5FO0A

D298e mutant of fad synthetase from corynebacterium ammoniagenes
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
338
structure length
334
Chain Sequence
MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRRAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFESVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
publication title The trimer interface in the quaternary structure of the bifunctional prokaryotic FAD synthetase from Corynebacterium ammoniagenes.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
total genus 97
structure length 334
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5fo0A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 5fo0A01
4KKVA 4PBSA 3CVUA 1U0BB 4R2MA 3AG6A 1NB0A 4YP6A 1ZH6A 2A4MA 1O97D 4K03A 2Z3VA 1B6TA 2P3MA 4EG7A 5DEOA 3X1KA 1JEDA 3HV0A 2VTBB 3PNBA 1N2GA 1U7DA 2J07A 2X1LA 4ZCRA 3AIIA 2A86A 1OWMA 1N2EA 1NUQA 3X1JA 5KHAA 2DUMA 5KCMA 1Q11A 2DXIA 5LLTA 1OBHA 5J59A 1NZJA 4MW0A 1ULHA 2NZ2A 4MWDA 1OWPA 2QUJA 2QJTA 4XFJA 2GOYA 4DNXA 2VTBA 2XRZA 2DPLA 1XJQA 3ELBA 2PG3A 1J1ZA 1M8GA 1NUPA 4DDHA 3P0JA 4ZT7A 2J08A 3FHJA 3UK2A 1LW7A 4KR9A 1IRXA 1JIKA 4MUFA 1X6VA 3FIUA 3IOBA 3KT6A 4EG1A 3PXUA 3OTWA 5TEVA 2NSYA 3PNVA 4MVYA 4ZT5A 1N2IA 2TS1A 2IELA 1J20A 4JXZA 3IVCA 5BNZA 1JGTA 3TQIA 3CVYA 1GPMA 1I6MA 4F4HA 2C5SA 1NI5A 3FDXA 1U3DA 4NX2A 3OP1A 2O8VA 1G8HA 3KT8A 5J5AA 1EUYA 1EJ2A 1MC1A 1WOYA 5KWVA 2AG6A 3COZA 5FO1A 3DPIA 1A8HA 1GTRA 2CV0A 1O96A 3SZ3A 4AQ7A 1GZUA 1MJHA 4RUKA 2OV4A 3K9WA 3Q12A 1R6XA 1VLHA 2YY5A 5FO0A 1KKUA 1LI5A 3IODA 2A84A 1T6ZA 1S4MA 1M8KA 4JXXA 1GN8A 1FYDA 1KH2A 1IQ0A 5DASA 4CT0A 1WZ2A 2QUKA 5K0SA 2E89A 2EL7A 1T9GS 3ND7A 3AG5A 4XFDA 2Z09A 3Q10A 4EG3A 1J21A 3L93A 4ZCTA 1N06A 4KPUB 2WQ6A 4YMIA 3P0IA 3FNRA 4HJRA 5A89A 4EG5A 3BL5A 1N05A 1YI8A 3H9BA 1N3LA 2JAXA 1IVSA 1GLNA 4H3SA 3PNYA 1F9AA 1Q15A 4MUIA 2DEUA 3CLSD 3NBAA 1O5TA 1MRZA 1XNGA 3FY4A 3I05A 3VGJA 1ZJWA 3MUEA 1WJGA 3ZJTA 1IH8A 5H16A 2J09A 5TEWA 3QTBA 3CVXA 3H9CA 4NAHA 3A2KA 1O95D 3MXTA 2PFSA 4ND7A 2VBTA 1H3NA 1K4MA 1JEEA 1Q77A 4MUJA 1KR2A 4DDKA 2PZBA 1QRTA 3A4IA 3H05A 2ZUFA 4DE5A 2BYTA 1N2OA 2VBSA 2A1TR 2HGZA 3P0HA 1XNHA 3IUBA 3ZUGA 1MBZA 2AZXA 4YP5A 1UFVA 4ZT3A 4OUDA 4G5YA 3UY4A 1JILA 4HJXA 1KH1A 1NUTA 3HL4A 4ND6A 3ZJVA 5A88A 4G6ZA 4K0RA 3MLBA 2O5RA 1NP7A 4ZT4A 5DK4A 1QNFA 1O6BA 2GKSA 1G8FA 1H3FA 2PXHA 1YUNA 1N1DA 4ZT2A 4DJAA 2QJFA 3C8ZA 1COZA 1NUSA 3IMEA 3ZJUA 3LOQA 1JZSA 1MB9A 4J75A 1O0BA 2DLCX 4ZCPA 1WXEA 1J09A 4EG4A 1N2HA 1F7UA 3CLTC 3CVVA 2E0IA 1Q9SA 1NYLA 1YIDA 4Q16A 1SURA 3SP1A 1M1ZA 3GUZA 2A1TS 4PY2A 3RK1A 3VRHA 3HMQA 1G59A 4I6GA 4ARIA 1WXHA 3P52A 1M8PA 3H97A 4I6JA 4MWCA 4R2LA 3VU8A 1U3CA 3Q4GA 3IUEA 4MWEA 4AS1A 3FWKA 4QRDA 1EUQA 1WQ4A 2RD2A 3SZGA 5LM3A 1JMVA 1MAUA 4U7JA 3TZLA 4MUHA 1V47A 4J76A 1M8JA 2J5BA 1TQ8A 1Q19A 1ZUNA 2YWBA 3RK0A 3ND6A 1U7XA 3IOEA 4OJMX 1GTSA 3M5WA 3KT3A 3INNA 1QTQA 1M8FA 1EXDA 4CDMA 3U1VA 1HYBA 2EJCA 4YBRA 1JZQA 3CLRD 4MW1A 1KQNA 3RHSA 4A91A 4MW6A 2CYBA 2CUZA 2CFOA 2IP1A 1T9GR 3NV7A 1K4KA 1PFVA 1WY5A 1KQOA 4MW7A 4F3RA 1EFPB 3SDBA 3UMVA 5TGTA 4ARCA 3DLAA 3IVXA 3HFJA 4R0NA 4MUNA 2ZP1A 1KP2A 1WXIA 1OWNA 3FOCA 1PFWA 3IH5A 3E27A 2WSIA 2YWCA 4YP7A 4NZPA 2QTNA 1OD6A 1IFXA 2HZ7A 2CYCA 3AFHA 2QUIA 4MUKA 5F23A 4U63A 5LFAA 3CTAA 2RE8A 1IQRA 1PG0A 3N2YA 1R6UA 2VBVA 4MVCA 3LE8A 2A88A 3MLAA 2CV2A 1K92A 4S1OA 5TS2A 4MLPA 4HPWA 1V8FA 4BWVA 4MQ6A 1VBNA 3AKZA 1WQ3A 1QRUA 4MW5A 5H7XA 3TQOA 1EFVA 1KQPA 3DO8A 2IJGX 1D2RA 1YULA 5HUHA 4ZCSA 1QU3A 5HUJA 2OQ2A 1IQUA 3DV2A 4MW4A 3CVWA 5FNZA 3D6VA 2PIDA 1ILEA 1O0CA 3D6UA 2D54A 2YXNA 4DDMA 1XNJA 3A04A 3SEZA 1JHDA 4HK4A 3GMIA 1OWLA 3UOWA 3COYA 2WQ7A 2PZ8A 1TFUA 3CLRC 4MW2A 2GM3A 3LCJA 2D5BA 5K0TA 4L2IB 3TNJA 4EFKA 2J4DA 4P2BA 1JIJA 1O97C 1MB2A 2VXOA 1TEZA 1N2BA 3ND5A 4JFAA 2BTEA 4KR6A 1RQGA 4CDNA 3BNWA 1I6KA 1Y42X 3UC5A 4MUEA 1J1UA 1PFUA 2QUHA 3COVA 4UZEA 1I6LA 2OYNA 1JECA 4KR7A 3ISJA 2CYAA 1QQTA 1F4LA 4NATA 3X1MA 2X0KA 1IHOA 1P7PA 4G5FA 3S3TA 1PG2A 1MAWA 4I6EA 1EFVB 3PRHA 3RFFA 3SYTA 5AHWA 1QJCA 1LI7A 1NURA 1DNPA 1QU2A 4PBTA 1OBCA 3GLVA 3N9IA 4X0EA 3N05A 3IMCA 4E1AA 2DERA 4MUGA 2X3FA 4RPIA 1PFYA 2Z08A 3FH0A 3IOCA 1NB9A 3CLTD 4XSVA 4UZFA 4Q93A 3CA8A 3QE4A 3HGMA 3CLSC 4TS1A 3QTTA 1VBKA 1YIAA 1N07A 4DLPA 4WSOA 1NSYA 5HG0A 2X1MA 1H1TA 1O94D 2XRYA 4EF6A 4MAFA 2QTMA 4QREA 1T6YA 4QBTA 3L92A 3RJZA 1KH3A 4GU5A 2A1UA 4EGAA 1KAQA 2G36A 2E18A 3CLUC 1EFPA 1N08A 4ZCQA 4U8HA 5IJXA 5JBNA 1H3EA 3FG9A 2ZUEA 3H99A 2QTRA 1KORA 4CQNA 5TRDA 1TYDE 5DB4A 5J58A 3RBAA 4NAUA 3ZIUA 3KFLA 1WXFA 3JXEA 1N2JA 4FZJA 3ZGZA 2I1LA 1CT9A 2QJOA 1O95C 4ZT6A 1JIIA 4MWBA 1TYAE 3NBKA 1F7VA 3G59A 3MMXA 1G8GA 2DETA 3IVGA 1N77A 1YUMA 2HMAA 1M83A 1EE1A 1N75A 2CV1A 1J70A 1R6TA 3KT0A 2PZAA 3F3MA 3G5AA 1T6XA 4PBRA 4MULA 1KAMA 2CT8A 1WXGA 1O94C 4EG8A 2A1UB 1VL2A 1X8XA 5IHXA 2DR2A 1BS2A 4OUDB 1I2DA 3SEQA 1MOPA 3TZEA 1KP3A 3ZXSA 3FI0A 4MVWA 1TYBE 1ZH0A 1K97A 2H29A 2VBUA 1TYCA 4GRIA 2R5WA 2AKEA 3FETA 2E21A 5A8AA 1FFYA 1O96B 1WKBA 3COWA 2JANA 2H2AA 3K32A 2V0GA 4WNYA 4MW9A 3N8HA 4NDAA 1P4MA 3HZRA 5EKDA 2WB2A 2JA2A 1NUUA 2V0CA 4EG6A 3G6KA 3CLUD 2A7XA 1VBMA 3IDFA 3CR8A 3AL0C 4L2IA 4MVXA 3ZXIA 3A05A 2D13A 1N78A 4KPUA 1QRSA 1GAXA 3TS1A 4JZYA 3IMGA 1OWOA 2B7LA 4JYZA 3ILVA 2CSXA
