5FA5A

Crystal structure of prmt5:mep50 in complex with mta and h4 peptide
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein arginine N-methyltransferase 5
publication title Disordered methionine metabolism in MTAP/CDKN2A-deleted cancers leads to dependence on PRMT5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/protein binding
total genus 212
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5fa5A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5fa5A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5fa5A02
3OBEA 2OY0A 3OZRA 1G38A 3F4KA 5DX8A 4HRAA 5DRTA 3KPYA 2JG3A 5LQAA 3P9IA 4YTRA 3U3HA 3OZSA 1XISA 1X1DA 2AOUA 4DZRA 2Z6QA 3JWHA 2Z6AA 3ID6C 4QTTB 1O1HA 5KYGA 2BH2A 1XDUA 5F2NA 3BWWA 5FUBA 3ELDA 5CCBA 3EEOA 2Z6UA 5DT2A 3KCJA 3KBWA 4RVDA 5FQOA 5EQJB 2PXXA 2I56A 2CWWA 1ZGAA 4XUCA 4K3ZA 1YZ3A 4X63A 2BZGA 4M38A 2JJQA 4PYMA 4QE1A 3XINA 2YQZA 3KBMA 4YTSA 3LCUA 4QE5A 3AYVA 2IBSA 4OA5A 3U81A 1DIDA 3GXOA 2YUIA 3ME5A 3E8SA 3ER8A 3C0SA 2R3SA 5CVDA 5EC8A 5ICFA 4E32A 3ITYA 2B25A 2PX5A 3C0KA 4YUYA 3VNJA 3JU2A 3P2KA 2P1DA 3M70A 3TRKA 2FCAA 2BR4A 1L3BA 1A0DA 1QZZA 2QY6A 5EMMA 1S5NA 3NTVA 3LSTA 5E1DA 2NP7A 4RTNA 2PT6A 1XP3A 5DRYA 1JTFA 3H2BA 4O29A 5EGSA 2H00A 3RIEA 4FGZA 3SSMA 3OU7A 4ZTBA 2Q41A 1N7IA 4HSGA 3OCJA 4PWYA 3UZUA 2XYQA 3UVAA 2CMHA 2HNKA 2PJDA 2XYVA 3K6RA 1ZGJA 4WVLA 5HOQA 1KR5A 4NECA 5GP1A 5K03A 4CXMA 2P8JA 4FZVA 5HILA 2IDKA 1ZHFA 4EACA 4M36A 1VPTA 5XINA 2AZTA 2VDUE 5H1WA 2B78A 3DR5A 5EHGA 4ER5A 5EKUA 3NVKI 2EJTA 2CL5A 3PX2A 2VP3A 1XJ5A 3G2PA 3KQVA 4V0RA 3LDGA 3KBSA 2ZVJA 4F84A 5G02A 4XSLA 8MHTA 5I7GA 2OB2A 4R8RA 1YUBA 2ZBRA 9XIAA 4KW7A 4GQBA 1KIAA 3SR4A 3SXJA 5MHTA 3FTCA 3KQYA 3OPNA 3NMUF 4Q7IA 1JR4A 1QYRA 3KU1A 4E2YA 2Y1XA 2OYRA 3THRA 2ZULA 2DPMA 3KR1A 4BP1A 4E2ZA 2FPOA 1XICA 2H1RA 1XLMA 3PB3A 2O0LA 4HH4A 4YUXA 4HC4A 1I60A 2ZTHA 5FQNA 3DLIA 3FYDA 2AN4A 2IH5A 5T64A 5EZSA 1X1CA 5B80A 3C6KA 3A7EA 1RI4A 1IY9A 4A8LA 1U2ZA 4HGYA 5CM2Z 5EPEA 4B17A 1R74A 3M0XA 5KVAA 5K0CA 1G6Q1 5GIPE 2AVNA 2C7RA 4RTQA 4OA8A 3KPJA 1D2HA 3ITXA 4EMSA 2ONYA 5CVUA 2IFTA 2AOWA 5LQCA 4AZSA 1XXLA 4C07A 4PIMA 3GNXA 2C7PA 4EKGA 1VP3A 2JH8A 3DH0A 3O31A 3KTCA 3FUTA 5LQJA 4XSMA 4ZB5A 2IH2A 1I9GA 1RI1A 4Y30A 4ER0A 3PX3A 4MQ4A 1MJFA 1XINA 2CMGA 3M6WA 4MWZA 3LCVB 1OR8A 5GWXA 2ZIGA 1R18A 2PWPA 4P7FA 5ERGB 3HTXA 5BP7A 3THSA 3CQHA 2GH1A 5EMJA 3MTIA 4QPNA 5AVNA 2KW5A 5EEHA 2I7CA 2WA2A 3LKZA 3VC1A 3A27A 2NXJA 1G60A 1PJZA 2Q02A 3B5IA 3E05A 4DUOA 2VDVE 1MUWA 2NQ9A 4RTRA 1VQ1A 1YX1A 2AOXA 2ZWVA 1XIHA 3BZGA 3HCEA 1RI2A 2PX2A 2R6ZA 3FPJA 3MHTA 1SG9A 3TC3A 3M0HA 4EQZA 3QYSA 3ELYA 5E1MA 4GJIA 2B3TA 3OFKA 3HM2A 3PTAA 1VLMA 5DWQA 3R24A 3BXOA 4R6WA 1R6AA 3HNRA 4R05A 2A14A 3PT9A 5C9ZA 2ZBQA 5DLYA 2QUMA 3DX5A 4QDPA 5FA8A 3TKYA 2GS9A 2O06A 3EGIA 4M7RA 1L1EA 2AN5A 4KDCA 2PKWA 3GU3A 3SSOA 1XLIA 5K0EA 4YV2A 2UYCA 1NW3A 3TQSA 2BR5A 2AOTB 2G0WA 2OPBA 5E2BA 3CQKA 4PCLA 4FSDA 4X61A 3XIMA 5H6HA 5LQRA 2B9EA 4QTUB 5CUQA 3SSNA 1R8YA 2IIPA 3G2MA 3P9NA 4BP3A 5BW5A 4DQ0A 3UJ9A 1Z3CA 4PNEA 4PFHA 2PX4A 2PXAA 4YV0A 3VNLA 3BZBA 1YFLA 3R0QA 1SUIA 5FHQA 3DMGA 3RW9A 3XISA 4DCGA 5FWDA 3KCLA 3DXYA 1L3IA 5EVJA 3ITOA 3C6MA 4P7JA 2I62A 2GVEA 1JG4A 3A26A 3R3HA 2P3QA 4BLVA 1XLAA 1H1DA 2WA1A 4X60A 3A4TA 4AUKA 2IBTA 3LX6A 2PWYA 2VDWA 3KPWA 1JG2A 3I9FA 2ZBPA 3NDIA 5EEGA 3AWIA 2YVLA 4ER6A 3UA4A 1OADA 4M37A 5CD1A 3TPZA 4GUAA 2G8NA 3KPVA 1XLKA 5E9WA 4GOLD 5DTRA 5EZQA 1Q0TA 3L23A 4QEHA 3VNIA 4RVGA 2ONZA 3EMDA 3TM4A 2XINA 5K01A 2G1PA 3MAGA 2V7EA 5B7YA 1DXIA 3O4FA 3P2EA 4JXJA 5K0LA 3T0IA 1KPHA 3N4AA 1XTPA 3QOXA 3PFHA 1RJGA 4MIKA 2OXTA 4BLUA 2ZZMA 5K05A 4G56A 4RVFA 3UJDA 3TOSA 4OVXA 2YR0A 2ZW9A 3HA5A 5FA5A 3NW9A 2XYRA 4XUDA 2FYTA 4ZB2A 5B7ZA 4A8IA 3DXZA 3GO4A 1NE2A 3KQQA 3LKDA 5GM2A 2JH9A 1S5MA 3KHKA 5LQUA 2ZSUA 1SUSA 4XIAA 4DA4A 2QUNA 1QAQA 1KHHA 3EVDA 3HCCA 1MHTA 3FVMA 1P1CA 4KIGA 3I58A 4A6DA 4CTJA 3QZAA 3CQIA 4HG2A 2O07A 2XVMA 1BHJA 2G70A 3GRVA 3SX0A 2ZZNA 5FULA 4XCXA 1NBIA 1Q0SA 1XLEA 2GLKA 2P3LA 1I1NA 3CBGA 1N7JA 2NYUA 2P7HA 3FUUA 1PRYA 3JWGA 4HTFA 4PYKA 4RWZA 3UU0A 1ZQ9A 4MTLA 3OE5A 4QVGA 5T67A 1XYCA 4CTKA 3M6XA 1FJXA 4QDKA 3BT7A 2YXLA 3IHTA 3KCOA 3FZGA 1XIDA 2PT9A 3M33A 5D1HA 1QUMA 2PLWA 3QV2A 4PIPA 4DKJA 2IH4A 1XYMA 1XVAA 3A25A 3G2QA 2E5WA 1ORHA 1B42A 4PYLA 1KYZA 5KS2A 3HA7A 3CQJA 3A7DA 3CC8A 3GRRA 3CNYA 5E1BA 5DTQA 3ITVA 3FPEA 1XDSA 5HFJA 3P9CA 3ELUA 3LL7A 4POOA 1JQEA 3GWZA 3EVGA 4FS8A 5CIYA 1EIZA 4ISCA 4C04A 3C0QA 3C0LA 4X1OA 5F2KA 5BXYA 5XIAA 2ZWAA 1HNNA 2NNWB 3LHDA 3CKKA 3NJRA 9XIMA 2QULA 3P2IA 3RODA 4YTQA 5H02A 4C06A 3FUWA 4L7VA 3B3JA 5K0NA 4E70A 2BR3A 3UXIA 2JHAA 4QPPA 3KBJA 2NQJA 1FPQA 1O9GA 2PSSA 3DULA 2FHPA 5EG5A 4RTJA 2IPXA 5ICCA 10MHA 1WS6A 1KPIA 5B1SA 3JWJA 5K0BA 3ORHA 5HEKA 4BY9E 3BUSA 3T7RA 5KQSA 2WK1A 4GJJA 4FT4A 5U4XA 4DCMA 3MCTA 4MHTA 3NWEA 1JQDA 3P71T 4PINA 4EK9A 4X41A 1ZKDA 1DE6A 3BGIA 3EEYA 1VP9A 3G8AA 3HCBA 3QC0A 5EMLA 3KQSA 1TW2A 4RX1A 3UJCA 4LG1A 5CVJA 2IP2A 2G4JA 3G89A 3GRZA 5HZMA 4HHMA 4ZB0A 1XDZA 4IWNA 4E33A 1AQJA 5DM1A 1SQFA 1WZNA 3BGVA 1RI5A 4J4KA 3BWBA 3LBFA 2EJUA 4PYIA 