1LD3A 2VDVE 2E48A 3EPPA 4BQRA 4H7DA 5AK5A 2VF8A 5AJVB 2ODBA 2VCHA 2W0MA 4AMBA 2QPAA 2IOQA 3H18A 5ALXA 4M86A 1QHSA 3VH2A 1G5QA 2AI3A 4ZAYA 1THTA 4M0MA 4CGZA 1R0CA 4DF3A 3QELA 1DKMA 1QG0A 1A8IA 4QUAA 3SLGA 1VDMA 3TN7A 3WB9A 3GP5A 4XDGA 3S8MA 4CMKA 1OLSA 2ZYDA 1OR8A 3OM9A 4PIPA 4JLJA 4XGNA 3RSLA 3UJCA 3VSEA 3I2YX 4ZAWA 2VHXA 1XL1A 4TL7A 1KPHA 2YXDA 1ENOA 1WMSA 2WSYB 4N3GA 5F3WB 4H4CA 4LNUB 1TQ4A 4W5JA 4EB6A 2PTGA 1YOVA 4J16C 2ECPA 2I2CA 4V0MA 2ZOSA 4GUDA 1Q7BA 2VPQA 1RJEA 3ZNQA 5I9IA 2REBA 1JA0A 4YT4A 4M8IA 4G0VA 4R2IA 1RYBA 4N76A 4C7VA 4OM8A 4MHOA 5EFOA 1CY6A 1ADFA 4F71A 1VB3A 1H5QA 1H8HA 2XNJA 3TIGA 5ITVA 5KCZA 2W2LD 2ZWPA 3VR5D 3S7ZA 3PRYA 1TFUA 4AJKA 4RTPA 5FTNA 5C9ZA 1JAZA 2CK3A 3V46A 4AP9A 5C1BA 5HRCA 2QMHA 3WGJA 1K92A 3I39X 4LSWA 1JPUA 4I55A 1TECE 3WK5A 1EJ6A 2FPMA 1Y34E 1VKJA 1NLYA 1WPXA 2A5JA 1GZUA 2CBGA 3HFSA 3KOYA 3I05A 5LB4A 5K03A 2QL7A 1YQGA 1RVDA 1CC1S 1GEEA 1JPVA 1PV1A 3DOIA 1P2FA 2C9CA 4M1QA 2B1GA 4D4KA 2FGJA 3F7NA 4YB8A 2JCVA 5IYZF 2Y77A 5AP9A 5G1OA 1LF0A 4M6WA 1SXJA 4US2R 4KOAA 2L18A 2IJGX 4QFDA 4DCNA 4Y9SA 2C5AA 1XD2A 4Q4AA 5JW6A 2W6ID 2G8LA 1B1AA 3PK0A 4I1IA 1ZU4A 4QDZA 3G17A 5FKJA 5TGZA 2PMEA 1E0DA 3OJEA 4LSZA 3ANNA 4BEBA 1CJUC 4JITA 4DCUA 3KQUA 3DOHA 5KC9A 2D74A 4AMGA 3M0EA 4KU4A 4PZYA 3EF0A 4YV1A 4LNAA 1MN6A 1H42A 4RVUA 4A10A 5ICMA 4BNWA 1LX6A 2RHWA 1CUCA 1U7WA 5FPYA 4CV1A 1TAUA 4CPDA 3V8VA 3AEYA 4BAZA 3WMWA 5JWOA 4IDPA 3QYPA 1JE0A 1G21B 3KVYA 1E2EA 3AERB 4IJ6A 2AXEA 4ZCLA 2D0OB 4CIXA 3Q12A 3DD1A 4Q37A 3L0SA 3DE6X 5LUAA 4TUYF 3GAZA 4EYEA 1AKMA 5K2MA 1MB3A 2M6RA 1UOOA 3O4IA 4KB5A 3C14C 4X9XA 4JV5B 4BQOA 3B82A 1WVMA 3ABRB 3PKZA 3CIFA 4EKGA 3CX4A 2EL9A 1H23A 2DJ5A 4IGIA 1C5KA 4ZZ2A 1LLDA 4WK0B 5THXA 1S9DA 3QI7A 3L4BA 2FVXA 3IBYA 4WKPA 1AK9A 1OI3A 1Z07A 2F67A 