chains in the Genus database with same CATH superfamily
4QXAA 2YWXA 3TLKA 1V37A 3H8WA 1RPNA 5DYWA 1QCCA 1H66A 4IMJB 3GBPA 4PGAA 1FXWF 2W0MA 4LRTB 3SJCA 4C0QC 2X8BA 3AI7A 4G0UA 1Z26A 4L5CA 1VHJA 2PJRA 3WE7A 2P3MA 3FSRA 4RC9A 4EG7A 1ZO8A 1CB0A 3CKKA 1U5CA 1WO8A 4Z4YA 1MO6A 4QU8A 4AJKA 1X7ZB 1ZITA 4MHOA 2OV1A 1GYPA 3IB3A 2ZJYA 4BVLA 5JAOA 4YJ3A 4C4XA 2F1RA 3OOYA 1Y8CA 5F2EA 3IKMB 1HQYE 4KVAA 4FFRA 1RXVA 3VR5H 1Y3HA 3W5BA 4GR9A 2FEXA 3CY6A 2GD0A 3TL6A 3CONA 4QDJA 4K6CA 4P4NA 2IEIA 2XV1A 2ZB8A 2WYRA 1OBHA 1MABA 3BMCB 3MWEA 4NONA 5DGCA 4C1NA 4NMLA 3LKBA 1Y6QA 1JHZA 2EJWA 2YVLA 3MCWA 1U0OC 2WYIA 1OWPA 2HIGA 2OV3A 3JZAA 1YSCA 4K9DA 3TZHA 2QJTA 5JXIA 3N2ZB 5JMOA 3K7EA 2ZJ0A 3A32A 1MG5A 2D1SA 1RLTA 2FWPA 3I0ZA 2W22A 2YRXA 3WIUA 2WK1A 3F71A 4HQLA 2FMTA 1NHGA 4X1IB 4ZVKA 4DR5B 3NWPA 4JJIA 3PHIA 3FAZA 2WJWA 3R8CA 4GWKA 5G4LA 3U3XA 4EO7A 4DLZA 3DBVO 4OLBA 1XPRA 5CB8A 1E9BA 5DS0A 1OT3A 4H31A 1E79A 4OBEA 5DM2A 1WNTA 2ZPTX 3NRCA 1ABFA 4WWVA 2I6GA 3KCQA 3OPYI 3I53A 1EWQA 2ACWA 2BDEA 2AYXA 4MVYA 1KQSB 1H2ZA 3CF4A 2P6MA 5CBPA 1RRKA 4QUGA 3RVQA 3IVCA 3C5CA 1F1JA 4E2WA 5A5FA 2AD1A 4Z4IA 2D7JA 4REQB 3W3ZB 3QHAA 2EBUA 3N86A 5FT9A 2O7QA 1A9TA 3ZE9A 2O2ZA 1JU3A 3QMVA 4PLHA 1PX0A 1PW5A 1T9AA 2PT6A 4O2BF 2OQIA 4MITA 1TAGA 3UB4A 4NYIQ 1U6KA 2O1XA 3IPYA 4YB8A 1GAWA 3F47A 1SUAA 1Z62A 2VT3A 3H3FA 3W77A 5K5EA 3CWCA 1KHHA 1SXHA 3PNQA 1YQGA 4BECA 2QVLA 1X39A 5CTJA 4OX9B 4XLLA 3HXPA 4FGUA 5AIAA 1YIOA 1CY6A 2CHEA 2O2JA 2G1PA 2NQTA 1RQRA 1PLKA 3HJHA 2XDYA 3H6GA 1ETHA 5JS7A 2IHUA 4L28A 1SC3A 2C2OA 2Y2UA 4HWPA 4AYXA 4G5OA 1KKUA 4NEQA 5B3JA 1A98A 5EMLA 3K70D 4OATA 4B6JA 1S4MA 4FYXA 4OH1A 3WRYA 3ICEA 1ZWLA 4A7PA 2AFIA 4DIFA 5JVDF 4JXXA 2MJLA 2I6SA 1P6QA 1XQ6A 4FXOA 5JJ5A 2XCRB 4DA4A 1WZ2A 5HF9A 3JD4A 3JTEA 1WQ1R 4DK1A 1QAMA 4NBVA 1I4WA 4TTSA 5ADVA 1KHTA 4EG3A 5CBPB 1VLMA 4Q7JB 4KPUB 4EW2A 3CFYA 5F77A 1SZCA 1Z2DA 2P2ZA 3FNRA 1OLXB 1T4GA 1ZC4A 1VIYA 1P1KA 2JJ2A 2X4DA 4IXNA 2M6KA 4DQ0A 4OF4A 2ZIZA 1BU5A 1I80A 1M0EA 2Z6UA 1UWCA 4FE3A 3V3TA 4L1KA 4EFNA 3PNYA 3W79A 1ZM7A 2DKOA 3LUAA 4F91B 5FAKA 1EESA 4UREA 2FK8A 4B35A 1ZWKA 2BJHA 2HFKA 3P0RA 4NOLA 5A4AA 2AFHE 4PTZA 3BDIA 2WU8A 4KQCA 4ZAFA 3OIYA 4BCDA 5TEWA 1UH5A 1I30A 1QTNA 1N2CB 1W76A 4K6GA 4Y6QA 4DMMA 2GD2A 4GEKA 3DLTA 2PFSA 3F5DA 2UU9B 2QTGA 1QVGB 2PX0A 4BMVA 1CXZA 2BI4A 4M9RA 4DRXA 1S9DA 3QE2A 3FPGA 4U2GA 3O92A 3SKXA 2QEQA 3TRIA 1XEAA 2R6CA 5KYNA 2JD2A 2C42A 4KTVE 5MHTA 4DRYA 3G85A 3L7CA 5M2QA 1VB3A 2XCIA 3M6VA 4B4KA 3STHA 4R1SA 2O3SA 1ISSA 3JWGA 5BNFA 1KEZA 3R3HA 2BFCA 5DHTA 3E8SA 1JKJB 3NKLA 2Z5GA 1C0KA 1GPYA 1D04A 4RLSA 1Y3DE 4XVQA 1WUYA 2DUWA 3DE0X 3PUYA 4HLNA 2JJ2D 4JLAA 2QD5A 1WCXA 5EE0A 1XEXB 4D0LB 3EFHA 3AJ9A 2RJ3A 1BZYA 4EPRA 3PNSA 4OH7A 4EKDA 2ZK7A 3QVTA 1V5GA 4ZT4A 4GKBA 3KS9A 3UKDA 4TL8A 4RHTA 1XDBA 4G2NA 2JK0A 4IV5A 1Y4UA 4AG6A 3BERA 3SE0A 3AEUA 4X3OA 3KKKA 3TQTA 2EIHA 3V00A 4JLOA 2UVQA 4DLSA 5LQAA 3GRZA 4HMQA 3AV0B 4UBJA 4QUHA 4W8HA 1IYZA 2NZYA 2WT9A 4WINA 3A35A 5BWOA 3RS4A 3T0IA 5IYPA 1ZN8A 2KPOA 3AUTA 4Y0VA 4EQ6A 2LNDA 4JI4B 2DLCX 2QQFA 3MWLA 4J4BA 4XARA 4BMNA 4Q3OA 2RH4A 1P74A 1JRLA 3B48A 4NHOA 1RHJA 3UJ8A 3L7NA 5DT9A 5AQEA 3M5DA 4Q1EA 3R3JA 4Q18A 2Q7DA 2QXUA 3QELA 2EWVA 1TPZA 5LLSA 1GTMA 2YS6A 1MUUA 2VA8A 3B1YA 5EXPA 1L7NA 4BNGA 3DQZA 4V2UA 2GN9A 5BQFA 1LVGA 2VHEA 3BJRA 3FCAA 3M6LA 2ASVA 3AR7A 3BTSA 1JQBA 1NIPA 2G5TA 5F1YA 2VDRB 3M4YA 3RAFC 5H1YA 4G07A 4RSMA 1GUDA 3RGWS 1M2FA 2R5NA 5CA0F 3NZEA 1SKMA 1WQ4A 2C1XA 2WAOA 3PHHA 3P2IA 1JFLA 2J6IA 5A02A 4KOAA 1H9BA 1V9SA 4HNQA 3ZPXA 3GIDA 1JXAA 3MWGA 3A06A 4EA9A 4F2GA 2VBFA 4N18A 1NRWA 3ND6A 1J6UA 3QV2A 4TS9A 1T1RA 4BGUA 1SK9A 4CTOA 1EUZA 2PSHA 3O4VA 1KQNA 5TQJA 3OM8A 1XQ9A 2FFRA 2W93A 1JWBB 2IP1A 3WGYA 1HDYA 3T3NA 4MEBA 2OBSA 2G9ZA 1KJYA 3CCJB 1OFVA 2HRBA 3HCPA 3KD2A 4M7RA 3DLAA 4ZGNB 3T53B 1QLHA 1T2FA 3BRQA 2NXNA 4MUNA 4BNWA 3RSOA 4C7OB 2GN4A 1CJBA 1LQUA 1YBMA 3Q9UA 1JVBA 1Z07A 2BT4A 3UAGA 2AVNA 1WB5A 3OF2A 3HJUA 5KMGA 3Q72A 3F8SA 2BFDB 1IFXA 3BGSA 3Q8XB 1SGWA 1IULA 1VQKB 1UUFA 1WMDA 1IXZA 1H2XA 1M66A 2QRGA 4MUKA 2CW5A 2FPLA 3R3UA 4PIVA 2OCGA 4KXXA 3VUFA 2O2SA 