1D2CA 5LSAA 3M0VA 3LECA 4RSRA 3FPGA 3FUXA 2F8LA 4KW2A 3HCFA 2GAFA 2ZCJA 3M6VA 4E3VA 4XUEA 3HVIA 4EAYA 1XIEA 1NV8A 3TVAA 1NT2A 2HCVA 2ESRA 1G55A 1NW6A 2PX8A 5K0JA 2QW5A 2NQHA 3ITTA 1XLJA 4PYNA 1EJ0A 2HV9A 4RTKA 3LDUA 5XIMA 3DBNA 3LMZA 3NWBA 4A8RA 4PGGA 3D2LA 1EQAA 4KDRA 4HNOA 3U0HA 1XIMA 2QM3A 5DM4A 3V97A 5TNVA 2FK7A 2PY6A 2IDJA 2NP6A 1O9HA 3FPHA 4KVZA 2C7OA 3KR2A 3KWSA 2OKCA 1Y8CA 2HWKA 5HIKA 1YF3A 3ITLA 5FADA 5FWAA 8XIMA 1DE5A 3UA3A 1G8SA 2YXDA 1EJ6A 4PYQA 3BGDA 3GCZA 3OZTA 5DSXA 1BOOA 5IKMA 4UOEA 4CKCA 4F86A 1F3LA 3KBNA 3HVKA 1ORIA 3VC2A 3DTNA 5K0GA 3MGGA 5DTMA 2IGTA 4KIFA 2EX4A 2ZFUA 3IV6A 3M4XA 1R8XA 4GOMD 3UFBA 2GA9A 5ICEA 3MQ2A 3AJDA 3EVCA 4KRGA 3BWYA 2XISA 1NBHA 2UYQA 5DM2A 4P7GA 4RTSA 4YTTA 1IM8A 2GYIA 3EVEA 3S68A 2ZDSA 2ZLBA 2FK8A 1UFKA 4PCAA 4AZWA 2UZ4A 1P1BA 4YTUA 4QDJA 4CWAA 4YMGA 3FTEA 5T6BA 2ZIFA 3G8BA 1UIRA 3QOWA 4DMGA 4GLEA 3C3YA 3TR6A 3DMFA 4OBXA 4RYLA 2HK0A 1BC5A 1RJEA 2AR0A 4HTFB 1QT1A 2ERCA 4IKPA 2PVCA 2AVDA 1A0CA 4LWOA 2BM9A 4GOND 3OU2A 3BWCA 3M0YA 3B3GA 5DXJA 8XIAA 4BLWA 1XYLA 3P14A 2ZIEA 3EVFA 1D8WA 3GIWA 2AOTA 3VNMA 1D2GA 1F38A 4OQEA 1R00A 2DULA 4YUVA 1EAMA 1JG1A 3DXXA 3EVBA 3JWIA 1INLA 1K77A 4XISA 2P7IA 4EKIA 5M5BA 3AALA 3HP7A 1FP2A 3P9KA 5K8VA 4E31A 1XLGA 4RTPA 2XIMA 1RI3A 2JHPA 4ATNA 4PONA 3UJBA 1X19A 3HCAA 4R8SA 4FT2A 2QYOA 2YXEA 3IUIA 5FHRA 3PLAE 3TLJA 3WQOA 1JTEA 4V0QA 5JR3A 4QQNA 1BXCA 3CVOA 4AZTA 5E2AA 2I9KA 3M0LA 1P39A 3GGDA 2OZVA 3ANXA 3E23A 4PYJA 3K0BA 2X7WA 4HHLA 3ELWA 4QVKA 2HMYB 4YUZA 5GINE 4RV9A 5C0OE 1DCTA 4ZBCA 5HIIA 4QDWA 2GB4A 2QRVA 1V39A 2UYHA 3FRIA 2N47A 1X1BA 2PV0A 4KWCA 4E2XA 3NGFA 2QRVB 2XBMA 5DSTA 1N2XA 1XYBA 1DIEA 3EGVA 5EKXA 3UJ6A 4RVHA 3KR9A 2GPYA 3KKZA 3KQMA 4DF3A 3REOA 1NW8A 1XLLA 2VZ9A 3IUDA 1YZHA 2Y1WA 4HGXA 4GEKA 4OQDA 2P41A 4HGZA 3C3PA 1QAMA 1I6NA 3B89A 3WSTA 2CKDA 4FSXA 1T43A 4XKMA 5EHIA 3SVZA 4YMHA 4C05A 2ADMA 2G72A 4ER7A 3GJYA 1WXXA 3FYCA 5K0FA 4Z2YA 1P91A 3M6UA 4GOOD 3CJTA 4P58A 2O05A 3PVCA 4C08A 1XIFA 4AX8A 4RTMA 2C7QA 5DXAA 6XIAA 4PGLA 6XIMA 1VE3A 2HTEA 2UYOA 3DP7A 4IV0A 3BKWA 2AS0A 3AXSA 3UWPA 3PS9A 3ER9A 2ZVRA 4GF5A 1MNZA 2AOUB 4K6MA 3VSEA 1AF7A 3KQWA 1XIJA 3EGEA 7MHTA 3EVAA 3M0MA 4YV1A 4PYOA 1AV6A 4AZVA 5J8LA 3DOUA 1GW9A 2I57A 3E7PA 4QQKA 1KXZA 1XLFA 3G7UA 3FRHA 3P8ZA 1VL5A 2AOVA 4QEEA 1M6YA 4A6EA 1YFJA 1TZ9A 1XIBA 2EFJA 2P35A 3MCZA 4U7PB 3TKAA 4Y2HA 3BANA 3LPMA 2NXCA 4DM3A 3G88A 5DM0A 7XIMA 2JHCA 1NV9A 3CCFA 3BDKA 1X1AA 3LDFA 3TM5A 5ICGA 4LECA 4ER3A 3OU6A 1SVUA 3KBVA 3Q7EA 4QE4A 4LWPA 4US6A 3HEMA 9MHTA 1JSXA 3CGGA 3G5TA 3T7TA 3G5LA 4WXHA 1NW7A 5GM1A 1L3CA 1WG8A 5K09A 1I4WA 3MTEA 5IH3A 4W4QA 2X7VA 3O7WA 3IYLW 1QANA 3SMQA 3Q87B 1M6EX 3DUWA 4CKBA 3FTDA 4IV8A 5LQNA 3P97A 3GRUA 3KQOA 2ZZKA 3AAMA 2EG5A 4H0NA 3OFJA 2AN3A 5P8WA 1KYWA 2HK1A 3BWMA 5FTWA 1QTWA 2OU4A 1KP9A 2H11A 1XLHA 3ERCA 1RJFA 2O57A 3NDJA 3R6TA 5F2OA 2OB1A 4GC5A 1BXBA 1RJDA 4YUWA 3IUHA 1XLCA 5FCDA 3TFWA 5EMKA 3UJAA 3TMAA 5E8JA 3CJRA 1IXKA 1VIDA 3HA3A 3SM3A 3P6LA 2QE6A 2PGXA 1CLKA 3OE4A 1NW5A 5CVEA 4XIMA 3BKXA 3V8VA 1M0EA 1EG2A 4E30A 3I64A 1FP1D 3L8DA 3T7SA 5LQKA 3QXBA 2OBFA 3I53A 1WY7A 3VNKA 1AQIA 3SGLA 2V74B 2G71A 3EMBA 1FBNA 2BM8A 4LNCA 2OO3A 4K1GA 3G2OA 3PFGA 4GBED 4FP9A 3VYWA 3LGAA 4OBWA 1L9KA 3KR0A 5DX0A 5DX1A 5GIOE 3AXTA 4P7KA 5E9JA 1VBFA 2P40A 2YX1A 3AY0A 3KQTA 1YB2A 2HR1A 2GUBA 5BW4A 5LR6A 3EPPA 2K4MA 4EVIA 1XLDA 1XIGA 1HMYA 1WXWA 5E8RA 3CJQA 4RTOA 1ZG3A 5EOVA 5CCXA 5EIFA 1SQGA 4E2WA 3DMHA 2PBFA 4F85A 2YTZA 1A0EA 3LCCA 4R6XA 1QAOA 3X0DA 3KPUA 1JG3A 1TPYA 3LBYA 5CVVA 5JUWA 3HVJA 2I6GA 2GLUA 2VS1A 1JQ3A 2ORED 3DLCA 1XIIA 4DVOA 2B2CA 1DUSA 2NXEA 1BKYA 2PXCA 3EVZA 3FUVA 1UWVA 3IEIA 5AVHA 3R9XB 3MERA 1NKVA 3UJ7A 5HIJA 5HIMA 5E9QA 5E1OA 3HCDA 4C4AA 3UBTA 3BZJA 3KQPA 5KQRA 3CWHA 3HVHA 4PGHA 3MB5A 5GOZA 5EIWA 3I5UA 1JSZA 4CKEA 3VYLA 4RTLA 1SKMA 4GC9A 4C03A 4FR0A 3B3FA 2XVAA 5D1NA 3FPFA 4OX9Y 1TW3A 3NVMB 3UJ8A 5C1IA 3AYTA 3GNLA 4U7TB 2NXNA 2P3OA 2LD4A 1G8AA 3FTFA 1XLBA 2J6VA 1XCJA 3B7PA 3GRYA 5DPMA 2FRXA 1O54A 1DL5A 3GDHA 1KPGA 1XYAA 4A8NA 1XCLA
chains in the Genus database with same CATH superfamily
1DHTA 4HOZA 4FFSA 5HKKA 4BMOB 5KMYA 1AA1B 1OY1A 4F2WA 3E12A 3A24A 1N1GA 1SBCA 4DJDA 1DOZA 1N8KA 5F5LA 1DC6A 1XRPA 3ZQ4A 3UPUA 4TZTA 1J6OA 1YS6A 1X7FA 4DUVA 1S5NA 1KCLA 5E1DA 2V2HA 4R9RA 5DM70 3EXG2 1H2RS 3QPUA 1UBMS 3QUAA 4TXEA 1C8XA 4WVLA 1T8PA 4CKQA 4M36A 5F4BA 5H1WA 4NL4H 4EVZA 2UZ0A 5T9BG 4XYGA 3VE9A 1D4ZA 4RNCA 1UKSA 3V33A 1CXLA 1SHTX 1B93A 4A73A 3EQ6A 2V98A 1TLTA 3VBEA 1D6MA 4GXQA 4O3FA 3NBFA 2Y77A 3DV2A 4LCSA 1MTZA 2AI1A 3KX6A 2F2HA 4L4ZA 4G1VA 3FUTA 5LQJA 4XSMA 3BG5A 1GLVA 4EVRA 3R6WA 3L2IA 4KEMA 3EC2A 3WIOA 2NXIA 4FMPA 2WLTA 1RP7A 3VGPA 1ZY2A 1PKMA 4P2VA 4HCJA 3LY8A 1E8DA 5HMSA 3AKEA 2XKAA 3NQEA 5FLXA 2CLEA 1EB9A 3S2MA 3RMJA 4JYDA 3Q40A 1B57A 2BEWB 3WB2A 4E3WA 3F3YA 1SCKA 3DFOA 3OLCX 1NW3A 3E0XA 2CF6A 2IKJA 3L6UA 3SSNA 4CM4B 2YVQA 3W1XA 3DMGA 4JGDA 1M7OA 4EG3A 4I19A 3OVRA 4F38A 2W11A 4KH2A 1C9DA 4H1HA 1NBME 1T36A 1OK4A 4XM1A 2EEZA 2AKAB 3QH4A 4X8OA 1I3LA 5CXXA 3DONA 1OFRA 3GLIE 5JVDF 1R86A 2WBLC 1C0PA 