2V6JA 3ASUA 1T43A 2GWRA 1A1SA 3O4FA 4M99A 3VH3A 4EPYA 4JBWA 4EKIA 1B2LA 1YBMA 3HJAA 3NCTA 2Q3FA 3MJSA 4XRRA 4DM4A 2ZQ5A 1I30A 3RUAA 3NWPA 4OD0A 3JVIA 4QOFA 2XB4A 3MIZA 2CY0A 3LK7A 5PGMA 1RYEA 5T64A 3AV3A 1NGSA 4OKIA 4NL4H 2KJQA 1O4VA 3OJCA 3PNOA 3QOWA 3LZDA 4QO8A 4EATA 5DFAA 4MQ6A 1WCIA 2H6EA 1BXGB 2O2IA 4O4JF 4UBKA 2CLLB 3KKOA 1YR2A 3SSNA 4ZGWA 3X1KA 5I7VA 2PUCA 3OQ1A 3KTFA 4D5GA 2OWDA 1AJEA 4IOJA 1NN5A 3QH4A 1YZGA 1GCGA 4NZNA 4OHFA 1V96A 3DDUA 3NETA 2X5OA 1VBKA 2MOKA 4MGHA 3RTAA 4O5AA 2XCRB 4LV5B 4L5AA 4IVQA 5IVKA 2V9ZA 6REQB 4PZCA 2WG1A 3KPYA 4B48A 3VJMA 4I36A 4KXLA 2Y71A 3E2IA 1NQOA 2WSBA 4UHJA 3LKDA 4MQBA 4GLJA 4BNHA 2NG1A 3KD2A 3W3AA 4ND3A 2GHQA 3PPVA 2KM1A 5EOVA 1C4OA 4XIGS 4WBXC 5HWSA 4OJTA 3MZ0A 3BL5A 3F5DA 5J1SB 2ZUSA 1I7DA 3SR4A 4KRFA 5KYWB 2D1RA 1FX0A 4IXDA 1H0SA 2F2TA 3OOEA 3W5VA 4EGAA 4F6RB 1DMSA 5JPCA 4QYSA 3TX6A 5JJLA 2BGWA 2V5VA 2I7DA 2H0QA 1JLLA 1LTHR 5IVPA 4RUKA 4XM1A 1PD0A 2P30A 4DCPA 4A0GA 4BXOA 4F2GA 1ZLYA 4XDHA 3ZDAA 4KNVA 1X2BA 1TM7E 2BP7A 5CXXA 2QP4A 1SUSA 4MYSA 3KPVA 2HD4A 2YW9A 3P8ZA 1NXSA 4YXWD 3UXEA 4KNYA 3L7DA 2DKFA 3Q5DA 2QD5A 3BWYA 4KH1A 4BNXA 4KR6A 4CCWA 1KK0A 3AKZA 4N03A 2W58A 1T3ZA 5DHTA 2EZ8A 1ZDMA 3DM9B 3CT4A 4HAIA 2AG1A 1UZAA 2C2WA 3AILA 4N0DA 3TLXA 3C5WP 5HDBB 4BWFB 1FJGB 3M5PA 4PRKA 4TTVA 3QG1A 5BV7A 2P3QA 2O23A 2BWJA 3LHDA 3N75A 5MDHA 4IGFA 5LMCA 3RREA 1L4FA 4OATA 1O97D 2XWBF 4NI5A 2YWEA 4RU1A 1UF9A 3W8FA 3HKEB 2ZXEA 3S7TA 3U40A 1VLQA 4HB0A 4RIIA 3P9SA 5DHUA 1EJ0A 421PA 1VFNA 4BFTA 2JJ2A 1N6LA 4FN5A 2JK0A 3FYDA 4YFYA 3PPYA 4LY0A 4B75A 3LBYA 1XQXA 3M3DA 2C96A 3Q7RA 1TCVA 2XDAA 3CZ9A 4D74A 4KPYA 2V6GA 3H75A 4GMKA 5A7FA 1NJFA 2J7KA 1OXBB 1PLJA 1A9XA 1RQPA 5DM1A 2NQTA 1RKXA 4NZOA 4Y0NA 2X0IA 4TVKA 2I2WA 4WBSA 5EJIA 1KJYA 1PS0A 1Q0LA 2CUTA 1AX9A 