4EF4A 2JLCA 1J8FA 2REOA 4F96A 2CZCA 3SJZA 1EUDA 3JQ8A 3GH1A 5GM1A 4Z1OA 1E3QA 3SZOA 3KHUA 2HMUA 4FIZA 3TKYA 1YZTA 4G1BA 3UMBA 3ZHSA 4CXMA 4H18A 3MG9A 1TQ2A 2R00A 3GT0A 1N6NA 4RTJA 1YB2A 5CT9A 5DXFA 4BNJA 1DG9A 4QGAA 5JFOA 2NZVG 4RTQA 1KZ9A 1IMJA 2C7OA 3CEPB 4N3CA 3LQYA 3WWCA 1VCHA 4BO7A 4Q1AA 2PGOA 4FFMA 2X19A 4REOA 2C2YA 1K0UA 4JUAA 3JAMA 1NYRA 2CUTA 1XZIA 3BD9A 3FFTA 5HUHA 1RKBA 4BPBA 4NSNA 1BYIA 1KDPA 3KU1A 4I81A 4GXNA 2C4MA 3NWBA 1N3BA 2XIQA 1GQYA 1P9WA 1U1CA 2NG1A 2P3QA 3BX1A 1E96A 3E1SA 2H16A 4AF7A 2GWRA 3IAHA 3LXXA 4G4SP 4LOJA 4PHTA 4REMA 2XUJA 4EYSA 4Z0TA 5LQSA 4CIYA 3IC5A 4YCJA 3AQ4A 3OPNA 2AOWA 3OEHD 4Q48A 4DNQA 1G17A 4FFBB 3ZE1B 2WQ7A 3CCRB 4P4GA 1TM4E 3OE4A 4RZQA 1DB3A 1G55A 4B79A 2XCTB 3NVDA 3BTVA 3WLEA 1BC5A 1U8XX 5BOVA 4M21A 1YS6A 2VSNA 3ZZ0A 3MJDA 2UVPA 2DBZA 2ECPA 3AJAA 3I55B 4KAAA 2OGTA 2WLSA 3SY8A 2OENG 2OHGA 2I78A 1AQ6A 3E9RA 2CXSA 4V3CA 4WCVA 1LK0A 3TIXB 3MUNA 4P9NA 3G7SA 5LBUA 1K73D 4CV3A 4NMWA 3FYHA 2FPWA 1DAPA 1N8KA 1U6IA 1XTRA 4JI0B 3JAKA 1TF2A 1GGFA 5AM0A 2QR5A 4ROTA 4O3MA 4N48A 1EYZA 1A2KC 1TKRA 5IDVA 1SVKA 1SC6A 1K3FA 1PJBA 2I8AA 3OZSA 2ZJ8A 5GJVC 2C04A 1U7HA 3AUKA 3ISJA 2WTBA 3KCNA 3Q2KA 3DBLB 2KI5A 1IHOA 5I9MA 4R5MA 1JHYA 3ZU2A 2D3TA 1PG2A 1WF3A 2R4QA 3IPRA 4LI0A 5TPWB 5JJBA 3NB0A 5KJ1A 1YR3A 3KKNA 2E48A 3KTOA 1QJCA 1AKYA 3WGQA 4DA7A 5T3UA 2R6R1 4CTNA 2PRIA 3NTQA 4HH1A 4RLHA 3TG8A 4LPKA 2W6NA 2ZT6A 3MUFA 1OHHA 3QOYA 4HLDA 4WXPA 4XR4A 4C3OB 2OBLA 1PFYA 3HSYA 2OCPA 4JU9A 4KLCA 4RJ2A 2AJ8A 2D3WA 4RMIA 1WBJB 5DRTA 5J5CA 4JI8B 2FF7A 1RFLA 2COEA 4JXKA 4LAFA 2WMOB 3M2TA 4WPGA 1WX1A 3LRXA 1WSBA 2YASA 4M1ZA 2PMKA 2BFPA 1DQRA 3EUAA 2GAFA 2E1BA 1UM9B 4RM2A 2PQMA 4LKOA 1QZTA 1ZBQA 1UBMS 2CHVA 1GRNA 2ZR7A 5DPMA 4PSKA 1GCGA 5HG0A 3SLRA 2ZZNA 3KLMX 2AVDA 4QREA 5FL7A 2XE6A 5FOQA 2QM0A 2O23A 1KH3A 1PL8A 2FPGA 4N3GA 2C5EA 2CSUA 1PWEA 1RCTE 3C3XA 1SVNA 4I4CA 1YR6A 4WUTA 1DT3A 5KX5A 5J1SB 2WQ6A 4H4DA 1H9AA 4OB6A 5B6PA 3G05A 5IJXA 4CW7A 3DEAA 5CFLA 5JMWA 3PKZA 1NL3A 4NMMA 3VKUA 1UK7A 4Q3EA 5TPWA 4KN5A 2PUAA 3HWRA 5J58A 1CUUA 4NAUA 5EG5A 3ZCTA 1Q1GA 3W5JA 2Q2NA 1M1NA 1PBNA 2WICA 1B42A 4JBWA 4KODA 1EJ6A 4TQGA 3SC2B 1P2TA 5FUWA 3WHKA 4QYMA 3M2PA 2AHOA 4HF7A 1F17A 4LJ8A 2K4MA 4L9AA 5D1HA 1SH7A 4IJQA 3ZGZA 1GQFA 3LS2A 3DAPA 3G2HA 3N6VA 3LC1O 3FFAA 4BNFA 3P4UA 1PN3A 3NYQA 1RYNA 4B6RA 4HFRA 1SQ6A 1FP6A 2AC7A 3PT9A 1M6NA 1VQ8B 1XLUA 2R6AA 2DQSA 4JX9A 2Z2KA 2TYSB 9ABPA 3IVGA 3R09A 5J2TF 1USVA 3N1UA 2WG2A 1JR3E 3HO6A 4QGHA 4HATA 4ZVUA 1OASA 3CUUA 4WXYB 3RKUA 1AS2A 3GP8A 1J1IA 2AWOA 4FOLA 3R0VA 4GMKA 2WP8J 2XMZA 3V8PA 3SC2A 4CTKA 5JQGF 1W4BA 1DLJA 1Y9ZA 3I6YA 2XZLA 2RH8A 2X5OA 3IV9A 4Y0AA 4BAUA 5A4IS 2GBPA 3R24A 3D54D 2ZIVB 2B36A 4OGKA 2WU0A 3T1HB 3LPCA 4XM1A 2FPIA 2A3NA 4OQPA 5CDYA 5GADl 4Q3LA 3KB2A 5FUQA 3T5AA 2A59A 2WJPA 3GRYA 4X84A 2UUOA 4XZ3A 2VJMA 4MB6A 3F96A 4IFTA 5AW1A 2ZL5A 3C2QA 1IWPB 2YJGA 4YRPA 5KVVA 1QVVA 2P79A 5K0GA 2OC4A 3HKCA 5ALEA 4K9QA 3OFJA 2OTCA 1UQTA 2ODPA 2AK3A 4Y0NA 2J67A 1F5SA 1ZJ4A 3HJGA 4B31A 1H4SA 2VUSA 3WICA 2IEDA 5F4MA 4UPEA 3U7FB 1WMSA 4Z4UA 2X2FA 5TIIA 3QA3E 2C2GA 2PXCA 5EMKA 1SM4A 2W83A 1NE7A 5WRFA 2JLUA 3K70C 4HRAA 2I2XB 4KHPB 2FQQA 1NKTA 2X14A 4YXWD 3AL0C 1PR2A 3NATA 1GZ6A 3KSUA 3OD1A 3FNBA 1XD2A 4L08A 4U7GA 2D59A 3UMFA 1DIGA 1S2MA 1XMPA 2JAWA 4HDKB 1QRSA 2ZQZA 1GAXA 2VJMB 2C5AA 3E2MA 4URXR 3DDHA 1T10A 3IAXA 3PFIA 1G5IA 2QN8A 5I7EA 2XTZA 3SSAA 1GM5A 4IWNA 1JEJA 1HE1C 1QC5A 1CU1A 4KNVA 2BFBA 5BY2A 4MV6A 4F92B 2AJCA 2JGAA 2KW5A 1TVKB 4MR7A 1GQQA 3PIDA 4Y2HA 1A1SA 5EIEA 5BSXA 1B6TA 1Y9DA 2CMKA 2PCLA 2XQVA 6YASA 3X1KA 2XKAA 3UMYA 1THMA 2J07A 3KB1A 1EI9A 1QPGA 3WADA 1PX2A 5HMMA 1XMXA 4BV9A 1G20B 1HSOA 1VE6A 3MZ0A 1WSWA 1Z6QA 3AB3A 4R41A 4RZ3A 4UPVA 3DMDA 3VR4H 4LXHA 4C7XA 3S2IA 3WXBA 5IVIA 4LE2A 2LZ0A 1AGXA 3KQNA 1WR8A 5CP8A 4YQFA 4OJTA 1OI2A 3LHIA 2R6ZA 5E6UB 1OE0A 4RZXA 4W5TA 2W6JA 2OC9A 5JEEA 3CEJA 4IUYA 2JH3A 2RHLA 3MTIA 3BMOA 4MMXB 3RYHB 3P8ZA 3T7DA 4CLDA 3Q3AA 1VSTA 3RRMA 2FG6C 4KQ9A 4DA9A 5IG2A 2IYUA 5T8KA 4FHDA 1HYGA 3HADA 2WUDA 1RM4A 3AY3A 5K3FB 2C2WA 4JR2A 1UD8A 1B26A 4MQEB 1GKIA 1M2OB 2B82A 3RVDA 4DDHA 1OA0A 1Q6YA 1SXJA 3P0JA 4L4SA 2Y66A 4NCXA 4DV0B 4YV7A 4IHKA 3AFOA 2R4UA 2GF2A 4J3JA 4DSUA 1A77A 2ASEA 4YAOA 3JCZA 3GVLA 3V2UA 5JTUA 1BE0A 2JPDA 1KWGA 2B8EA 3P2OA 2VN8A 5E95A 4G8DA 4N6GA 4BNKA 4KDCA 1XFAA 1M2JA 3LCMA 4G1FA 2OBNA 3H6HA 1XQXA 4ZT5A 3PEWA 2A9JA 2EZ9A 4UUMA 4R8MA 2IELA 2X8KA 4ITRC 4OYHA 1JKIA 3RH0A 3V55A 1R9MA 4NJEA 2IYEA 4U7DA 1BMFA 2YUTA 4FQ7A 4P86A 4U3JB 4WLVA 1PR4A 1PJLA 2DT8A 3W3AH 1VE1A 4MB2A 2ZWVA 3BUSA 3RSGA 5CLIA 2AFIB 4Q9HA 3WC4A 2YVQA 5JQWA 1AKUA 1G7SA 1DDGA 1E2NA 3M8KA 2DJ5A 1YVEI 3G2MA 4OHBA 4FKMA 4S0XA 