3QYFA 1ZAHA 5K9CA 1DQRA 2WAMA 4GI9A 4N4QA 2VHVA 2Q8LA 4ID9A 3GX1A 4HJXA 4PW0A 2R82A 4IISA 5A9SB 4HTFA 3IGFA 1H42A 4EJSA 3UR5A 3U48A 1B41A 1KM1A 2CYGA 4C2UA 1FFEA 1MC4A 4MX8A 3Q8WA 3QUSA 2AJTA 4RPJA 3EGDA 3EDQA 8ADHA 5FWXB 4DLBA 2EG9A 2AWNA 5G2HA 1HO4A 5B1SA 1EDOA 3OZEA 4IO1A 3GLSA 5C7VA 3H9BA 2BSLA 1XROA 3S2JA 1Z75A 5CIWA 1WX0A 4JHXA 3RS7A 1YKFA 5FB3A 3CSUA 1KY4A 1U7TA 3CMMA 3KLLA 4L74A 3I5YA 1XKLA 2O3QA 3N3BC 3IE0A 2BFMA 4URHA 1Z44A 5AVTA 2DF8A 2G0NA 3LMZA 2ZR7A 1YOVA 1E2GA 3WNCA 3W72A 4BIIA 4PYQA 1SVLA 3UQYS 4TKUB 1M6NA 4RABA 2PV7A 3ZE6A 2HLDD 4L78A 3CF0A 4AJLA 3O8QB 2ZYSA 4P3YA 3O90A 2Z9BA 3GEHA 2AD1A 4KRYA 1I0IA 5AUOB 2CFOA 4K37A 4NQRA 4Y6RA 4UDNA 1INLA 4PAQA 3TCKA 1E6KA 4N4PA 2H8ZA 1E4LA 2CHRA 1PZFA 1M10A 1V3UA 2XPCA 3K8QA 1R9GA 3WQOA 1W36D 1N82A 3JZEA 5K2MA 2XUDA 3I2HA 1EF2A 5FL3A 3L41A 1M2FA 4BX3A 2BVYA 3HI6A 4ABTA 1W2VA 3DD1A 2XYLA 2Z2XA 3FNRA 3FFWA 4QTXA 1PR3A 4JQYA 2WKJA 2O05A 4JB3A 4QBGB 2C7QA 4KETA 3NHJA 2IWHA 1XE3A 1K7FA 4J3UA 4NE9A 3NPUA 1YQ9A 4EUHA 1RKQA 3HZ3A 5H2ZA 1VL5A 2RC6A 4CD5A 1UT6A 2ZCVA 4A3SA 4POAA 3MTJA 3MLAA 2GSJA 1E77A 1DQUA 5A04A 3PXBA 3QKSA 1E3WB 1KOLA 1GT8A 3LMKA 3M5WA 2A0XA 1X8CA 4KGDA 1ECFA 4MVJF 1DQYA 4LU0A 1O7AA 1YPIA 4HTYA 3I8OA 1BXBA 2Z00A 5IMBA 2H6EA 4D97A 3OIWA 4OL9A 2PA3A 2G71A 3OICA 3CPRA 2VWTA 4JI7B 1R0ZA 3VAYA 3NGLA 2IYSA 1E1CB 5AYIA 4D8WA 4B7XA 3URMA 2VYCA 2B61A 4C7GA 1TJPB 1XC6A 4EEKA 5JUWA 2GLUA 2YL9A 2QMQA 1YMVA 1KTVA 5CITA 1QW9A 4NATA 3ET5A 2OOFA 1ZICA 4JZ5A 2SICE 2C95A 2DPEA 4KV9A 4JEUA 4NVTA 4YJ3F 1LX7A 1WMEA 1GD1O 5DU2A 1DL5A 3M6FA 1E9SA 3Q45A 4HRAA 2PO5A 3UJSA 1S1CA 2QLNA 4HPXB 4KGZA 1WB5A 3T3NA 4RPCA 2V03A 4TMXA 2P53A 4MVXA 3T3HA 1MMFB 3QE0A 1UODA 2ETVA 3JU2A 3VIJA 2Z1MA 5LA6F 1IBKB 1PPIA 3E9QA 2AOSA 2C99A 3TXVA 4AT1A 1R46A 1V5EA 1MPXA 2XYQA 2HNKA 1OHHA 2OZLB 1K86A 1E6SM 4KN6A 4V3BA 4EYGA 5CT6A 3LHVA 2OC4A 5TVGA 1HT1E 2V4UA 1TD9A 1XDGA 3VPAA 2VHWA 3C1OA 1VHLA 3EGXB 3HG7A 2VDNB 1FSPA 5HA7A 4A8LA 2WZIA 3K0AB 1UASA 3QFCA 4XEHA 2W70A 2R6CA 3HPQA 3L82B 4YX9A 1UC4B 3HBAA 1P0BA 3S1UA 3TCNA 1OT1A 1CUJA 3GBVA 4ZV4A 1DTEA 4NDNE 1AH2A 1YJAA 1D2EA 2EZ8A 3DHWC 5LNWA 4P92A 2TYSB 1R18A 2JFWA 4YCAA 3GC6A 3TVDA 5AKHA 4D8XA 1C2YA 4LTDA 3A1SA 1QP4A 2WUFA 4L85A 5I4KA 1O5TA 1JJBA 2FKPA 1QGDA 4GYYA 4AKEA 3ANTA 1GP2A 3KKEA 5SY4A 3FHQA 2AN5A 2B7BA 2XQIA 3SSOA 1CW2B 4DBDA 4O33A 1RAAA 4ZYLA 3TIVA 2R1LA 3FJYA 3SN4A 3CWCA 1VL1A 2XN1A 3B1FA 1K9DA 4QM6A 3ZZ0A 1TYGA 2F8MA 4OLBA 1H7PA 1BE8A 1H61A 1DXYA 2V0NA 2V7QD 4LNUB 2J0UB 4L7QA 2VELA 3NH6A 2EIXA 2PS2A 4O54A 4GKBA 1W9UA 2IOFA 4X6YA 3DPSA 4LSBA 4RW3A 3MSDA 3QMVA 5A7FA 1CYEA 2VFEA 4DIBA 5SYNA 4KIEA 1QNFA 1NL3A 4BKPA 3MN1A 4A6DA 4LDRA 1NI3A 1SC6A 3C3KA 5A9SA 2GTIA 1RMQA 4IPTA 4TS9A 3S1AA 4JQ4A 3R40A 3VCNA 3ZUPA 4IOMA 2HMAA 2AH5A 2OT3B 2J5RA 2PWDA 4OBSA 1MC8A 3G1AA 4FS8A 3EGDB 4G89A 2G4CA 4LFAB 1Y6FA 2ZJ2A 4UTXA 4BF9A 2GWRA 5A6LA 3Q88A 1ZX1A 3NCHA 3R3JA 4FOJA 3KQSA 2J7CA 3HBJA 1JAKA 3H11A 3GAYA 4YT5A 5JD3A 3M0VA 1BMFA 2IE0A 3RGWS 1XZGA 1PGJA 3L1KA 1J0ZA 2R8EA 4AIUA 5K8CA 2WWRA 4EW1A 3DBNA 1TUXA 3S1LA 4ZOQI 4H1ZA 1XH2A 3VR6D 1CHDA 1GKKA 2WNWA 2D2GA 1EFRD 2EZ9A 3NX4A 2FWRA 3V8QA 1GVHA 3AICA 1ICQA 4MDPA 4BX2A 3PXXA 5JFOA 4JOCA 4RENA 1LNSA 5ALPA 4DIAA 5D7NA 4EWLA 1KZHA 5JFTA 2BMDA 3N04A 1YTKA 3RUAA 1LDEA 3U9TA 3KAQA 3NLLA 3UWUA 2I4MA 4KOAA 3GZJA 4JR0A 1XF1A 4QLJA 3E0IA 4WSJA 3ZWVA 2HMCA 4QQUA 4LCJA 2QYOA 2GZSA 4PZPA 2FPYA 1UMBB 2VAWA 4M9QA 2VP8A 2Q4RA 3W3AD 2YJQA 3KS9A 1E72M 5JW6A 2IXFA 1NNLA 5EE0A 2J9ZA 3D0QA 1S3SA 3PI7A 3VX4A 1ZD4A 4E7PA 1EVJA 2P41A 3FA2A 2ZZ2A 1HF3A 4JBNA 2CYCA 3W3AH 4KX3A 4DG5A 2CHOA 3LKBA 5I45A 3TQTA 2MR5A 5JIBA 3WCZA 4NC9A 3J81k 3HYLA 4B3LA 1XG4A 2FN7A 3QFEA 4ZXOA 2R25B 4XUGB 1XCBA 2Z1BA 4PUMA 3CF2A 1Z9AA 4O4HA 3WNVA 4I3FA 1JKIA 4GIBA 2TSYB 2C31A 2HLNA 1GTVA 2NUTB 3PCXA 3KOMA 2H48A 3K16A 4XZLX 4QG9A 4MUFA 2CLMB 3FFXA 3QX3A 3KP0A 4FX6M 3VDBA 4QFMA 3UG3A 3BWMA 4IFEA 3LC1O 1YZUA 5CYFA 1VA4A 4B85A 3VJKA 1QF7A 5ABGA 3V8VA 4QJ5A 3I64A 3PSHA 5JCOA 4LVOA 3RJ5A 1YT5A 3GPIA 4AWEA 3DOIA 3RABA 1GTL1 1LLFA 2D7JA 3WF0A 4U2BA 1YZTA 3TONA 1FXWA 3WK0A 2VJCA 3H9UA 2QYSA 3IP9A 2F1OA 3F9IA 4TV8F 3E5NA 4IKOA 1YIOA 3WGJA 2XVAA 2J3MA 3F6YA 1S2VA 5IK2D 4XSHA 3V1NA 4E6MA 2QAGA 1EHYA 4BN4A 2XZ9A 3DBHB 2CDCA 1Q77A 4QSHA 3T9EA 1RBLA 4MKRA 4LFCB 3I39X 1KJ9A 5ALUA 1W9VA 1ZBDA 2IF0A 2PDHA 3IRSA 4PTVA 4IFRA 4IQ0A 2IOFK 1K7XB 4RUBA 1EJ7L 4J7AA 4K9SA 3RC7A 5FI3A 2WWIA 1KU0A 4I7VA 2Z2AA 2Z6VA 3C6YA 1YHYA 1FRBA 3F8SA 4M1SA 3TN5A 4S0XA 2DQZA 4ZT7A 3ERPA 4RO0A 4YUXA 3LCLA 5A6MA 3QBUA 4B17A 3OQ6A 4Y2RA 4HA4A 3HL4A 2I3BA 5IJ0B 2ZTUA 3P82A 3VNBA 1AMUA 4FONA 4X1KA 4DG8A 4CETA 5ERGB 1LLCA 4IMPA 4EA8A 3O91A 5AVNA 1GNVA 3AU8A 3NRJA 1NR7A 2I9UA 3D0KA 2FR8A 3LLDA 2YHIB 5A3QA 4TZ0A 5A8QA 2NW0A 4ARZA 1FH7A 3EWWA 1V8BA 3F7OA 3FDIA 2H07A 1ULHA 2YL8A 4QJ4A 3FUCA 4LISA 4RMJA 1CY1A 1JAYA 2H5JA 3UXLA 2WCGA 2DHCA 4G1EB 2EQBA 1EO5A 4JFAA 5DLDA 2GQ8A 1GXSB 3RGTA 3E7XA 3NQVA 5FWDA 1V1MA 5DHAA 5B4VA 5KNDH 3QXHA 2I62A 3SWWA 3RRNA 2DH2A 4P22A 2JLCA 2E0IA 3CWZA 2JEQA 3A2LA 3AG5A 2IUYA 1EIXA 1VLWA 2HISA 