3A6EA 4MV5A 1B16A 3EVFA 4RTRA 3RARA 4F11A 3UTCA 1YDWA 2BFFA 1P19A 5E4FA 5K3DA 2DM6A 3VI3B 4UM5A 4NNOA 4PZ0A 3NYIA 4C4RA 2B25A 3AM1A 2R8BA 3EWIA 2P7HA 3AOEC 4WUTA 3UGTA 3UYLA 4L5JA 1UKBA 5LZ7A 4DARA 3M6VA 1I4EB 1YS9A 5LPNA 4DV4B 2EF0A 4RMIA 3ESZA 3Q1LA 3UUWA 5KVQA 3U0VA 3QA9A 4CBVA 2P91A 3NHZA 1VKHA 1S8OA 5HBGA 4JUDX 2PWZA 2C07A 4HDAA 4MTLA 1E3MA 3KYCB 1MIOA 4HJXA 1W47A 5EVCA 4LAFA 5TMEA 4HP8A 1JWBB 4IDOA 3COZA 3LM8A 3OQ6A 3LGSA 3KVOA 1HGXA 4AMZA 4EHFA 1AO0A 3CKMA 1P60A 3ER9A 3BE5A 3KKZA 4JEUA 1IIBA 1XRSB 1OWOA 2HLNA 4GZ3A 4XD7A 4CKWA 3SAJA 1V37A 1MX5A 2WIDA 3A1VA 5LQKA 2ZTMA 2JLXA 5C51B 2HCJB 3OF2A 4RA9B 3A1UA 1NJSA 4K8RB 3H8VA 5DDIP 4RZ2A 3GNLA 4JP2A 4KLZA 3ELYA 3OO0A 2XT9A 5FAXA 1KEEB 2YOHA 4BZPA 4UPDA 2ATCA 1SO8A 1W88B 2H54A 4M21A 3H5NA 3SF0A 3R9KA 3ANXA 1S9HA 2AQIA 4NFYA 1XAHA 4Z2YA 3VISA 4DSNA 4MR9A 4DDUA 2VJDA 3N59A 5K4HA 2FX3A 3L7BA 5FBLB 4WFKA 1PFQA 5BNFA 3AB7A 4N4AA 2VQ6A 1EAYA 4UEWA 2P2YA 1Y9JA 3D8BA 4MINA 4WZBE 1EK5A 4KPGA 3FKQA 3RRBA 2PYZA 2EFHB 3PC8C 1DLJA 4Z8XA 4QJBA 3FJYA 2R6AA 4GBMA 1A4RA 4R41A 2R7MA 2PKWA 4LJYA 1AXGA 5E6SB 2DFDA 1CUUA 3NVAA 4MI1A 4LOJA 5BMVF 4ZVKA 3V7FA 3U1TA 1ZH6A 4LOHA 1MT3A 3C1AA 4EG6A 3E9NA 2V9CA 1II0A 1YB4A 3NDPA 3KL2A 1C1YA 4YALA 3SEAA 4OL0A 5FI1B 4R98A 1WMEA 4TLEA 4YJHA 1QB7A 4N39A 1HE2A 2ZXFA 4JXJA 3EVEA 3WRVA 1NNSA 1ZK4A 2AJLI 1UCFA 2NSJA 4QAQA 3SD7A 3N8NA 1IN8A 1WW3A 3DFFA 4MQEB 2B4YA 1DX4A 2VHJA 5ARDA 1VCHA 1Z7YA 2NUPA 4ATNA 2XRZA 2RKWA 1TK2A 1GQRA 1PFVA 2C8KA 3G0DA 5JAHA 4JDPA 2XODA 3P52A 1KMIY 1DIRA 4WIAA 3TW4A 4CCYA 1XJ5A 3IBGA 5EKSA 1G7SA 1R5OA 2GEVA 3CLSC 3HKEA 2NO4A 2HHHB 3AR5A 4GIBA 5ALRA 2I78A 1JU4A 4PPQA 2H8GA 1JAXA 1GD1O 2HF8A 1SHLA 2ISCA 1OVMA 3UB3A 2IH4A 1ZXBA 5DGDA 2A4KA 3OFND 4OK5A 4CQMA 1VDZA 3G88A 1J8VA 2XKJE 3VNQA