3MS2A 2EQ5A 5CIWA 5DX0A 1M6YA 3RCBA 1GFIA 1RRGA 3H1AA 1KPGA 4IZ6A 3WXMA 3LX4A 3QLVA 4J3NA 3VI4B 4A1OA 2XUZA 2NVBA 2IUUA 3F7NA 3OD5A 2REQA 2AJBA 2LPMA 1EP2B 3PUMA 2H1HA 3DPIA 3OLZA 2QR2A 4FMDB 3ZJ4A 5JCOC 3UFXA 5KTMA 5EINA 5LYJF 4QASA 2VPXA 5JNTA 1SNYA 2WWRA 2PWBA 2A0FA 1HQDA 1N92A 4EK9A 3EMDA 4IIDA 3ZWNA 1QRTA 3IODA 1X19A 4S12A 5K0LA 5L6LB 1WMAA 4Z9XA 1U3UA 5GGYA 5HF5A 4JLNA 1GPNA 3I56B 2PH7A 1PGQA 4M1OA 5SYNA 5JYCA 2Q41A 2EKDA 5DGHA 3LYHA 2ON6A 1QIJA 1NF2A 3WZLA 4RF3A 2EZTA 1KERA 2J3JA 2AR0A 4BV2A 1E98A 5BUQA 1F6WA 4TUYA 1A4UA 2PMWB 2HWUA 4R51A 4JITA 4CT5A 3BXPA 1KI2A 3D8UA 3GVKA 3N2KB 2V1XA 5JFGA 4Q37A 4AYTA 3LP8A 4G65A 1Y82A 4IIJF 3ZHBA 2ZIFA 3SNKA 5AW6A 3R0JA 2ZR8A 3UMMA 4G9BA 2L18A 2QVCA 2BEUA 1GPWB 3MSCA 2H2IA 2W6QA 2V7UA 4Q7EA 4XLHA 3L84A 3G02A 4B8WA 4EEZA 3ANSA 3N8DA 3NXKA 3PUXA 4FX2A 2DBVO 4LYHA 4OP1A 4PEVA 5DKFA 3LF2A 3CTMA 4INAA 4Z9FA 1NXSA 4F5EA 1XNGA 4E6EA 2YWRA 1K2VN 3BJIC 4LF4B 4FBLA 3TSZA 4I4TA 3O4IA 1OIVA 2B1RA 1D2GA 5E6SA 4LXGA 3EGOA 4ZJZA 1XKTA 2BMFA 2EEPA 3OQIB 4O1MA 3EOZA 2YW2A 3UB2A 3NHMA 1P9OA 2J0EA 3KQPA 1EGHA 1XPJA 5EI5A 5C5DA 3KKEA 2VJIA 2YN0A 3RSSA 4CF7A 4L5JA 4NU8X 1FTGA 4OOVA 5DNEA 1S01A 3GUVA 4JMLA 3EVBA 4C0BA 1HBJA 3NMUF 1GR1A 1VOTA 1Y0BA 2Z1NA 1KKMA 1EB8A 3D6TB 3X0DA 3HY3A 3L7DA 2H0RA 4S1VA 1N2OA 2J4CA 2CB0A 4YMVA 2A1TR 1AHIA 1Z0JA 2WAXA 3HCOA 1V3TA 2PJZA 1WP6A 3MPOA 5D84A 3UMJA 4HAYA 3HN6A 4QJ3A 3BH4A 2B83A 3QUQA 2FEWB 1N33B 2J59A 1RJ9A 2OBRA 1CVRA 1Q84A 3JSAA 4HJXA 4JP1A 2GZ3A 1AY0A 4WUVA 1N5JA 3C4JA 3WYGA 5ENVA 2YV3A 2QTFA 4RE5A 3UFBA 3HVKA 3HEAA 1ACMA 4CEHA 1DGQA 1N6KA 2I1QA 3MLBA 3A1FA 4HQNA 4EYQA 5J4YA 4QX6A 1SCUA 3KVYA 3LPAA 3FMVA 1TE2A 3SJBA 2IXBA 2JCVA 3DCJA 5FJIA 5L53A 3F90A 3Q6RA 1PWXA 2XNHA 5M29A 2OCDA 3DAYA 5A0VA 2X9GA 3WYAA 1YUNA 1N1DA 3K0EA 4DJAA 1GPUA 2COKA 1Z5NA 4GI3A 4HLUA 2VRNA 3WRYC 1XTUA 2B9EA 3WNCA 1M6VB 1N6RA 1RJFA 1BN6A 3A9RA 4J16A 3TE6A 4NKRA 2H07A 4K9SA 3TFQA 3CP2A 4BJHB 4OV6B 5JSZB 2JCBA 1WMEA 2JIOA 2FPXA 3RT7A 3MTGA 1LFDB 2UZ3A 4U9IS 1WOSA 4MPPA 1YIDA 4G3XA 2VF5X 4QO7A 1R2QA 5AJZA 1LLCA 1F60A 2HM7A 2W2TA 2YV2A 2ZYGA 4I1YA 2YKGA 5HZKA 1XQVA 1YZQA 2G9VA 3BWDD 4D4MA 1Z4OA 3CISA 4DRXB 2PKQO 2O8BA 1KIMA 4MI1A 5G02A 1FDOA 3CIOA 3OCZA 1EM8B 4YX9A 2RGNA 5DHQA 3PU6A 4UULA 4YAKA 2OMEA 1XLTA 5GOZA 1FX1A 3GIRA 2Y6UA 1HTBA 1YGYA 3NC0C 1EUQA 4WKNA 2YQ4A 1P3Y1 3AF3A 5IABA 2A92A 3SXJA 1KOLA 3D2LA 2R25B 2X8LA 2O07A 1KC3A 2ZZQA 4GFDA 2ZWAA 1Z5OA 1CKEA 3QUAA 4WNCA 4L4RA 4HQOA 4P26A 1YDGA 2DG2A 1ZGBA 1S2DA 3N0RA 2VXBA 2YZKA 5FOVA 1E1LA 3RG8A 3BRCA 1JQAA 3U1VA 2XXJA 3PS9A 3B53X 5JS2A 5KNLA 1I18A 2H3HA 2FUG6 2ISCA 2W6CX 1EHIA 3EJWA 5ESDA 2RH5A 4MX8A 3LBIA 1MNQA 3X1YA 4TWRA 4BX0A 5DLYA 4UTRA 3HO8A 5AW7A 4D6PA 1Z0ZA 3K31A 1K4KA 1WY5A 4C0LA 1OYYA 2DTXA 3MD9A 3OESA 3DP7A 4D79A 5PNTA 1UBKS 2D8AA 4U7PB 5FHQA 3GQBB 3MRTA 1FE8A 4MR9B 3ELDA 3T0FA 3V8MA 4DEXA 1JMKC 2IIPA 1K0FA 2ZP1A 4FYWA 3RSHA 4X65B 2JJ1D 1T5IA 5D86A 3EWIA 4O2BB 3M70A 4Y1RA 3T1YB 5FNVA 3L6BA 4ZV4A 5IBQA 5C80A 3M1YA 3R6GA 2VCYA 3J7AC 3H18A 3AGPA 2HK8A 2R1TA 3AFHA 3ESDA 3UMCA 2RCNA 1BD3A 4MVJE 3W5CA 3OP4A 3EIHA 4XM0A 5CAEB 2B2NA 3TSCA 3RC8A 2G0AA 4MVCA 3ECSA 1HTTA 2DHEA 4OI2A 3VHXB 3LFUA 3HCNA 5B7PA 2Q6IA 2P2SA 3VMFA 1KDYA 2PXAA 1HOXA 3U4AA 4C08A 1Q0LA 3PHGA 1AK9A 4BAGA 1DEAA 2XA1A 3R9IA 5G1OA 1GY8A 4UOEA 5HPYB 2QTWB 2C4TA 1QHSA 3A1UA 4RELA 4ZWNA 3TQOA 4TM8A 3QBTA 4JQZA 4WY5A 1ZGJA 1Q2XA 2Q46A 3DOCA 4OPOA 2WZNA 4YAWA 1KAEA 1NVGA 1W6RA 3Q40A 2CZGA 3S2SA 4PGOA 4B3JA 1PZMA 3O8LA 3GGPA 4NYMQ 5HUJA 1J2RA 2FQYA 4BP9A 1MGOA 3JD1A 1DV2A 3MTBA 2JZCA 4V39A 4YRKA 2ZS9A 3O8QA 2WUGA 3E1GA 3A2LA 1E8NA 1YK0A 4N5DA 1G98A 3HPRA 3MT0A 3LV8A 3E35A 3CLHA 4TZ0A 1FRNA 4TT8A 3GLGB 1WSAA 3EASA 3NH9A 3OKAA 1HF3A 3F46A 3DHWC 4LJ4A 4MO2A 2PZ8A 2QLLA 2WSBA 1YVUA 3MRVA 3OF3A 5CW2A 4ENRA 2IUYA 1VQ5B 1R5NA 2FW8A 4NG4A 3SQOA 1TZMA 1YUBA 2IH4A 2HHJA 1PG5A 2Q5JA 4P2BA 2W9XA 3MJTA 4TYPA 5KYTA 3EIUA 3PYXA 3LT4A 4JN6B 1O97C 2EOAA 4BO3A 2NOAA 1BO6A 2VXOA 3PWSA 2WAAA 5CNJA 4P5DA 1G5QA 1RMTA 1RLIA 2MSCB 3QVLA 2C2KA 2W0SA 3KLOA 5HZGA 3RHTA 3PRJA 5G2OA 1IN4A 4DL9A 2WZPP 5E9JA 4IKOA 2WU3A 4MUEA 1QFSA 5LQJA 2RGUA 5A7FA 1OUMA 5JC8A 3DEIA 1Z2AA 3H5WA 5B6JA 1COWD 2RHGB 3B6JA 2BONA 5KWIA 2KJQA 1MQ8B 1KZ7B 3M6AA 1Z5PA 1C0IA 2N3ZA 3PEFA 1JTFA 1L3CA 2GHTA 2K6GA 1BOFA 2XVXA 1C0LA 4IQ0A 4JP5A 1P7YA 5DNUA 4LJ9A 3J80A 2GQ0A 1VRWA 2X0JA 1RRCA 3RUPA 4D82A 3DL7A 3L0OA 1EFVB 2PBZA 4PVCA 4Y2SA 4IVRA 1W2GA 2VDLB 1E9FA 3DWFA 1OKKD 2PX6A 2WOJA 3A6HA 3RS3A 3HBLA 5F1OA 5EUMA 1I3KA 3S1AB 3ZU6A 4EDFA 5CVTA 1G63A 2PAAA 1E1NA 1OBCA 4IIBA 4UDOA 3WR5A 2C1EA 3NVAA 3KYBA 1UJNA 3FPBA 5KAMA 4G5RA 2R7MA 1HYEA 2HLHA 4IIHA 5EFOA 3LPNA 2C8VA 4KBGA 