4J3FA 3WL4A 1EA7A 2OQ2A 3JQEA 1V11A 5CDUA 5K6AC 5TS3A 5C9RA 2QUBA 3CX4A 3V8PA 3AB7A 4KI0A 2W42A 3M1LA 4XIAA 7PTDA 1VIVA 5CPOA 3DKLA 5LMUB 1NBIA 4MY1A 1JL3A 1GTHA 4CTNA 2IPFA 2CXUA 1PYFA 2FR0A 4YAEA 2O0JA 2QVHA 2H17A 4IRMA 3ELUA 1E63A 1A1VA 5CGMA 3VC7A 1NI4B 3AEYA 4QR6A 3I05A 2CBZA 4MP8A 3S5NA 2WZDA 4BY9E 1TJ4A 3K0CA 1QCWA 4JN8A 1MA0A 1SCJA 1ZCAA 3VNDA 1A71A 4LW8A 4KLZA 1DKUA 2G50A 4O1FA 1RY0A 2O9JA 2F8LA 4Z1YA 3U2QA 4MV7A 1WXYA 4LAOA 5HJLA 4G85A 1X6UA 2C13A 5AW4A 2PY6A 3NORA 1T5BA 3IVRA 1QSGA 5F1OA 4Z0TA 1C1DB 2AGKA 3ZZUA 2PZNA 2IU6A 1LS6A 2BMFA 2G37A 3D2BA 4EW2A 1K5GA 4RCZA 4KIFA 4GOMD 2PRKA 4D9FA 1DRUA 1JLKA 2Q1UA 4J94A 1W48A 3I61A 1AD2A 2E9SA 3PQDA 3FFBA 5IBCA 4QHRA 3N76A 1B9ZA 5EHNA 5GJNA 5AM3A 3EVFA 1R00A 1Q6FA 1ZUNA 4OLHA 3PJWA 1FP2A 2XIMA 3OTGA 4INAA 4CV0A 4ZE5A 3RK4A 2F55A 2OZVA 4YCCA 4ZK2A 1DLIA 2JFYA 1V39A 3QY7A 4TX8A 1ISFA 2GDQA 3CO0S 4PSPA 1E7RA 4H4IA 3VTKA 5A0TA 2AGVA 1KI8A 3UKOA 4HNSA 1RH9A 3S55A 3SX4A 2PDCA 2WC1A 2VJQA 4LVAA 1Z17A 1DV2A 1H41A 4HPWA 5DV9A 2QPSA 1KIFA 2NYVA 1R5YA 2DCUA 1ONBA 2NUTA 1EA0A 2AMGA 4AVNA 4PMXA 4A1OA 3VYUB 4FXPA 1EFZA 4LY9A 2FUCA 2R79A 4JFSA 4XUYA 4NICA 2HOQA 2A1TS 4K6HA 4YAUA 1RQHA 4YNGA 1E9BA 2ZRLA 4JAVC 4V38A 1NVEA 3AIBA 5MF5A 4HA1A 4R7GA 1E9ZB 1HWYA 2OHOA 5LOVB 3FI9A 2FU5C 2ADAA 2V30A 3GIQA 2IHJA 5LU8A 2CHVA 3RU9A 3TB6A 3PQ8A 1VSQA 2HMUA 1T10A 1E0SA 2HM7A 2WM1A 4N5DA 4GGOA 4Z8YA 4BAUA 5IAGA 2EF1A 2WICA 2AQKA 3UUWA 4GKLA 3R0XA 3WK7A 3AW9A 3X2EA 1U02A 2VK4A 3PCTA 1JCXA 1CB7B 4H1UA 4S1NA 3K5XA 1KKUA 2YN2A 1VBMA 1ONXA 4BX8A 4BJHA 5FEMA 1MZPA 4L5AA 4JJFA 5IBXA 1C1YA 1I5EA 1O6CA 1QZZA 5AC8A 3JD1A 5AM1A 1QI2A 3GVPA 5LD2C 4PRRA 3SK0A 3H9CA 4OUEA 4RD4A 4EAQA 1NBOA 1Z15A 3PFKA 4F2BA 1QIJA 2I71A 1TRKA 3MMXA 5IC5A 4LV6A 1C5KA 1IG3A 2WINI 3ATZA 1E32A 3ZZ1A 3KU1A 3VZQA 1NFFA 2YZKA 1KC7A 1H66A 3CUZA 1WZ2A 3EEIA 2NU6A 1Z7AA 3EBLA 3WL7A 5G4KB 2YZ7A 5BZAA 2A9FA 4MKVA 2GLXA 3OKAA 4X3PA 3HACA 3O31A 3D6FA 2HPAA 3LM8A 4MFEA 1X6LA 3SE7A 4KOEC 2ZUBA 4BNFA 3EY4A 4YPJA 2VBFA 1ZNWA 1MABA 4MAZA 4S3JA 3LQYA 1R6UA 2A14A 2ZBGA 1KI6B 5DK6A 3DMNA 3N29A 4B87A 4HQRA 4QROA 1IYZA 2B1IA 4G0MA 1WE2A 1II8B 1YR2A 1EWVA 1V1MB 5J4HA 3RRXA 2XE8A 3K8KA 3XISA 5A6BA 3ETDA 1NE7A 3EDEA 1OH5A 4ZRMA 4RVCA 4G7EB 3SEAA 4HPHA 4CR6A 3QU5A 4GH1A 1SQ0A 5I8PA 4L8YA 1P4SA 1OKKA 4RVFA 2INEA 4BKUA 2VHYA 1QAQA 4N49A 5C80A 2OO5C 4HVXA 4JAWA 1KAHA 2CFCA 4LXYA 4BNVA 3SF8A 3KWXA 2EG8A 1TA3B 1EPXA 2NYUA 1I7DA 2NN3C 2ZUEA 3L4YA 3VXGA 1QO0A 1SBTA 1FHLA 3T3PB 3I2KA 3QK7A 1RSCA 3QY0A 4EG7A 5A8GA 5D09A 3JVAA 4XV0A 1XDSA 4QE3A 3H18A 1UP6A 5IPFA 1Y3AA 2WABA 1L7OA 3FM9A 2JF0A 2M2IA 3WADA 3NQDA 1IIRA 3LV8A 1B4DA 2ZWZA 1VYSX 1QGYA 5E4FA 3ORYA 1M83A 5JS7A 2JKYA 4AJOA 5IM4A 1GR1A 3F7TA 3IP3A 1EJ2A 3PPVA 4GWEA 3DDSA 3EW9A 4EPRA 4DYJA 1HZYA 2AZDA 3O2QB 2W43A 1SELA 3EBVA 4XGRA 2CYBA 5KPJA 3TVAA 2CJXA 1MGPA 2RHJA 1Q12A 3IJQA 5HKLA 3RLUA 3WRXA 1Z36A 6YASA 2XNDA 4CGTA 5JG7A 1RLDA 4BGUA 2JQXA 3CZGA 1CIVA 4B6GA 2DG2A 1SHZA 1R27A 4Z1DA 3P27A 1WM1A 4ZKEA 1G8SA 3OLDA 2IEDA 4C4SA 3CM4A 4RIIA 5C9WA 2VC5A 1K5PA 3OKFA 1QRRA 5DISB 1O9BA 3PIDA 1R9ZA 1WOAA 3P5YA 1NTOA 4C2BA 5H81A 2QL7A 3KC2A 4GOND 1RD6A 3RAOA 4JYMA 4ESVA 2GFIA 5CB0A 2ESCA 3UXKA 4KVFA 2YXGA 3IUIA 4J2PA 4Y0VA 4FR5A 3ARVA 3JSXA 1DB3A 3P5SA 2QX9A 4H77A 2F1RA 1CZNA 1V47A 1FVXA 2OQYA 3NGMA 3SLRA 3ZTWA 4LYFA 5DEZA 4DF2A 4HS9A 2X9GA 1W4AA 3M7IA 1WP9A 3SD7A 2D20A 1JZSA 1QYDA 1GTMA 2PGRA 1DAFA 1RD5A 1JJIA 4BQQA 2NGRA 1SSDA 3PEFA 2O1SA 1WETA 2JK2A 1ZLPA 3VVLA 1U5AA 1QF9A 1LDGA 4LECA 2BOFX 4IWYA 5CVTA 4S38A 1WCGA 1W7AA 1FFDA 1G8FA 4V03A 1AQNA 2E2WA 4UM8B 2A3CA 3E1F1 4MGKR 3D4BA 4YRDA 2J9FB 2EF0A 5JNLA 1KBZA 3KAKA 1NYRA 4NULA 3L0OA 1EPUA 3M9YA 3FHTA 4F8XA 1D2KA 3LK7A 5ABPA 2NTEA 1LI4A 3TK7A 4FK9A 4N1AA 3KIPA 4AS1A 2HR1A 2DFKB 4ERAA 5EOVA 1M75A 5IZ4A 2C2KA 3D7KA 2CV2A 3QKIA 3NEJA 1DTWA 4NOJA 3SEQA 3LGDA 3OJ0A 1NDVA 3T6CA 4LY0A 1H23A 2J3DA 4ETNA 4JODA 4R5EA 4EAAA 3I01M 3C5EA 4KJXA 4XZ3A 5FBHA 1KZ6A 3DMTC 4X6UA 4ZGYA 2QUKA 1GNPA 1BXRB 4UXJA 5HJYA 4CYMA 4G1FA 2CLEB 1OYWA 2ZG6A 1QH9A 2ISQA 3KZOA 4EE9A 1U1GA 2Q09A 3NBUA 2CWWA 4GSLA 4X6XA 3FVTA 1ZIOA 5K8LA 2V7WA 3VOCA 1K4GA 1M1YE 1CXKA 4JGBA 1LOSA 5E7MA 1QP8A 2ODQA 1GKUB 2PA6A 4JI3B 4ARCA 3EQZA 4J07A 1FMCA 1M6VA 2Q3FA 2R1VB 1CEYA 3IUEA 3R8XA 2QTMA 5CQ1A 1CDOA 2H1RA 4ARBA 3ZWTA 1M66A 2QS9A 3DHPA 5BWFA 2P6RA 2W63A 3DE0X 2CF5A 1KZGB 4AJ4A 3WELA 4LYJA 3NXLA 1TYCA 2RDMA 3D4NA 1KOJA 2Z6IA 3BSFA 2GETA 5HZHA 1P3JA 1IY1A 2VTKA 5AK0A 5JNUA 4ASTA 3G1FA 2AE1A 3UXHA 1VG1A 5F1KA 1J0EA 1QLWA 3C8NA 4F4CA 3BEDA 3M0HA 1VPEA 1RPTA 3HNRA 3KM0A 1EFHA 1NNSA 1WHSA 2ZT5A 4M7RA 5HGJA 1V48A 2XB8A 2OPBA 4KQ6A 4YLYA 4AFYA 4WZAA 1PL7A 1W47A 3AF5A 2AEFA 3JTEA 3W1PA 1T8SA 3WQSB 1HDGO 1XU9A 5ESRA 3OQIA 5AFDA 1CR6A 4W5ZA 5T3YA 2KZHA 1RRPA 2PF8A 4R9OA 5I7OA 4G1MB 3U57A 1CZHA 1UUMA 3V4PB 3EISA 1YHZA 1U3CA 1LL7A 2WFLA 3R8CA 4UHBA 2BFEA 2FI1A 2TMKA 2Y88A 4L07A 3GY0A 3PD7A 1OXUA 4CIBA 4LUJA 3G1RA 2FSUA 3N9SA 3BT7A 2JJMA 1XQWA 3UCFA 1SO5A 5IUJC 5HFJA 4UR7A 4E2DA 1L4BA 1JCJA 1O5IA 1E3WA 3MB9A 2QRKA 4RTJA 3OO1A 4XH9B 1L8NA 