2VNSA 2ADOA 4RPIA 4M9UA 3RF6A 4DMGA 4OHPA 2BN4A 3IOCA 4I08A 3IEUA 4XEHA 1DCTA 1E32A 2XMGA 3AR6A 4FJ2A 1JA9A 5CYOA 2DLNA 3IHLA 1YBAA 1CULC 1LPSA 1M3SA 3GA0A 3QE4A 2D1QA 3QU4A 1G21E 4ILEA 5JDIC 3KM0A 1CY1A 5IAEA 2X1MA 3ELYA 4PZZA 4J0JA 1DTSA 5CDUA 1C3LA 2DPGA 4B4UA 3S4YA 1AUPA 5K6TA 3AM5A 2WM9B 2WTAA 2FGJA 1UAGA 4XGQA 2A1UA 3V1TC 4K46A 3W9BA 4OX9Y 2BF7A 1NNUA 4EA8A 4JSTA 2YX1A 4AMYA 1UD3A 2P5YA 3OLYA 1DQYA 2OZLA 3QUSA 2JZNA 3NT4A 2FFJA 1RI2A 1EK6A 3FG9A 4K3VA 4CMGA 1CY0A 3OQ6A 1KE2A 4ZI7F 2D62A 3VM6A 4Y9UA 1P1FA 1ADCA 1GGHA 1JV2B 2O2CA 2XUIA 2ZQ5A 1D6MA 2SECE 3B1WA 4GRDA 3RBAA 1G5HA 3EIWA 4L8GA 3THXA 1D4AA 3KR2A 3CW9A 5JV5A 5IP5A 1DT5A 2ZYWX 4QLBA 4M9ZA 2VSQA 3L8CA 1N2JA 4PC1A 2NXWA 2V5UA 1NBIA 4LDAA 1D4OA 2EFGA 4QDZA 5K8JB 4XWTA 1EFCA 1XMOB 5BN5B 3KTAB 2AFVA 3KVOA 1MVNA 4EFLA 5CDSA 5EKXA 1G5RA 4WHMA 1LVHA 3BWXA 3L9WA 3QVUA 1JFVA 4JJ7A 1QYIA 1DRUA 4YP1A 4M8LA 4KO3S 4DPKA 4ZCIA 1T6BY 1E7MA 2XUFA 4HDMB 5HDBB 2V6IA 3AHCA 1N75A 4O5OA 3ZDQA 4D9KA 4JLWA 1UKYA 1EAYA 1QYVA 4JQYA 1XA4A 4L5BA 2OFWA 5J5VA 5TXGA 4CKEA 3LPDA 2BLNA 4CMJA 3BWMA 3DFMA 5K45A 3CZQA 4LDZA 4PO3X 1J0XO 2O7RA 4Q02A 2EKQA 1Y3IA 2CJXA 3O8OA 2VL7A 4LFBB 3F9IA 3OMLA 3TLEA 3HJNA 3CPHA 4BKPA 1P61B 2LXNA 1Y1RA 2ZYSA 4AS3A 2EYUA 1J42A 1E2EA 2Q9UA 2GJ9A 5BRNA 3R74A 3SYMA 1OVGA 3VKWA 3VYRB 3ZXSA 4B2YA 2O8EB 2B0JA 1YO6A 3PQ7A 4TTIA 3DL0A 1ULAA 1MTZA 3EGEA 3OUZA 3SOPA 3ZEAA 2QJRA 3GN1A 2GEKA 2BFEA 4FJ1A 4JBGA 2VTEA 5HCIA 2DB3A 3GROA 4K6FA 2QG4A 2FKNA 3H4VA 2EFYA 4UUOA 3UKJA 4BRWA 3U9TA 3TTYA 4XVHA 3W4JA 4QU0A 3W8RA 2R7AA 8GPBA 4YJHB 5IAGA 2V0GA 3PUKA 1U0RA 1L1QA 2WYUA 2Y1KA 3UUWA 2H4YA 5JW6A 1D5WA 3MGCA 5GVSA 5EZYF 4WZBE 4X63A 2WUFA 2UXDB 3V48A 4PG4A 4E6PA 3G6KA 3CLUD 2DWOA 1KYWA 1FUKA 4K8RB 2RC6A 2FN9A 2J5QA 1AHHA 5EA2A 4JP2A 5GJWC 5LB4A 3V2IA 8LDHA 2HLPA 3E48A 1ZW1A 3NPMA 5JQGB 1GZSA 2WWXA 2J0SA 2FSHA 4FFDA 1UKAA 2WV9A 1CQIA 2NZUG 3QWBA 5CJPA 1YS9A 2YH2A 4XKWA 4NHEA 3TD2A 4UZUA 2QW0X 2XZPA 1OQAA 1GZDA 2PH5A 5EJ6A 1DC8A 1B76A 3LC2O 1J4AA 5KS2A 1UP6A 1XZMA 3BRWD 2Y8EA 4FSXA 2ZYIA 4INZA 1YQXA 2R8OA 3DG9A 4GKAA 2PLFA 3ETLA 1U2GA 2GTHA 2IVZA 2QTCA 3B8EA 1ZK3A 2WILA 1KZ4A 2CK3D 3H3JA 5IJ9A 3EFEA 1DC3A 2RKWA 3ASQA 1JBEA 3FMIA 3KKLA 4WERA 5BSUA 2I4OA 1SO8A 1UPUA 2HU7A 4JVOA 3DLPX 1YCHA 3ZCVA 1EXNA 4IM7A 3I9KA 1KJIA 3C3AA 1CNFA 1Q3KA 2JIRA 2XVYA 5GPBA 5BRAA 5BWLA 4X85A 4HRYA 5C37A 4DJ5X 3CC4B 1GCIA 1K06A 1E62A 1K7SN 2W48A 3ZZTA 2F7SA 3UKOA 1BWRA 3OKFA 3Q1LA 1ZIYA 5FB3A 1MH1A 1XF9A 3VHRA 2P9JA 1T0IA 1FVXA 5KYWB 1T6NA 3IT2A 5IFLA 4BAZA 4TMVA 5K0CA 3LSYA 1O1YA 1YQEA 3FCOA 3VR5D 3RTCA 1KDRA 3ILHA 3GEBA 3LT2A 3GZ4A 3MQFA 4YT8A 1U8ZA 1RWMA 1EP1B 1C50A 1IBRA 2HUPA 4MP8A 3E18A 5LD2B 1IAQA 2I4NA 1RI1A 2HYIC 2Y67A 5KYVA 3L7IA 4UFPA 3C7TA 4ZTBA 3CNLA 2VHTA 4OP2A 4CL8A 4YMHA 5IJAA 2DIEA 2Q5OA 1RXIA 4KREA 2WJ4A 4K5QA 5AOBA 1X0VA 3E5MA 4DAOA 1DE0A 4RIFA 1OAKA 1MC8A 2VYNA 4KJXA 3OIWA 3ZWMA 4FD3A 4NH0A 4KR9A 2Q5IA 5BMOA 4QVIA 1V1MA 3H5IA 3FSGD 4HIZA 2X86A 3QWHA 4YNBA 3AERA 3K6KA 4X94A 2IZ5A 3OTGA 1RWXA 1ZM2A 3EF3A 1GZ3A 1SPXA 2EV9A 3PNVA 2P7IA 1PJSA 3OPXA 3NONA 5F3RA 3IP1A 3TAXA 5I7SA 4B84A 2R2AA 4K9NA 1WZUA 3E7PA 3OJOA 3EZ7A 3SFZA 4OQZA 3RJ5A 4G26A 3ZHUA 2O2GA 1RWKA 1OGJA 4W5WA 2EHJA 4LE1A 3ZDYB 2O8VA 4IGIA 4P58A 3F6EX 1IM5A 3FLMA 2ZUVA 3OWXA 1SHTX 2QX6A 2ZI7A 3K2QA 4DCJA 2XPCA 4I4IA 5CBKA 3AR3A 3UWDA 5JD6A 4Q12A 2J87A 4KAJA 1OI7A 4TL6A 621PA 1KFEB 4QTUB 3AR9A 3D9QX 4C89A 2A0YA 2PUEA 2QL9A 2EWMA 3ZE0B 1Z6YA 3Q7QA 5CCDA 3T9EA 4X7MA 5IZ4A 2P2CA 3TD6A 2VPIA 1CQJB 3VZPA 3AKEA 1AGPA 4D5GA 1V1MB 1NLYA 4WECA 1ZVMA 2YVKA 3LRPA 3MEQA 3VR0A 4E13A 1PR3A 1IQ0A 3I2JA 4JK3A 4CT0A 1XROA 3GRFA 1Z12A 1E1RA 2CD7A 3O2NA 3GPDG 1UDCA 3A2NA 3CG0A 3SHFA 1N6HA 2FRDC 4AURA 4G2TA 2BKEA 4IVPA 5CX1B 4HN4B 2V4MA 4KSYA 5HRAA 1N7HA 3GLFB 3GFQA 1E6UA 5A05A 5HTOA 3D8HA 4LXYA 3JQAB 3HR7A 2RCYA 3LRTA 3MUOA 4MQ5A 2AC2A 2DQYA 3H1GA 3T3DA 3X2FA 3GFFA 4I66A 4RIEA 1N8TA 3GEMA 1Y6JA 2W6ZA 5ER9A 1YI8A 2QK4A 4Y2VA 1LZLA 1V7QA 2JFZA 3RRXA 2FW7A 3ETCA 1IVSA 2Q7OE 2CKDA 3OPVA 1XD2B 4CEJA 3EFOA 5M04A 4HQ0A 3UHPA 5CVVA 4M1YA 3PXBA 4C0AC 3D3WB 4NPHA 4P83A 1L5HB 4P31A 3ORRA 1ABEA 3THWB 3SC3A 5JO9A 4KKSA 1D1NA 1Y6ZA 1AOXA 3DA8A 2DPXA 5E0OA 3NALA 4IDPA 4W5QA 3CVXA 4KZKA 3VAAA 3ZLBA 3NNSA 2QZ4A 1CZLA 1BX0A 2WWVD 2YUIA 3EOAI 4ND7A 1VYUA 3KBBA 2O50A 3WLQA 4EAQA 1YQQA 5ICMA 3HBAA 5H4HA 5K03A 1J2JA 4PPQA 1RAIA 4BZZA 5JEDA 1YVPA 2WU4A 4KO8A 3VC2A 3GGCA 3HDQA 4IDEA 1DIBA 1XZKA 4ZRNA 4EJSA 4ZO4A 5ITWA 1KR2A 4HE5A 3ZDFA 1Y3FE 4D4GA 4CL2A 4B81A 1MV5A 5FQNA 4B3RB 4HGYA 3K6SB 5KU7A 4F5DA 2A14A 2HMTA 5DCWA 3T7JA 4W9NA 1NZFA 3NBQA 2IS4A 1KIFA 1T4CB 4URVR 4GBJA 3IVMA 5EP4A 1XDUA 5JPDA 1ADBA 3T9FA 2RIRA 3NHAA 2FUG1 1BXKA 3P4YA 3KL9A 1GFWA 3PITA 2PR7A 1TQDA 2PS1A 3MHPA 2GN1A 1ZL0A 4MKXA 3U7EB 2BVNA 2XMBA 2WJAA 2ZAMA 3N8KA 2RHHA 3CN9A 2YBDA 3ZJVA 4MVJP 4CETA 3FOFC 5A88A 3JAWB 1DEHA 4KWHA 3C6XA 2PKEA 3STWA 1UXOA 2RGXA 1YACA 4AZWA 4TMTA 5I4CA 4JNKA 3K0HA 2O5RA 2YINC 3ZV6A 1CJVC 3LCCA 4RA6A 4QPPA 4DBVO 3P26A 4ENVA 5B30A 2JLWA 1NQTA 2DFPA 3VR3D 2CXUA 3Q7SA 3C3JA 5C46F 5HHTA 1YI2B 2PZMA 5REQA 2B99A 4Z4VA 3A26A 2QYTA 1COZA 4MIOA 5LIRA 3SQLA 1C9KA 1TZCA 3CEHA 4RGYA 1SXJD 3PI6A 3I09A 2BI8A 2EFHB 2D4AA 5AVYA 1ZHOA 3RS9A 4LDPA 3FPFA 2EKLA 3EQZA 3OSZA 3GGGA 1NUHA 4AJHA 1KVUA 4BO6A 4D2IA 5MN4A 4ZAYA 5JOQA 4I4NA 4IJ5A 1SURA 4ML3A 5AI6A 2XDQB 1FFSA 3GAFA 4PYLA 1NXTA 1G1AA 2A1TS 2OO7A 3DZCA 3EGDB 4GNRA 1MHPA 1LD3A 1USWA 2FJUA 2ID4A 3GLHB 2WSSD 4MUMA 3RK1A 1U8TA 2G0TA 5D7NA 3T9AA 5KSYA 3TQQA 2YIVX 5LDDC 3QFTA 2C83A 3F4BA 4BMZA 5KQPA 3INTA 1SVIA 4KMRA 3OU6A 4DNOA 3AFNA 2QVXX 1P5JA 1MRNA 2HRRA 5AXCA 1L8LA 2GDJA 2HFJA 2JRLA 2R8ZA 2OPHA 4LHSA 2HBZA 1HE3A 2ZLBA 1K08A 1U2DC 3CR7A 1VLLA 1X38A 2RHDA 3AETB 4XDGA 1W94A 3HSSA 5LM3A 2FZKA 2JDID 3VDNB 2X8JB 3N75A 4NQRA 2IP2A 1AE1A 1KGDA 1M8JA 3I52A 2VSYA 5BT8A 5D3MB 4U2DA 2GARA 2YWBA 2C7QA 1YZYA 3EXG1 2I6UA 4KHZA 4X92A 1NXWA 2Q5EA 4E5DA 4D8VA 4ZYVA 5INTA 2PY6A 2H5JA 3KT3A 3MK31 4YC7A 4BX9A 4GBED 5FHRA 5CB4B 1JL3A 2HEGA 5ER6A 4ARAA 5FOWA 3E22A 3U7QA 3BMXA 4X7CA 8MHTA 4C14A 4JBIA 5HGJA 4EHFA 4YBZA 5F7ZA 4O2AF 3UMVA 1SBIA 3T4XA 3DKRA 3WK4A 1IBMB 1ISMA 2ZZEA 1QZUA 2OHOA 2XNKA 3PKIA 3AU8A 5H70A 3GXBA 1HPLA 1KPHA 1OWNA 1PQUA 2JW5A 4IIEA 4RVCA 2V96A 2MWMA 5JSHA 1KI6A 5EJ7A 1BMDA 5ED0A 4X3CA 1GTZA 1RIIA 1QKKA 1I6WA 4Q24A 1LRKA 3EQ9A 4N9WA 4FC6A 1H1DA 1Y4SA 1ZY2A 3CTAA 4MB0A 1B16A 3ABSB 3IEXA 3Q3VA 3HWSA 4N1AA 3SVLA 1EP3B 3T95A 5IS2A 2G04A 4J7CA 1VZ2A 2DSTA 3PWZA 2ET6A 3CSUA 2B5WA 4B2IA 2IH2A 3IAS6 4II3A 5FUBA 4DYHA 5HOQA 3G8AA 2OPBA 5IUNC 2NMVA 2JVJA 2QKYA 4HDSA 3WQSB 3UXMA 3HDHA 5CYFA 5CEFA 4LNUA 1Z5WA 4FGLA 3BSYA 4YV2A 4LXXA 2FVXA 1YZLA 4XGIA 2GA8A 2NZWA 4TKVB 2VQSA 5JTTA 3C43A 3RC3A 5C4MA 4OREX 4TQUS 2RDMA 4H3KB 3EZ6A 4Q01A 1BDJA 4GWLA 4P93A 1FUUA 1YXMA 4BBZA 3MGBA 2YNMC 3WLAA 2XJ4A 3DMTC 1PUXA 3CXCB 3GEIA 2WVAA 1IN1A 2WF5A 3G0CA 5BNTA 3EPRA 6GPBA 1PZEA 1HRKA 1OXBB 4W5OA 2WTEA 2WWFA 3H86A 2IYOA 3IDSA 1DC6A 2WJJA 4XYGA 3RF7A 4AU1A 1QUEA 1BHJA 5EJ8A 3Q0IA 4XGRA 2ZRFA 5AYVA 4KX5A 4OHYA 2QZSA 2YFKA 1Z2OX 3HBMA 4LXIA 4H7EA 3AEUB 1LX7A 4J7UA 5JSYA 1VMEA 4S3MA 1TVCA 3V34A 4M1EA 3DT6A 3V1MA 5KVCA 4CM8B 2C2BA 2FMUA 4E4RA 8ABPA 2VXYA 4Z4HA 3HXKA 4TRNA 3B3QA 3CUSA 3NTVA 1P0FA 3OU7A 2Q4TA 4GYKA 1X9GA 4NXMB 2V7TA 1R0ZA 1VSQA 1Z0IA 3K4PA 2PKWA 4CDNA 5AKZA 1B7GO 1SG9A 2K2QB 4L5AA 4HVTA 3DL4A 2I03A 3LZCA 3CYFA 1N1EA 1J1UA 3W6OA 1ZD8A 3GFSA 2X4GA 1GOTA 3COVA 3NDIA 4DCCA 3LFTA 4MWTA 1VP3A 3T3PB 4RTSA 2HGSA 4B3HA 1ZGGA 3HB5X 3MXOA 3QP9A 4L0CA 1ILWA 3FCEA 2CFIA 2R9VA 3T7KA 3GZNA 1L4LA 4CMKA 1PQWA 1ZU5A 1E1YA 3DTVA 2NU6A 5ALKA 4BUCA 1C5KA 2BBOA 4B47A 1KRHA 3F5QA 4OI4A 2AUNA 4DA0A 4ARSA 2GNPA 2WJHA 2Z43A 1W0JA 4EH1A 4ECAA 4GPTA 4Z7NB 7ABPA 3KQOA 1TUIA 1MX1A 4MICA 3NVKI 5BMVA 4ZOEA 1RQXA 3LL7A 4CM9A 4FNAA 3EFBA 2FUCA 3S81A 2G76A 2X3FA 4B3XA 4OHWA 3ON5A 1CEXA 3H9EO 4BQQA 4E1BA 3K2BA 1WUHS 4WACA 3DMYA 1H2EA 3P96A 5TVGA 2PGNA 4RTLA 2IOYA 1OXSC 5TY0A 5AESA 3LG2A 3BXFA 3COPA 1YNOA 1T2DA 4LY9A 3DTVB 4E0FA 4P5PA 4RZIA 4JI1B 4C5CA 5G1PA 1KK2A 5JCXA 4LDQA 1P9RA 3PNOA 2H31A 3CMAB 1PV1A 4WCFA 5ABPA 1WSRA 3TQCA 2DHRA 4RK1A 3MB8A 1T2AA 4DMCA 2RFLA 4YS6A 4KRXA 1UBHS 5GV7A 2JFHA 1I3NA 3TR5A 1P1CA 4KNYA 2UYYA 3G7UA 1JFFB 5KWJA 1JQLB 5EJ9A 2FU5C 2PMEA 4CV1A 3EHEA 4CQNA 3PRYA 1HEUA 1HDOA 3K96A 3KC2A 4P92A 2CL6X 4X97A 1YE3A 2A0UA 2F6RA 3T7TA 3G2JA 1KEEB 1FFBA 3OIDA 2MYUA 2C78A 4A03A 2I7DA 2Q99A 2LDXA 4QRHA 4F3NA 3LVBA 2PYZA 1RHUA 2JLSA 2ID7A 2FSSA 2IP4A 2YJZA 4ZOLF 2Y4NA 3AR8A 3D8BA 4HDCA 2GJSA 4UAVA 3OFNA 1S7GA 1XAIA 1C30B 2P67A 3PR2B 5FI1B 1E2LA 3ROXA 4F11A 1W29A 1GDTA 1VLZA 4DLLA 1V1RA 2PDAA 5BVGB 5DHRA 1IL0A 3QOFA 1LLFA 1KDTA 1KBQA 2HEIA 4LTMA 1JR3D 1S96A 2J9YB 2BMWA 1YUMA 1BFUA 1T3ZA 2ZWMA 2E1RA 3HN7A 5GWXA 4LBVA 3AYZB 1YRHA 2BFFA 4ZCMA 4P3IA 5IAOA 1VE7A 2GILA 3HB7A 1MO5A 1UKEA 5AOVA 4LMBA 3TRDA 2D0PB 3PC2A 3SBDA 3VOSA 3WQRA 1II8B 1ZA1A 3JD3A 1PJRA 4TTRA 4UMEA 3W4KA 1JEOA 2OWDA 4UTZA 1RYBA 3B70A 4YRAA 4MS3A 4YT5A 1J7KA 4TYQA 3ASVA 3QNUA 3D8SA 3LLSA 1F2TA 2D2EA 1BOOA 2DHQA 1IB0A 3AUUA 4I8XA 1KP9A 4QOHA 5KJEA 3VSAA 2NSHA 2C5BA 4C6SA 1PNTA 2Z4SA 4XX1A 5DTQA 1GLVA 4NU0A 1DAEA 2AT1A 2FOLA 2G1UA 2HZBA 3A1SA 5JADA 3K0AA 4GVLA 4NOMA 4QTTB 3U17A 3R3YA 2R5WA 4GP9A 4M0EA 1Z6TA 3GDOA 1GWNA 1FFYA 1JHUA 2NT3A 3AMVA 4YREA 1E79D 1EWVA 4HH3C 3ZU4A 1BU8A 3DLIA 1L7QA 3ESZA 3PLRA 4UNIA 2YC2C 1PSZA 