3T7RA 4MWAB 3CUGA 4BZPA 3GH3A 1FWBC 1AUQA 3P71T 5KSZA 1EL3A 4WY0A 5A94A 3GJ8A 1XPJA 1CUXA 1PV1A 5EY5A 5IMSA 1ZCFA 3WSVA 2ZUNA 5LSAA 4B79A 1AW1A 1KM2A 1QPRA 3LY0A 3ITTA 4YCJA 2I7VA 3ICWA 3F2VA 5NULA 3ZN2A 2PWVA 2QM3A 4Y0AA 3NPVA 4KO3S 3WKZA 3I52A 2GN0A 5KWIA 3Q98A 2PT7A 3DOCA 2OKTA 1F48A 2WWFA 3VOFA 3JYOA 2CLSA 3QKSB 1UUFA 1SG6A 2FVLA 2DJXA 1ISZA 3QVXA 3RVPA 1XMXA 4LUYA 1QCCA 2DPGA 5FFFA 1IJKA 4KI7A 4AG3A 4HDRB 3BREA 1VCMA 1JXQA 2OXIA 3C6QA 4IDPA 2CUKA 1DIOA 2GD2A 2VX5A 2F62A 4MA5A 4MI9A 4OXYA 3GFRA 3SR0A 4K28A 4URIA 3LC7O 2NAFA 3E84A 1P2FA 1C91A 3OZPA 4JR2A 3AZRA 2L42A 4TTQA 3DBIA 3MF4A 1XQ1A 5GJBA 7ENLA 5CZ0A 4I4NA 2QJWA 3C5HA 1VBRA 2M6KA 4Y9DA 4GEKA 2QM8A 1J5TA 2C82A 2C5GA 1K6IA 5PTDA 5J4VA 2C97A 2D2VA 2H7CA 3TUIC 3D54D 4TWRA 4YV7A 3AS1A 3BKWA 1US3A 5AHMA 1CUUA 3OURA 3NEHA 3WLOA 4L9WA 4UTNA 1ZIXA 4TSFD 3RHGA 3KT8A 3KOYA 1SVSA 1TA0A 2VQDA 4IWXA 1GKRA 4WAUA 2NXCA 3IJ5A 1AXGA 4XVRA 1RPZA 1YONA 2AMFA 1SVUA 5CT4A 4TLBA 2A59A 1TTQA 2WVTA 1ZRSA 2AK3A 2FPGB 3WD0A 3SMQA 2O2DA 1UC5B 5KYNA 3DFMA 1JECA 3COSA 1U30A 1KJNA 2WMYA 3D3QA 2FB3A 4U2FA 4PODA 5KBYA 3HJCA 3G2NA 3A4VA 4LQ4A 2WSYB 3I68A 4X0VA 2W22A 4JBRA 3ZU5A 3QJGA 1U2RA 3INGA 3RILA 4MW2A 2E89A 4W5UA 4G0OA 1Y1SA 1J18A 2HV8A 1QH0A 2G4VA 1WAWA 5CHEA 1MFUA 2H3DA 3VI3B 3NNSA 4DA9A 1QX3A 1J5EB 1G8AA 2PDJA 2FRXA 3V7NA 2ICAA 1RAGA 1RLUA 3UB3A 3ZU2A 1GNTA 3UAVA 3ZKWB 4TYMA 1KBJA 1IZ9A 2VPTA 3EH1A 2Y92A 4RQBA 3LHFA 3HKDB 1GR0A 5I7WA 4R53A 3ZDEA 3H8WA 1EM8A 2FLWA 2EGGA 5EZYA 5LXEA 4QOHA 1YZVA 4O29A 2BB0A 2YJZA 3QMSA 3UZUA 5C18A 4LQ1A 3CKLA 2G3JA 3AHEA 3DOPA 1XALA 1YS4A 1IRIA 5IP5A 1L5WA 3E9DA 4OJTA 4PO9A 1BXKA 2VT2A 4PULA 1LF1A 5DBHX 2DPHA 5IAOA 4DAIA 1L6IA 3T9DA 2VUYA 4L9RA 1DJNA 3PDUA 1FKWA 5AC7A 1H2HA 3CC1A 1BG6A 4AVOA 3WWOA 3JZDA 3WRYA 4FHEA 2IU0A 4ZAFA 3PF3A 2H0RA 3U7GA 1JFHA 4HNRA 3KSBC 2H1OA 4MW0A 5L3RA 4Z4EA 1MO6A 3IT1A 4KFCA 1LT8A 3A27A 2HL6A 4JLNA 4UHKA 1Z2AA 4FIDA 5ITZB 5K0TA 4KIJA 1U8UA 3W5UA 2O7RA 2J7BA 2C5BA 4CL8A 4NBSA 3G1SA 4B4KA 1KMQA 1ZR4A 2ATMA 3VDHA 2VAVA 3HEBA 3AESB 4FR6A 5DRIA 1BIFA 2B69A 2BY2A 2CVFA 4LYAA 1YWGO 5LOVF 3LVBA 2E82A 2YCKX 1RALA 4JMLA 1LZOA 2DQWA 5IC4A 5JIPA 4Y7DA 3ZK9A 3O2LA 1GO2A 3H5OA 3UCCA 4UMDA 3GGCA 1ZRMA 1O0CA 3G8DA 3O73A 3C0JA 5DTRA 4I1IA 2F38A 4ILSA 4INZA 3RBVA 3FZYA 2PKCA 3UJ2A 4BATA 1YQ2A 2GKOA 1VPLA 1SUSA 5AW2A 3MHUA 3GY1A 2DORA 3WJ2A 1DBRA 2A5HA 4BNWA 1U0LA 1O12A 3KDNA 4PC8A 2ZKLA 4IL5A 3UCXA 2KHZA 4LOKA 4OJYA 3AJXA 3NWOA 2BW0A 4JLDA 1O3YA 3EVGA 1W37A 1G7TA 2QCGA 1E89A 4NJJA 4XRGA 2MU1A 1P1FA 3RM3A 2NQJA 5HEKA 1GRNA 2VA8A 2X5NA 3CIOA 3H3FA 2IUSA 1K03A 1BWRA 2NADA 2NVUB 2Q3MA 4XFJA 5KTRA 3JQPA 1UKBA 1LJUA 1X6NA 5KNBD 2JEPA 3C4JA 1ZD9A 1K6WA 2B4RO 3SY1A 4A03A 1EEXB 1H93A 4P98A 4CMAA 3JQCA 4D9BA 2NUBA 5J4LA 3UF9A 3K0EA 3ZGVA 4X62B 4L95C 2W2LD 1IN4A 2ABBA 2MSKA 4EHDA 1C8VB 1EFPA 4II7A 3W25A 2GEDA 5SV2A 4C1NA 3LWBA 4GBMA 4I4TA 1VKJA 4L0CA 1T0HB 3ES7A 1ZNYA 1JAZA 2HK7A 4CMBA 1CCWB 4Q5IA 2PD6A 4J0QA 3W5JA 4BEVA 5DVZA 3TB4A 4KESA 4KAJA 2YXXA 1LORA 3IT0A 3KJIA 4E31A 2E1WA 2JHPA 2NPFA 1Y7VA 4YS6A 1DQSA 5GONA 3FZNA 3SZ8A 4L4YA 5DCBA 4WA8A 2RGNC 3DDOA 3WGIA 1W88A 1AGXA 1JIUA 2IKQA 3QEMB 2B0MA 3MMUA 2W0UA 2GPAA 2O8EB 3LXBA 3RSLA 1BMDA 2PYDA 2PEYA 2PD5A 4GT1A 2C1HA 3MQ4A 1NLZA 3C14C 4IH3A 6XIAA 1N32B 1PX3A 1XI2A 3T2PA 3TD6A 5A1AA 4K87A 1U2GA 4MZ1A 5BWLA 1N2BA 1P9NA 1YNSA 1ZXBA 4HAZA 4TTUA 1EBHA 3LUTA 2WM8A 3QPBA 3V8RA 1I5OA 3MS7A 4R1LA 4DQXA 2XKKA 1VYPX 3RTAA 5JH7A 2B20A 3DYPA 2BL4A 1UC5A 4HZGA 3AEUB 5LYJB 3H21A 4RDIA 3ZT7A 2WWVD 5F51A 5E5CA 4TMCA 3UJAA 3L0ZA 3W88A 4IF4A 5BR8B 3SI9A 3ZEAA 3T4WA 1ABFA 3A9UA 2Z9DA 5FRDA 4GM0A 1AO0A 3KT6A 4UAUA 2ZXFA 1E6NA 2BP1A 1NMSA 4D80A 4GDMA 2PDPA 3CL8A 2G9ZA 1QRSA 1DT3A 3GUWA 5DB4A 4GCXA 3QSTA 4PLPA 2ZRWA 2LIPA 3CH4B 4JEQA 4UATA 2WFAA 5FI0B 3CL6A 3CPHA 3OVQA 3AI0A 1VP5A 3QLLA 2JJYA 3KAOA 2RUSA 1T41A 4BNHA 2YVUA 5DX8A 3Q41A 4DZRA 3PIIA 2IE8A 3NVDA 4EJSB 1P80A 4HDAA 2W37A 1YZ3A 2CD9A 1O89A 2QTGA 4ZD6A 1MB2A 4D9GA 1CIUA 4U3AA 1NR5A 1RAHA 5AI8A 4N9DA 3OQJA 5BVGB 1SBHA 2VI5A 3O3RA 2DKFA 2VHQA 3W7VA 2WHEA 2CNWD 2QDEA 4RGYA 3LUJA 2HHHB 4CQAA 1Q57A 3O2NA 3U4FA 4LALA 1EA9C 1QG4A 3FKSA 4CD7A 3PQ7A 2AN4A 1MV5A 2ORIA 2JAXA 4R0NA 1Y5VA 4EMSA 3CW2A 4ATLA 3ZVNA 1YB5A 5ALFA 1EUZA 2HWXA 1AUVA 3B1XA 1RLOA 4GYPA 3TPCA 5A03A 3ED5A 3ACDA 1KI4A 2PUHA 5FUYA 5EEHA 1YR3A 3ABOA 2CLPA 3VOGA 4BGEA 3ABRB 3GHYA 2E1DA 5C7HA 1ZK0A 4DDHA 2DT0A 2XX3A 3ZGNA 5KYXB 4D9MA 1QP7A 4PRKA 3VI2A 1H63A 2ZJ5A 1JDVA 2PU5A 3FAXA 1TKBA 3ZLJA 3TQVA 2BTOA 5H6HA 5KYWB 3IPRA 4TMZA 4C4XA 3ML1A 4R8VA 4OYYA 2POCA 4DC9A 3LTEA 2ZTVA 4ZOAA 3NUQA 2G8LA 3ZK7A 2GZXA 5DH9A 4R40A 3AI2A 3B8TA 1H94A 2C84A 2RAPA 3PE6A 1OXVA 2HDHA 4K9QA 1GFIA 2XVMA 3VTFA 1C7QA 4F2HA 3RIGA 4B83A 1PZMA 4MWGA 4ZQOA 4FO4A 4IIJA 1KJ8A 2PWEA 2JVJA 2RONA 4UFKA 2FSSA 4AX7A 1Z0KA 4HDNA 5D01A 1ODSA 4WJZA 3V3KA 4H9YA 2PLKA 4JTQA 3FGNA 2XOKD 3HJUA 5F7ZA 4H16A 4LOIA 3RB8A 1PR4A 1QPZA 3CLRC 3L4ZA 3QTPA 2LV8A 4Z2IA 1Z18A 1SO4A 2C78A 4Q6WA 1GUAA 1WE5A 3B9DA 1K6XA 2GARA 3VZSA 3P4XA 3PXDA 5GVJA 1ULZA 3K09A 1JZ8A 3GU1A 4LY4A 