2E4VA 2I3ZA 3AVWA 3IPCA 1NMZA 2GJKA 2EZ4A 5EZ6B 1IUNA 4A2QA 2ATCA 2ALJA 3BFVA 2JLVA 3KETA 1UZNA 3IHTA 4NDAA 1P4MA 1THGA 1RPJA 1KVTA 3ANNA 3FNGA 5BSTA 4CU2A 1QF9A 2NXJA 4A8JA 5KBYA 2L82A 3QJGA 1XWWA 3I04A 3BIWA 4EARA 2GVZC 2DULA 3O91A 1P31A 2VCEA 5TT1A 3DGEC 4DXAA 1PHPA 4AN0A 4OAOA 3ZXIA 2AZTA 4LTNA 1CQPA 2R11A 4K6OA 5E1OA 1APBA 4CLOB 2I29A 3Q3CA 2FP4B 1OWOA 3N5KA 4JX8A 4JQCA 3EC1A 1EDZA 5H83A 4YUXA 4YT4A 1O7JA 4X7FA 1IN8A 1KZ1A 3JRNA 4EMTA 2Q5LA 1QGOA 3H4IA 3HDTA 2D06A 1GPJA 1LV8A 1P5FA 2GUGA 2J9ZB 2NTVA 2QD4A 2ZRGA 3A3NA 1FTNA 3AB8A 4F3KA 4D9MA 4R0MA 5DEOA 1IHUA 2XRMA 4AO7A 4E31A 1N2GA 4XVCA 1O89A 2D2IA 4RF2A 4ZGGA 2XBMA 5FKJA 3H5NA 2BTOA 3WHPA 1OYWA 2Q2WA 2IU6A 4FLEA 5FNVF 1ZUHA 1EGMB 3OLXA 4YT2A 3ED1A 5I7WA 1ZHFA 1K88A 3DMFA 3LTNC 1EA7A 4Q3KA 2B1QA 1QQBA 1VQNB 1Z5ZA 2VS1A 3BHMA 1Y5NA 3I76A 1SKAA 1S5PA 3W6PA 3IV7A 1E9SA 3E0QA 3KJFA 5HZBA 4KFRA 3C3YA 3ZVRA 1TA4A 2EERA 3C24A 4FS3A 5IN4A 4KXQA 1FDSA 1KQGA 4UC0A 1PVVA 3TTXA 4GMDA 4HUTA 3P9QA 4GX5A 2GKGA 3DOUA 2JG3A 5E6TA 2EFDB 3AVUA 4OQQA 3I42A 3E84A 3WVNA 4XFJA 5CHEA 4DG5A 4YDHB 3UUFA 4D98A 1E60A 1NW9B 1IEVA 1XJQA 2H57A 3DDOA 3LECA 1W36D 1CUXA 1KY3A 4ZN6A 3HKBB 4Q3BA 2QPOA 1NI3A 3NIDB 2CF4A 2DWPA 1VB5A 3B1ZA 4B5LA 3RNOA 4D8YA 1R66A 2CXRA 1NRIA 5L3SB 3WIEA 2E4WA 3DKVA 4FJ0A 3BCRA 5CB4F 1OT5A 1WOMA 4GW3A 5IBRA 1L1FA 4ZALA 1IEXA 1FDIA 5LZ2A 5IZCC 2WSMA 3N2GA 2JFWA 3IOBA 4HWOA 2HJWA 2G1JA 3EARA 3HUUA 1BDBA 2I9KA 1VQ7B 3EGIA 4V02A 4EBFA 2GFHA 3KZVA 2M1XA 5FWXA 1HDZA 2X0IA 4LWOA 4EL0A 1G7TA 3OTQA 3KOYA 4ALJA 2XCSB 2P0YA 2O8CB 1CQJA 1GTL1 1F8GA 2DFLA 2QMQA 2QVYX 3HUFA 4NNPA 2XWSA 1IK6A 1AK1A 3N70A 4NEHB 1LJ8A 3ZC3A 1K27A 1QBKC 4F4HA 1OF1A 1NXVA 2XVZA 3BKWA 1C7IA 2GPSA 1XT6A 3JQFA 4D3XA 1A2BA 4LBZA 1WB6A 4KTTE 4BBAA 1KAHA 1I3MA 2YW9A 1E18A 2WSLA 5HFNA 4OO3A 3BH0A 5IANA 3V8BA 1IHMA 2IKSA 2X1HA 1P9LA 1A8IA 4CI0B 1I3LA 4YJDA 1ISJA 2Q6VA 4UE3S 3ZCQA 5J3OA 1Q6ZA 4MDEA 1GTVA 5DM4A 3GBSA 3GCDA 4MJXA 1RHQA 2OV4A 3ZKAA 4O2AA 2RGDA 2HLNA 1PKVA 3QBDA 1ID8A 3E4DA 4NJEB 3V1YA 1UJMA 3IKJA 3V8RA 3ZD8A 3AVXA 2AG1A 1T6ZA 4I3HA 1QE3A 2G08A 1CDOA 2X53S 3FKQA 3QYAA 1G6Q1 1E6CA 1XCMA 1L4GA 5KW9A 4L22A 3CNQS 4A92A 4WLNA 3UPTA 3P2MA 3HKDB 5CXUA 2KBEA 3AC0A 3TXXA 3SEAA 2G06A 4C04A 2H18A 2ODBA 1G9XA 4LX0A 2V1UA 3VNUA 1C4OA 3NWJA 4FFVA 4QBFA 4TMWA 3OOWA 2GREA 3CT6A 4R05A 4YMIA 5JCJA 4NZZA 1ZRSA 1P7VA 2R5FA 3H6KA 4FEGA 4YECA 2Q5CA 3BSSA 3MINB 1U81A 4GXQA 3MRSA 1JIXA 3HBNA 2MOKA 3A0RB 3GFRA 2RGAA 4XUGB 3KOXA 3DC2A 1QP0A 3GI1A 5JCOA 1Y6GA 1XGKA 3V4LA 4LZNA 1B3RA 3RS5A 1NQOA 4M0LA 4QBHA 3G0DA 3K09A 1ZJWA 3MMPA 1MJ5A 4IYRA 4PQYA 5C4IA 3ZJTA 1RCFA 3QLEA 2GASA 5CH8A 1K9MD 3DMHA 4ISCA 1G2OA 4BEJA 5IWAB 1QYCA 1EFDN 3B7WA 1ESZA 3G17A 3KJIA 3F1LA 2PKRA 3DP9A 3AHIA 2X6QA 3LOUA 5AKLA 3VPHA 4RX1A 4DHWA 2BKAA 3FKSD 5AVZA 2GTIA 2XD4A 2YVUA 3JYHA 1JYSA 1KO4A 4R5HA 2JJQA 2YIDA 5A9SB 4UASA 3CX6A 4EYOA 1Q3TA 2AOTA 4GZLA 4EF5A 1RKUA 2B9VA 3FRHA 1FU8A 4OOXA 3M3HA 3M4ZA 5E6RA 3ZI0A 4CV0A 1FF9A 1M76A 4GKVA 1XZLA 4P08A 1MBZA 2V0NA 2Z5LA 1JA1A 4IIUA 1C4WA 1QFJA 1R10A 4HEA6 2Q8QA 4RM3A 4G5YA 4IJKA 3L0ZA 1D0SA 2IPNA 1KH1A 1ZESA 3DOOA 3DWGA 3PE3A 5KX5B 3JWJA 5FOUA 2DU8A 5JWHA 4Y98A 3CF2A 5P21A 1RBYA 2CXOA 1JPNA 4BKQA 1SXJC 1C8KA 4M22A 4A0RA 1NP7A 3A1VA 3FUWA 3VFDA 5KTYA 2FR8A 1SG6A 1JPUA 1CUGA 2YOFA 1LX6A 2AXPA 4R1PA 4WJKB 5LBTA 3KPUA 3LI2A 1U0FA 2AD5A 1E61A 3A3YA 2FP3A 5IU6A 2DWCA 3HHEA 1MTOA 1S4QA 1UJCA 3UW3A 2ZR9A 4C4OA 1SA0A 3CH4B 3FX2A 5D00A 5M7EA 4Q4AB 4F38A 4C4YA 1NT4A 2W58A 2OORC 1QLWA 1UC5B 1JJAA 2IHBA 3FROA 4L0MA 4QGBA 2XIJA 1JUDA 2ZJFA 5HFAA 5JZVA 1TRHA 1A9QA 1U0NA 4YRDA 4PZ0A 3UA4A 1NYLA 1ZH8A 4UD2A 1NA5A 1E2MA 2PK3A 1M1ZA 4H08A 5CUQA 1VIDA 2LVBA 4NPAA 3CW8X 1MO4A 5CGQB 1D1TA 5H80A 3OLWA 3VRHA 4BQPA 1YL5A 1NNSA 1EMDA 1IZ0A 2H65A 1DAOA 3ONVA 5FYQA 1IMOA 1ULUA 1M8PA 3QXSA 2IWRA 3SGLA 3WSTA 5HJEA 4CM4B 4CTJA 3RVOA 1G6KA 1P44A 2YCLA 3PC4A 4MWEA 2C31A 3VX4A 4BBPA 4CT4B 3LTEA 3T5BA 3PDUA 4G01B 4JLVA 4P4SB 1QO0D 2FYTA 2AKAB 3FYTA 3LUPA 4N54A 4WZ6A 3TIIA 1WE2A 3ZYZA 4D9GA 5BUCA 5ALVA 3PC8A 3PSAA 1T24A 2IDKA 4IGEA 1V47A 5C1DA 2LBPA 3KAQA 4AROA 3JY6A 1CBUA 1IPHA 1EHCA 1A72A 2IPAB 1NBAA 2X7XA 4KYTA 3RK0A 4BC1A 1TMGE 1I3OA 2DBRA 3LCRA 4FOPA 2LRHA 4RMHA 4ZAZA 1X1CA 3DHVA 5BURA 2I3GA 1CWUA 4XOPA 4LOAA 4U6SA 4Y9RA 1IE3A 4QUAA 3ITEA 4LJ6A 5ALWA 2CFOA 4XX0B 1TMKA 1S0UA 2DLDA 4ZFNA 3NV7A 1QZ3A 3D1VA 3DH0A 3Q3EA 4JCCA 4HDNB 4YLEA 3DW1X 4UHDA 4UTXA 1Z0FA 4ZVQA 3RRYA 3OPMA 1VL0A 2QM8A 3KTAA 2PYDA 4PYQA 4DF3A 3CMMA 1ESCA 4PYIA 4RV4A 1MP0A 4OFWA 2OILA 4OPMA 4ZO8A 1DBQA 1IRIA 2JD0A 2WSIA 1TJ5A 2W7TA 1SOAA 3PXAA 5ALTA 1TC1A 2PHZA 1KC8D 1EPUA 3A1WA 4PRYA 2ATEA 5AHKA 3OQPA 5ALFA 5F23A 