5DN6A 3VC5A 2E48A 3SFZA 5J5CA 4HNAA 3S8YA 3T81A 1BKDR 5I7SA 3OX2A 3UTDA 4MRVA 1W8SA 4YVXA 4YHGA 4EKYA 5BYKA 1VJ5A 3L7OA 5HG0A 5BPHA 2HRCA 2IDJA 4JLSA 1X7DA 2XUPA 1YA4A 4LS2A 2NV9A 4DY6A 1F3OA 1NVTA 1L6SA 3DE6X 2GAAA 3Q11A 4DLKA 2XVNA 2WSSA 3L79A 1PFVA 4HGRA 2XISA 3IBSA 3HMCA 3R25A 1KFKA 4GLEA 4LXQA 4B3BA 4YCBA 3CZMA 2HIAA 1CDEA 2P4SA 1TE6A 3VYTB 4LPCA 3DPIA 1HM5A 4NU6A 3MJCA 4DFDA 2UUCB 5KOJB 3DFNA 2BP7B 2JJ2D 3PYMA 1Y81A 4HTBA 1KGUA 2NVBA 2ZP1A 2DJ5A 2D69A 3KETA 1GAJA 1T26A 3EXEB 1ME7A 3L4UA 3TQCA 5LLDA 3L8ZA 1T4MA 2CETA 3AUJB 2CHEA 1DC7A 3G0SA 4K7YA 1NKTA 2ZRVA 4Q4KA 1SN7A 1DVJA 4BRUA 1SXJE 1E5NA 3GNRA 2AG1A 1BJTA 1MNZA 3QELA 3DOUA 4ND5A 4HK7A 5HK8A 2PSDA 3DXIA 3N39C 2OD7A 1C1HA 3GUVA 4AEFA 3DD5A 5FNVF 1S2CA 3R0DA 1EESA 4NENB 1ZD1A 5H8MA 4LYEA 3SEZA 1NXTA 1Q45A 1VZWA 2R00C 1F8UA 1A8UA 3AEZA 2V7GA 4XIYA 3LZ3A 3TJ4A 3FHOA 2HX1A 4MG4A 4MJ2A 1OAOA 1P5HA 3G2LA 3W7JA 5DELA 1Z8DA 2POQX 4L5BA 3F90A 4DV4B 3L6DA 4MCHA 2WLZA 2VNAA 2A7NA 2CLHB 3OIVA 4O19A 4MB5A 4WJEA 2XNKA 4G8CA 1U8XX 3V46A 2ORED 2V63A 3MERA 1RBYA 4ZVRA 4JU9A 4M0UA 4KUEA 3MZNA 1G7UA 1BQEA 4CUZA 2J79A 5A9TA 2Z58A 4FNSA 1XCJA 3AF2A 5E9XA 1NOFA 1YV9A 4AG0A 1W6UA 3E96A 3FWYA 4GFIA 3F4KA 4TTIA 5MGNA 2ZYFA 4WXEA 5IEBA 3TRIA 1ZU5A 2BMVA 5CW1A 4QTTB 2VKZG 3FWNA 4EF8A 2Q6TA 3L06A 4R01A 2DBVO 1LPSA 1YZNA 1EZ1A 3GTIA 5ICFA 3JS5A 1I0DA 1ZMOA 1FWSA 1SQ6A 4GJ1A 5K9ZA 1I80A 4N0RA 3AF3A 5KU1A 1KBQA 3I6ZA 1XNJA 1GTG1 5EHGA 2QIIA 4G7EA 5A8MA 3CLSC 3UAYA 2J5XA 2JZNA 2PL9A 5I7GA 2ZJ1A 5DZSA 1EBBA 1R4MB 5EL1A 4S2UA 3B51X 4ZU6X 1VSTA 2PX3A 1OX5A 5E1QA 1Z25A 3RYHB 2JARA 5CPTA 1USUA 2O4QA 2GJKA 4ZAGA 3FMOB 2VYFA 3CT4A 3RANA 4MOZA 2YMMA 2O2HA 3KT0A 2D2XA 3FPSA 3IACA 1E1EA 2R6FA 1BDMA 5EMJA 1J90A 5H4GA 2EFGA 1I2PA 1JFFA 2XODA 1A5UA 4I9HA 2JB9A 5LXTA 4QLKA 4J2MA 1QVZA 5FNZA 1MXGA 4LMAA 4PBRA 2PC8A 2WT8A 2PZ8A 4TLEA 1YZQA 2AFRA 3FVDA 5HFNA 5E2BA 5EI5A 3P32A 4FX2A 3I10A 3EB2A 3NETA 4FXJA 1Z7YA 3NAQA 4WA7A 5IM4F 3SFWA 5YASA 1UD8A 3E9RA 5MGBA 5IM51 4PXYA 2J7KA 4QBXA 1G5FA 4YAIA 4JLPA 2IBTA 3QFSA 4B8YA 1S5PA 3OJLA 4QATA 2A0KA 3GG8A 3F5MA 2QGZA 1DADA 3WHKA 5FPQA 2B2NA 2B34A 3PZUA 2ZS8A 1E20A 1ORWA 1WP4A 4QYSA 2H1LA 2DPLA 5FA5A 3LBHA 2IP1A 3SYKA 1ZI8A 4TROA 4YPOA 5D8WA 3GG2A 2V6BA 3RH0A 4RD3A 3GLGA 3RAGA 3OE5A 2IYVA 1N7GA 4FI4A 4NPAA 1EOMA 3K70D 5A5WA 1RHCA 5DMMA 1VB9A 4POOA 4RKRA 3V9PA 2PBGA 1EDTA 2JI8A 1T4CA 5IXJA 3MP5A 3EF3A 1QC5B 3DAYA 2JFVA 2RAVA 3S5UA 2J9FA 3QIAA 4KEUA 4DELA 1EX1A 1ABBA 2Y2UA 4M1EA 2FEMA 2D24A 3ASYA 3V8EA 3UMJA 3ZWPA 3SZRA 5KYYB 1IQRA 4R7ZA 3TJZA 4ZMSA 1MLDA 3ESDA 3SCQA 5MKGB 3GM8A 1SVWA 3FBGA 5J4KA 4QX6A 1DTWB 1ZP4A 1WBJA 1A5NC 1BN7A 2VYVD 1ZU8A 1M1NB 1DE5A 1HL3A 3PLNA 1VLVA 5JZSA 4J0IA 5LKYA 3AU9A 3PVSA 3DEQA 5JAPA 1WPXA 1U90A 3ZGYA 4A5SA 4YRBA 5IK2A 1PSWA 4OD0A 4PYSA 1RM5A 4BQEA 2C1ZA 5T6BA 1ZVVA 4E1VA 2FMNA 4AZHA 1Y8RB 1JGMA 4PNPA 4MGGA 2DULA 1I3CA 3CYVA 5JYCA 2VK8A 5ECGC 2FMKA 2Y1CA 3PNBA 1Z8AA 3WK2A 2HJSA 1IBLB 1RWMA 4MYXA 4R3WA 2YXOA 1ODKA 4YAGA 2ISVA 2ATVA 2G7MC 2C1XA 3JD4A 2QBYB 3V42A 3HPFA 2NAPA 2NYRA 2X5JO 5K3VA 1I1XA 5GPRA 1HE4A 4WIWA 3GJXC 2QOEA 2OYMA 4N3AA 4MPKA 3S8EA 3PZOA 4XVHA 2P0EA 5I51A 3HJBA 2RJHA 1V9LA 2DUXA 2ZIWB 3WYNA 4FDAA 1CUHA 3NQ8A 4AF0A 1CJMA 2PUVA 1WXZA 1Q20A 1KBLA 3WP0A 5I9LA 3CB3A 1DYSA 2HNAA 1R5BA 4IILA 4HA0A 2DY0A 5LDDC 2ZZ7A 3EWUA 2FGKA 1QFSA 1U0FA 2DLNA 3ZV4A 4M1WA 2GGSA 2WUVA 3TFWA 1CJTC 2R6JA 1F8GA 2NZYA 3L8DA 3BTNA 3DV0B 1YJ5A 2NSLA 3O9MA 1AY0A 2YZNA 2G67A 2OLSA 1X98A 4D0GA 2ZYWX 3KQTA 1EKXA 3IKTA 2EFCB 3HQOA 2EV9A 4QU9A 4TZ6A 2PDUA 3HY3A 4ZVOA 1IBMB 5BVHB 3MUXA 5K8UA 5E6RA 3ODGA 4D98A 3IVXA 2VD9A 4ENQA 2EKCA 5D1NA 5DCDA 3RUIA 3HKEB 4D9NA 4RV8A 3TDFA 3RFFA 3DO6A 1XCLA 1JR3D 2W6CX 4HB2A 2NO5A 3C3DA 3EFOA 2EFYA 1TJ1A 4GUGA 3U9IA 5TF4A 3N74A 4TN5A 2M6LA 5JAMA 4HQVA 3CZRA 2R8BA 4MAFA 5TPZA 5M03A 5EGSA 1XMPA 1UJNA 1N3LA 2FUEA 2CMHA 4AWBA 1GG1A 3WNMA 3PC8C 4M83A 4TQUS 4LHSA 5EBAA 3QW3A 4JBYA 1JDBB 3FCEA 3VHXA 4C90A 3D47A 1P48A 4KW7A 4B32A 4W5OA 2CLKB 4UC0A 1AQMA 2RKOA 3OOHA 3LRLA 4ZV7A 1FXPA 4HATA 4KU4A 4HPJA 2DZBA 2HB6A 3FVVA 3GV0A 3NZ1A 4ZB5A 4DVGA 3HU1A 5IVIA 4RWEA 1RVKA 1U3WA 1CDDA 2I6UA 4MI1A 2CC0A 3L7MA 4RTRA 1QRAA 3QQ1A 4GIRA 1QVVA 4NCHA 1X7YA 1U4OA 5AUQA 2BFWA 3MGBA 3NHFA 4DQVA 5IBRA 2JGJA 1I13A 1XEXA 1KMHA 4Q05A 2PANA 5EIBC 1RTKA 2IHNA 4JUFA 3AIKA 1QE0A 4ZI3A 5BPFA 3UIEA 2XVKA 1PR5A 3KZKA 4EKEA 4GQRA 1X8XA 1Y8ZA 2GHQA 4RD1A 1GKLA 1ADSA 2WZMA 1XU4A 1MN6A 4L80A 2K6GA 3AVQA 3ITOA 2CJWA 4J90A 1QPQA 4DV2B 1JNDA 1D7OA 1DS6A 5HK9A 2ZBFA 4EMBA 2VEPA 3LCGA 1ZQ1A 4M7TA 1HH4A 3AI7A 1P17A 4NYMQ 3D9QX 3UG6A 3HFSA 3KRUA 4Z49A 1PL0A 4A8IA 1RMTA 3LLCA 3NQ2A 3GR8A 3RT7A 3EE6A 3WMGA 4WZBE 4XA8A 1EJTC 2NZUG 3FYUB 4J9VA 4XJVA 3KSDO 1SK8A 4BVEA 1DQXA 1EIWA 3PPWA 4MWAE 1E2DA 4C6EA 2VD8A 2OGYA 2WOOA 1QUMA 2BRUA 4ZARA 3G18A 2LDXA 3ITVA 3ROEA 1SIWA 1N6OA 4C04A 4LK3A 1SJAA 5DBGA 4L76A 3A11A 4S2EA 3S6TA 3C41J 1XEWY 2FHPA 2XH7A 3N53A 4PAOA 2YS7A 3W4IA 4Y2PA 4F8JA 1DUIA 1OZFA 1EXPA 2FDRA 1MQPA 2BFDA 4CM7A 1YTUA 2BKVA 3DGRA 2GESA 5LUAA 3M1AA 1H22A 5LDGA 3CAQA 3B9RA 2ZA2A 4M8SA 5HQJA 2NVOA 3I32A 1YVDA 4N7RA 2VX4A 5KTNA 5LJIA 4LB3A 4P36A 3ICJA 2HWYA 2A9PA 2VZUA 1Q6EA 4IS3A 2QPOA 3MT8A 1UDWA 5DHRA 4OFXA 2JLAA 5GZ1A 3LB0A 1H7NA 4FILA 2FPGA 3RCYA 1GUVA 1CE8A 4WCVA 3EVCA 4X22A 1F6WA 3UGKA 4OOZA 4DWSB 3M83A 4GNKB 4N4AA 4CNSA 3A2NA 3DSRA 5KZEA 4HTFB 5JHHB 2RG1A 2R6AA 3BWCA 1LRQA 3AALA 4GE0A 2C2OA 3AHFA 3ESRA 2O8DA 5EZYB 3TOCA 2BKLA 4H9GA 4IHJB 4FGUA 4QP0A 2WWTA 2PDWA 1D1TA 3NBMA 2XRZA 3S5OA 4JQSA 5BCAA 4XX6A 2FGJA 2BGLA 2GJ4A 3OF5A 1FSGA 1VPXA 2H4YA 1JDDA 4B5KA 4A3UA 3N2GB 1AS3A 1G8GA 3UWPA 1TSIA 5KEIA 3TFXA 4YAFA 1KEEB 2WF7A 4B84A 4Q1CA 2FLKA 2OGJA 2JEZA 3L1VA 5F3RA 1SU8A 3T0BA 2ARKA 4U7FA 4Q24A 3THCA 2J7FA 5BYAA 3U13A 5BSFA 4HJWA 1TQXA 1U0SY 3LUDA 4Z8XA 1JTVA 3T7TA 1KJIA 2C5AA 3HMKA 2HVOA 3EWBX 3U1VA 3OLEA 2O4UX 3QPZA 1QPGA 4UOQA 2ZXBA 5BWMA 4K5QA 4IHQA 1OFHA 3TH5A 4HT3A 5E8JA 1LXCA 3VAAA 1AH4A 1NDUA 1P1MA 2XZOA 5KUTA 2FQIA 1QK4A 1NG9A 4KMOA 4MI6A 5LIKX 1GA1A 1Z5PA 3WVNA 1QVBA 4URWR 3HM9A 4NX5A 3N6QA 1FTNA 1J93A 2XOEA 5SY9A 3KXPA 3B2NA 1PD1A 2QJFA 2FW6A 3PNOA 3JQGB 4BWYA 1VYRA 1ZO8A 1F05A 2C9YA 3L8MA 3KQPA 3HVHA 3GVGA 3I5UA 3ZH9B 4B82A 4UHCA 4E8DA 3OEWA 4R27A 4D92A 1JIKA 1UB3A 4TTJA 2FZLA 3R0VA 5LNUA 3N5KA 3LBMA 1QUFA 2NQ5A 5AFSA 1ZM7A 4L72A 3FGOA 4D8LA 4GW3A 5A3RA 2H08A 2YA0A 4MGYR 4RHTA 3LWDA 2ZXUA 5FI5A 1GPFA 1K92A 4I7EA 1PFYA 4RYDA 3GC5A 5I00A 1I4EB 4DUGD 1T34A 1U28A 4EF9A 2Q21A 3RGGA 3HXMA 2ZJAA 3A6KA 4P93A 4XM0A 4V1YA 1UMDA 1OE0A 3W3ZB 3FJ1A 1YQXA 2HZ7A 1K97A 2GCOB 3E1GA 4HAYA 5CLTA 4I6VA 4L15A 4DMLA 3KAJA 3QE4A 4NUWA 4HH3C 5E0KB 1GGOA 2WNZA 2ZVDA 3CUFA 3DH0A 1D07A 4OL0A 4ZREA 4D4IA 2IX3A 1H2XA 1H8EA 1IOLA 1URPA 1MXHA 1WCIB 4JOMA 4UUNA 1L5QA 4CL0A 4E1BA 3B20A 3NDRA 5CB6A 1H3EA 3CEAA 5KOYA 3P96A 3NBAA 4OKIA 3HKBA 3CR3C 2ZBQA 3FZEA 4AKIA 3RE1A 2ANUA 3O1NA 1VD6A 4O11A 4DBUA 4LHYA 3AHDA 3H4IA 3TQSA 4FM9A 1V26A 3N6RA 3USES 4GPBA 5U4QA 4UCGA 5B3KA 1GARA 2AL7A 1AX9A 3G2MA 1KC1A 3FOFC 1YDVA 3BWEA 1SPQA 5TAOA 4JUBA 1JA9A 3IPXA 3ITCA 5BQ5A 5DOZA 4NBUA 3CUWA 4F2DA 1PBGA 1S89A 4JTGA 3CAKA 2AMLA 4RESA 1NUTA 1ZESA 1I36A 2BEKA 3KL4A 2WMGA 5KWJA 1E3IA 5HP4A 4GMEA 4MJLA 2O8EA 5HE8A 1DBWA 4ADSG 1EFPB 2ZRBA 3ZBQA 2YYZA 3SCWA 2JASA 3K9GA 4HG2A 3P26A 2NUYA 1W2WB 1T8UA 5JD4A 3Q2DA 2ZE6A 2FFCA 1N7JA 1P0FA 3ITGA 3JYQA 3ZT6A 1B42A 5BOSB 3CQJA 4LRSA 1Q22A 4YR7A 2GUUA 3BSSA 4CEXC 1E4MM 2PMWB 3CF6R 2QULA 3PBUA 3H42B 2XUCA 4BVHA 4BGVA 2PHZA 3QKTA 2UZ3A 1B74A 1A9ZA 4KSYA 2W2PA 4HSOA 3PGVA 3AWNA 1XQ9A 4HH1A 2GOUA 5JBDA 3WF2A 2FWNA 3ETEA 4BWGA 2HA0A 4QOSA 3TD9A 2ZYHA 3MGKA 4Q39A 1PX2A 1DJZA 1B90A 4IUGA 5FPPA 4DC1A 5AK5A 3BLPX 2QN9A 4HYWA 5B6PA 5CXUA 2FN8A 3JQ9A 3PPYA 3B1YA 3DEAA 4RKAA 1CE8B 4Q8UA 3DLPX 3EG9A 1KTIA 4DYDA 1AM4D 4PPGA 3WK6A 3L21A 1SHKA 2ZDSA 3N2EA 2AF4C 2P9EA 3N9RA 1YZFA 1TTPB 1TZ7A 1EDDA 4B91A 3AEXA 3OIGA 4ZDIA 3R5KA 3HV8A 2AOTA 3L6CA 3DXXA 2WANA 1ZNXA 4O4IA 2A7RA 1RHQA 3L5AA 1JMYA 2BCEA 1C3OA 4D44A 1RM3A 2F1IA 2VOTA 1QG2A 4CF3A 1F7VA 4H7HA 1U3GA 1Y6ZA 2Q9CA 2EPOA 3TQ0A 4HD8A 1K3UA 2GVYA 1AQFA 1A3XA 1LZLA 4QUDA 4DIFA 4CUCA 1VI6A 1TC2A 1LBMA 5CSUA 1ODUA 1K98A 3KYIB 4EKDA 4UZUA 3SGUA 3U7QB 2VJNA 1N55A 1PFKA 2XQVA 1JAHA 1G9SA 3N8GA 3EMQA 3I4EA 2Q5EA 4HWKA 4DIOA 2C2HA 1X8FA 3WKDA 1P6QA 3BH4A 1ODCA 3A6OA 4C0HA 2B30A 1IE7C 1KBBA 2QN8A 1HDOA 1UJCA 2X5OA 4W4QA 1I0LA 3SYMA 5E95A 1TB4A 3GRUA 4YGYA 4UUIA 4U5QA 4YHHB 3JQ8B 2IQDA 3AHGA 4YJFA 2RH5A 4OXRA 3TCEA 2GPWA 3DBRB 1M0EA 3LQ4A 1UC8A 2J08A 5LQKA 1I7SB 4ZHQF 1PSCA 4CNOA 3PUJA 3HMJG 2V6AA 4U8GA 4YH1A 3MAAC 4CMEC 1ZI6A 4Q1AA 4IAOA 1KXTA 3ZTTA 2GBCA 5AW5A 4ITUA 3RPEA 5EIFA 1FFAA 1RXWA 3FBTA 2W7TA 4GI7A 3EF1A 4ABYA 4Y90A 4UBNA 2OEPA 2ZSKA 2J9ZB 5CAKA 5GOZA 1AKUA 4FHFA 1QK2A 1IL0A 3APTA 2BGKA 3NZPA 3EWCA 1TT5B 1P7ZA 4KQXA 8ABPA 5IUNC 3W1UA 3NYWA 2Y27A 3GOQA 4FS3A 2C7GA 4ADTA 4O4HB 4Y8VA 3CLTC 1T4DA 2JH3A 3O21A 3OJFA 2Q3HA 4JXZA 4H3VA 1Z4MA 5CVCA 3BLDA 3LCFA 1Y4SA 3WLEA 2RBKA 4L3OA 1L4YA 3ZZTA 4KPEC 4FW9A 3TTXA 4B6SA 3MC1A 2PCEA 1DG9A 4KFTA 1G98A 5EMYA 1BH6A 3PX2A 1UR3M 3KQVA 2NVWA 4MV1A 5CPFA 3MWKA 4KACA 3TSMA 4QCFA 4NPCA 3INRA 2OAQ1 4NE7A 3LMYA 4MDFA 4MLZA 1WZLA 5KVAA 3FMFA 2Y1KA 3GNXA 4NRDA 5LP6C 2JIZD 3TLBA 2FFAA 4RD2A 1IDOA 4Z0SA 1FDUA 1I8JA 3GXTA 1PHPA 1E0VA 4ICIA 1CLEA 3VNUA 5IJ9A 4HN4A 1VQTA 4J3XA 3MMZA 1COWD 1L4LA 2TRSA 1VOTA 1RQRA 5JO9A 2YYYA 4I5XA 3QXSA 1FDWA 1B00A 3DG6A 4LOAA 1DX9A 3GDWA 2QIOA 3CE9A 2G41A 4RL3A 2L2QA 1ESMA 4YJDA 4JWTA 3OZVA 5BOFA 1CTQA 3OU8A 4XBKA 2I7TA 2O6HA 1OTXA 2PGEA 2OFOA 2CIPA 4K05A 4JN6B 4ZHSA 1T9CA 5H3LA 3UHJA 2IEZA 2GBGA 3F0TA 4NYYA 4C3VA 1RXUA 2EJCA 1GVSA 1VYUA 1EP3B 4EJSC 1A80A 1OLSB 1PZHA 4HCDA 3K3PA 3C4VA 3OX3A 3GQYA 4BQFA 3OJEA 2ZXEA 4O1EA 5GZ6A 4Q3MA 1RLCL 4KF1A 3UXAA 1ZJAA 4HEA6 3BSGA 3T3DA 3KM8A 1EK0A 1CZ1A 1FA2A 4E4YA 1FXUA 2KBFA 4PYLA 5JVDB 4AHPA 4FC6A 3UKJA 2C3ZA 4M6WB 5IAAA 3R8HA 3STUA 1BWSA 2ZVQX 3PK7A 3S9IA 4L08A 1O9GA 1E1KA 3NSXA 3A9CA 3OYZA 4XKJA 3BILA 4ARZB 3FSGA 4XPZA 1VMIA 5HJ2A 3FG9A 4DJEC 4XTIA 1LSSA 1SU7A 2IITA 1ESNA 3CFYA 3D81A 2QN6A 3R74A 1RRKA 3A36A 1ICPA 4RSRA 3TW9A 2VRCA 2ZFAA 4KKXB 4DCCA 3NURA 4H6VA 1GSIA 3O9NA 1HFJA 3OBIA 3WLTA 4V24A 3HBFA 1UANA 4IOLA 4BUJA 4A1FA 1MRAA 4JR1A 3PXGA 3SICE 2POTA 4KVZA 2DVMA 2UY4A 4OJNA 1LI7A 4A23A 2BFCB 4C3UA 5JQWA 1EYEA 2O9OA 2QD1A 1OLUA 2B92A 3GHTA 3BMQB 2B1RA 3ZCVA 4HK5A 3NM3A 4CODB 2IKSA 4OU1A 4V15A 4DREA 5F3DA 4DV3B 2PO7A 4QNWA 2IS2A 4XSGA 4IQLA 2A78A 5HUHA 2G5WA 1NQOA 1EAYA 2PH7A 3H6HA 2EHHA 2AFIB 2G3YA 2VPXA 1Y8QB 4AMGA 5KEZA 1RFLA 1N8IA 3QN3A 3STWA 1L8OA 4D6JA 3GR4A 1XDWA 2EKZA 1YCDA 4NCNA 1X19A 3R5SA 4WOKA 4ITVA 4XCVA 3W1EA 2HBQA 5KDLA 4V2XA 4M24A 3VPLA 1KQNA 3EDOA 1FDTA 4B5WA 3ICEA 2GB4A 5ALHA 4BCEA 2G7ZA 3TRFA 1HEIA 2TMGA 4UWMA 4DV0B 2C4NA 4WXZA 3WXMA 4B2LA 3GYGA 4YDQA 3L93A 3PT5A 2BUCA 3NPMA 4UZEA 3S2IA 1Q7QA 4PVCA 1PL6A 2HTEA 4CT5A 2GVLA 3KQWA 1VCGA 3WGGA 2VJOA 1NMZA 4BDTA 3W6ZA 2A9RA 4KLAA 2QQGA 2BVWA 2KI5A 1YK1A 3WQ8A 3T9CA 3DM5A 5KQGA 1TTIA 1QANA 1NEYA 4BFAA 4LDAA 1OZHA 2VRBA 2XH0A 3IESA 3ZWDA 1U9CA 2HIMA 2PAFA 3SS7X 4JI8B 4F9JA 1XLCA 2FPWA 2KX7A 3NYZA 4ICNA 5E6YA 3VNKA 3KSAC 3WYBA 2PZLA 3H3JA 3UW6A 2GJLA 2C3PA 2HPVA 4B3TB 3H9JA 1YHNA 3ZI4A 3ISTA 4BNJA 3C48A 4PBGA 2RFGA 5A4IS 1ZWLA 5LP6B 5HIMA 4D96A 3OEHA 4AYWA 1KO4A 3A6EA 1LNQA 1T2FA 4PLCA 1R9JA 1F17A 4U7TB 1Y3BE 3VU0A 2P3OA 2VOEA 1C3FA 1KMNA 4UTPA 1PQ4A 2ZAIA 4F4IA 1GZ4A 1ZVMA 5JXGA 4INOA 4M88A 2NSYA 1LDYA 5J59A 1C80A 2E5CA 4Q18A 2POZA 1Z06A 4XWUA 1HOXA 3RS2A 3LC0A 4P3XA 4W1PA 2Y1GA 3GGOA 5DEIA 5EMMA 4YRGA 1UXJA 4QPZA 4Q1VA 4Q3DA 4UPVA 5CR9A 3JQFC 2PX6A 4UEQA 4NFYA 5AHRA 1VIWA 4FZVA 1P4HA 4LBSA 3WMFA 3EQ8A 2I99A 4KWOA 4OTKA 1V5FA 4B5LA 3SCOA 1BFUA 4UDXX 3NTLA 1NP0A 5EZSA 1XWWA 4OQ4A 2AVNA 2INFA 2IFTA 5L3QA 4CR8A 3K1JA 3OIUA 3WDPP 4O10A 3JAKA 1TQ2A 1WBJB 3EVTA 4MF4A 1U8YA 3T54A 4GR4A 3WKCA 5B1IA 3GUHA 3A47A 3H70A 1OZGA 2PK3A 5E9AA 2VUHB 3AJAA 4RV4A 5CCDA 5FNVB 2QUZA 3WG6A 2XCRB 5BYWA 1G41A 2RJOA 2QXTA 2XMRA 3WAJA 4DZTA 2ACEA 3R0QA 3B6KA 1YJXA 5AP9A 4BO2A 2GK3A 5A95A 3D7MA 1UWSA 4A92A 3I9FA 2ZYVX 4QBKA 3SB0A 4TMVA 1M3UA 1AXRA 4KIUA 4B4OA 2Z1XA 4GUDA 3AHIA 1G6KA 1JVNA 3MAGA 1WVIA 5AQ1A 4MIKA 4XZNX 4EVSA 3Q7RA 3S9ZA 2YWGA 4D74A 2XV1A 1P1CA 4OHBA 4CTJA 5HYVA 1C7TA 2QPXA 3I42A 2C03A 4Q4PA 4QS6A 1XR3A 4WZHA 4QDKA 3PPFA 4KTVE 1BD4A 3ZHUA 1KC3A 1SHLA 4K1LA 1Q5MA 4B46A 2CXGA 2C3MA 3EDKA 3RG2A 4V1CA 3MYPA 4HV4A 1ISRA 3CINA 4YBZA 2NO0A 3T5MA 4JU8A 4UTHA 4DL9A 2VQEB 1I9CA 4KQGA 1PKLA 2V3WA 4GY0A 2P5YA 2ZUTA 3RFCA 3DTVA 1WZNA 1W4RA 1IEWA 3O7MA 3B05A 2YMLA 3TC6A 5BW6B 1JZQA 4V0OA 1TDJA 2D22A 2WYHA 3OF3A 3G5AA 3WQPA 3K0CC 1E2BA 4GSKA 4B74A 5CDTA 3W2NA 4C89A 4P08A 2QG9A 2PYZA 4S1VA 3UWEA 8XIMA 4WPGA 4COOA 2WCSA 5BWCA 1BOOA 3ZDFA 3DCPA 4YWIA 3VC2A 1L5LA 1JR3A 5D2XA 1TAUA 3GFOA 4ICMA 3AS2A 1PDZA 1E6QM 4UVEA 3AHYA 3OLIA 1RE1A 1ETHA 3SOZA 4C0XA 4X84A 3LP8A 1N78A 3C3YA 4YRAA 3LZCA 2AKZA 4W1QA 2M1ZA 1ITCA 2HSZA 4JJAA 3LRTA 5CDSA 3FCOA 1RA5A 3HDVA 4MB0A 4LZAA 5HW0A 1E3EA 1I1OA 3S3GA 3ZS9A 4DB2A 1F9EA 1TVLA 3U6WA 3IPAA 4FLEA 1WQ3A 2X1VA 3S5JA 4Q19A 3LK6A 4R0VA 3V4FA 2I91A 2F43A 2WHPA 3NC1C 2Y70A 1QGUA 3H5RA 5TSDA 4HCLA 5K0FA 2I4OA 1IR1A 2VF5X 3FPAA 2XFWA 3GA0A 5JEDA 1YR1A 3ZW8A 4J3ZA 4HP8A 3MBIA 4DYVA 5CTJA 3MCZA 4L65A 3ZQJA 4AMAA 1F4AA 1A04A 3OODA 3K0KA 1L4FA 2A30A 1E5QA 4EIWA 1VCNA 2WNIA 1PF7E 3E82A 1Z6TA 1IMJA 1P5RA 4G2DA 3P84A 2IEIA 1WPCA 1WBHA 3QGVA 3HGOA 2XG9A 4IEFB 1C2TA 3B5JA 4RA6A 2G5GX 3R6TA 2WP8J 4IHCA 1N6PA 1OSNA 1DWIM 2GN6A 3O8OA 5L7WA 3MIIA 5HRCA 4OAOA 2VJXA 1VA5A 2DZAA 4ZA2A 4C20A 4HQOA 4DA8A 2WV7A 3RSCA 4U31A 4RJJA 4KQ9A 3C8DA 4JTKA 2OEKA 2OHIA 3PC6A 5CXSA 4Y0NA 1UKQA 4BNKA 1OU4A 1MW3A 5IBXC 5BN3A 5HR7A 3L7KA 1NHGA 4A8NA 1HLGA 2X14A 4INJA 1EG7A 1HJSA 2G3FA 3H5VA 4UBOA 4BBPA 3SCNA 1ENUA 3HJZA 2P3ZA 1B2LA 5EUBA 5ENVA 1HETA 1XEXB 1UQTA 2OA0A 3TNOA 2E6YA 1Y1LA 1P2SA 4X63A 3CBQA 1Y8BA 1T6NA 1IPHA 2GWNA 1E3TA 3VIGA 3AI1A 4AJKA 5DO9A 2QY6A 3ND7A 3TR2A 2H00A 1DFIA 2YWBA 3W04A 1YB1A 4RXGA 2CJWB 1E9EA 1UQUA 2ASEA 3VA8A 2CBVA 7ADHA 1TK3A 3HL0A 4OB6A 5A2BA 4QGBA 2B78A 3V7PA 3K13A 3ZWQA 4KWIA 5TF0A 4MP6A 5BMVF 1GOTA 1T5SA 1D7KA 2W6NA 3M2PA 2W6JD 2OG2A 3EQ2A 3WSUA 3ZHXA 2XIJA 3C2EA 5FQNA 4MZ8A 2V9ZA 2D2EA 3UGVA 2I8CA 5EPEA 1UZ1A 5DMXA 4JCOA 4Y2QA 3S4YA 3TI9A 3Q8LA 2W48A 3MKKA 5TJ9A 1W1IE 3HMQA 3FV9A 1DCMA 3LGGA 5AI0A 1RKVA 4AJIA 1ZSVA 3OUTA 1ECBA 3OOSA 1YH3A 4GPEA 1BXRA 2BHSA 3H4MA 3NQAA 3K9WA 2ODBA 1AGRA 4DSUA 2CXRA 1SQSA 2MR6A 4Q7JB 1S5VA 4GXMA 4DI9A 4XASA 5DTIA 3BK1A 1IHOA 2Q5OA 4JFWA 3C3AA 1OX4A 1OFDA 3HQ1A 3KTSA 4EUEA 3MD9A 1F8FA 4TO8A 4BF5A 1NZDA 3MDUA 1V3LA 4EHNA 4P7JA 1UWQA 1JG4A 1S8AA 2PSHA 2VDWB 1KV8A 4IHJF 3QI7A 3G79A 1L2UA 4M37A 1S3GA 2O1EA 3EG5A 5GJWC 5JVLA 3DLHA 4H60A 3COTA 4PX9A 1XTPA 3QOXA 1FTWA 2FYTA 3HQNA 2A5FA 4OGLA 2OBBA 2ZSUA 3FVMA 3DAOA 1JSRA 4KAAA 5FIUA 3D8SA 4HB7A 3B8UA 5DHFA 1QZTA 5JARA 4RNDB 2UUAB 1XYCA 4DB7A 4TV9B 4ZWNA 1KNWA 2C9CA 2IF2A 3FXGA 5HWSA 1A3WA 2NPIA 1MMFA 1GGEA 1PT8A 3DVQX 4OFWA 2IY7A 1POJA 4L61A 2FPXA 1H62A 3UNTA 2JIBA 1TU0A 1C7EA 1Y0BA 3SM9A 2P1ZA 3MTDA 2G06A 1FL9A 3V80A 1RFGE 3GRZA 4A8PA 1XQLA 2JLSA 3HWRA 3IIMA 2CHNA 3FPGA 2R47A 3FUXA 3MUY1 4HGPA 1S9HA 1VMKA 1US8B 2VJMA 1Y1KE 2P5SA 4J3WA 4KK4A 4C5ZA 1PJ2A 2E5FA 2H65A</