4U63A 1C7JA 1GUAA 4IMPA 1JT9A 1PJ2A 4P2GA 1MT3A 3EMKA 5EN4A 5FOSA 5I9LA 1IQRA 1PG0A 1C4KA 3B5JA 3SBXA 4R7GA 1KVQA 3NLLA 4U2CA 3BB1A 5HQ3A 5MFPA 4EGSA 4KAFA 3TBHA 3QFSA 1XTZA 2N75A 3LUBA 3G2LA 4FYIA 2OAP1 3A7EA 2DTEA 1SB9A 3E7XA 1SHJA 1WRBA 2CD9A 3AZQA 3HG7A 4L85A 3ZU5A 2WWTA 4JC5A 5DJ5A 1P3DA 2H1RA 2Q3LA 4PLYA 2YHIB 5ULLA 5IYZB 5JHGB 5ALNA 4MW5A 4IY1A 4RPCA 3ZI4A 2R6JA 4E7PA 1RVV1 1SZDA 4FSDA 4CKEB 4JJFA 5F21A 1VG8A 1VSUA 4JBXA 3KEOA 1HE4A 3C98A 3WMXA 5L3QB 2Q21A 1SXJB 2AL7A 3QUBA 1UJ5A 2O19A 1PO7A 1W85A 3P0FA 1PR1A 4ZCSA 3HK2A 5C5CA 3V97A 2IGTA 2BIFA 3TW0A 2GEDA 4PV7A 3DV2A 3ZE2B 2GYVA 2VF7A 4MW4A 3UM9A 4W1PA 4U7HA 3ND9A 1ST3A 4G1EB 3ORSA 5ALIA 3OTIA 4DDMA 2O54A 4DSTA 4BO0A 1SBYA 3L0IB 2FK7A 5CW1A 2NVWA 1OC2A 4HK4A 4MUYA 1Y8RB 1VTKA 2RGWA 3AHGA 4CVNA 4F9FA 2ZJOA 3QPVA 1XO1A 2HF8A 3KQSA 4C7VA 1XHFA 5LOVB 4ERNA 1TRKA 3ZDRA 4MQUA 4QDTA 1G1MA 2Q49A 3LF1A 1E5QA 2NZ8A 4P4TA 2QPAA 4XIGS 3RW9A 2A1IA 5DIFA 4BB5A 4ZYTA 4LXUA 5C7YA 3RSZA 4BVEA 3U09A 2O48X 1MFPA 4I5EA 4J90A 4KAXA 2PEZA 5F9HA 1VE5A 1L5YA 4XJXA 1RWNA 4MNTA 3ND5A 5FAXA 3NNDA 1RKVA 1TA9A 3CZMA 4ABTA 3ABIA 3KV3O 4WE3A 1EP9A 4LYJA 2XZDA 4CIXA 3FTCA 1EFAA 1MORA 3BICA 1RXEA 1O6CA 4JUBA 1P73A 2FLWA 5E4JA 3T8YA 1PGNA 4GQNA 2RK6A 4M8SA 3V4PB 4RDXA 3ZUPA 2CJFA 3T7CA 3T1TA 7MHTA 1Z8FA 3F6CA 2AUMA 3ENNA 1BWQA 5JJKA 1YRBA 3PUJA 3DJFA 1UDWA 4PLZA 3A1PA 3SKBA 1DI0A 1Z8NA 1Y0RA 2WE8A 3B9QA 2OK8A 3C5EA 3EA4A 4GWGA 4LY6A 3BCUA 1WHTA 1YRQA 1KDZA 2OK7A 1D2MA 3NP7A 1J56A 4J9VA 3RFFA 2BH9A 5HUQA 1GSIA 2J3MA 1IOVA 4ES6A 1LI7A 1SU8A 4OPVA 3CBGA 5EEHA 3ZNNA 1FFWA 5B3AA 1QIGA 4O0MA 3VSCA 3WMEA 4TQ9A 3L4BA 5TQVA 1XZEA 3VPBA 2BFNA 2CLMB 2VF2A 2HX1A 2J6BA 1GADO 1T36A 3KQQA 3KUKA 3BHNA 5JRZA 1NJ5A 3URKA 1GPLA 2HU2A 5LZ9A 1VQ9B 1W4AA 4IW3B 1Y4DE 1ZD5A 2FF5A 5KCZA 3OZBA 1X7WA 3DLCA 2RJOA 1DRJA 2EGUA 4KFSA 4CN9A 4YWJA 2PZLA 1A1VA 5CK5A 1CIJA 3KXPA 4LBYA 4DCTA 1NU6A 2WINI 2VK2A 5CB4A 3ID6C 4FM9A 1E3IA 1UPCA 1EJBA 5ALZA 3O8DA 4GLJA 3JW8A 2Q3MA 1XE1A 4F6LA 5JT1A 2OTJB 4JUFA 2F1LA 3OJ0A 4C6TA 3PWTA 1JDZA 1PL7A 2FFHA 1FPMA 4OXNA 5BV8A 2PS3A 3ZHCA 5K05A 1Q95A 1SUBA 4QDKA 3T7SA 4G0VA 1BCSB 1JDUA 3VSEA 1O94A 5K2MA 1EX6A 2ONKA 4LMAA 2ORVA 4F3CA 1OH8A 1I4LD 6NULA 3FSGA 4WOPA 2Q0SA 4WDRA 1QIEA 1QVZA 3GWGA 3DMRA 1TAHA 4FNOA 4RU1A 3E9NA 1OAOC 3WWYA 4JJ8A 1S89A 1G20E 2VTDA 2P2YA 1JHPA 1PJ3A 1X1RA 5KPJA 3AP2A 3VVCA 4IIXA 4YMLA 2WKWA 2JCGA 3FGNA 1KNQA 3P5SA 5BW4A 1RWOA 4RLFA 1OAOA 1NJ2A 1L8AA 1TXGA 3DBIA 3QBVA 3QWIA 4J43A 4KQFA 2D1YA 4O29A 3GJQA 4QYTA 5FUYA 1SK8A 3PXEA 3ZLUA 3AWDA 4HNUA 2H00A 2H1WA 1NR7A 2PD4A 1YJQA 4DKJA 1ZU4A 3FWNA 1QAOA 1TAQA 1YDHA 4N65A 1HH4A 3GLHE 2EX1A 3K8ZA 2Z83A 3ZHXA 2EX4A 4XLZA 1JSZA 4A6DA 4F0JA 4EAAA 3QLVC 4F93B 1E3MA 2V9PA 5DV9A 3GT3A 1KI3A 2ECOA 1B8VA 4M1TA 3ADBA 2I71A 4OUDB 1CRQA 4YRJA 3DPUA 4XN3A 1W4ZA 1U3VA 2V59A 3EXG2 2D5AA 5F2OA 2CVFA 3TZEA 1ZG3A 3GGDA 3ZH9B 5BWMA 2F9MA 2HUNA 2EU8A 2PANA 2VWGA 1M1KD 3D7KA 3K5PA 1KJNA 3LH5A 4QQ8A 4M9QA 4RKYA 3GK3A 1W5SA 3AVYA 1J2YA 1D8TA 4AL4A 2RGRA 2PBFA 4ETMA 4W5RA 3FUUA 2BELA 1NBOA 4I1UA 2IZ0A 2G25A 2WB4A 3B38A 1QS0B 1UT8A 3KB8A 4Q3NA 4YPOA 1Q7BA 4NG5A 2PS0A 3BRWA 4PE5B 4EY4A 4U7FA 4F4FA 1H2WA 1QTIA 1XZAA 2PZGA 3WI7A 1HT1E 1UXIA 1JDPA 4DKXA 3AK4A 4WAUA 4R8RA 3S27A 3I0MA 1CE8A 2CMDA 4U2EA 1CY4A 3HLKA 2RI0A 1MVOA 4GOKA 3PJFA 4BKMA 1HNXB 1E9RA 4TZ6A 4AC9A 1O6ZA 1IC6A 1Y9EA 3ETGA 3DZDA 2Q62A 3SQWA 1G8KA 4XPIA 1IZ7A 1IY2A 1DJNA 1I4DD 2OBFA 3TKLA 3WK5A 1ODKA 3JASA 3TS1A 1OFTA 4BLPA 1CR6A 2QQGA 3TTWA 5JVDA 4TMKA 2IXFA 2NO1A 3EDQA 1WEHA 5JJIA 5FQOA 4C01A 1GU7A 3OFKA 1DCFA 3OO1A 1P0MA 1ENYA 2OAEA 5TARA 5ICEA 5KU1A 4BNVA 3AG6A 2IS6A 2WKSA 2FE4A 1EUDB 2JHFA 3IELA 3IO5A 1ZC3A 3B52X 3F4LA 2Z3VA 3R7SA 1CE8B 4PHGA 1N3IA 4GS5A 3DDSA 1SOMA 1WCWA 2AR7A 3W2TA 1GIAA 5BSEA 5C1OA 1FLNA 3OQ1A 1YNSA 3I37X 1U65A 2BTQA 4O4HF 5TF0A 4NBWA 3SJAA 4ZCRA 1YB6A 2VCHA 2C3UA 2QGGA 4MAMA 4WZKA 5GIOE 3PFCA 2A9VA 2WC1A 4O4LA 4BZQA 3OQIA 3ZEIA 4L5IA 3QSGA 4QUEA 1SBQA 5HRCA 1Q1AA 1DBSA 4ZJUA 1X7WB 2HO5A 5TQ2B 4QPZA 1YQTA 1V0FA 4ASUA 2A5FA 4ND3A 4AXBA 1ZGHA 3NDRA 2C2XA 1OKKA 4D57A 3WL4A 3A70A 4BNDB 1QVRA 3SZUA 4AXXA 3DONA 3S2ZA 5B1YA 1CNEA 2XRZA 3MIIA 5DOVA 1TD9A 4O2RA 2AIRA 2EVWX 3Q6IA 4ZMRA 2QQEA 1M8GA 1KMHB 5AW5A 4R68A 3UO8B 3QZUA 1EINA 1IPEA 5JZBA 2W8BB 1G3RA 3HL0A 5HF8A 1RI4A 5JH7B 4NS1A 1K5GA 1GO2A 1ZNYA 3ZWXA 1ISFA 3UK2A 1X42A 4FW8A 1Z75A 1IRXA 4KYUA 3UTDA 3TK1A 4CN8A 1X14A 5C0OE 2X9QA 3QVKA 4G8CA 1F3LA 1HE2A 3W90A 3C5VA 4TPKA 1V8BA 4NABA 4RVDA 1K89A 1VRVA 4BNMA 5DXAA 5JAHA 3QX3A 5B4VA 3JRXA 3EWNA 4X95A 1VJTA 4GQBA 2C29D 3Q3JB 1TFRA 4KIWA 4ZI5A 1ZAKA 3VKVA 1Q74A 2EQBA 2NLOA 2OAGA 2ZYRA 1PLLA 5FI5A 2ZRDA 1RABA 1GV1A 1T8PA 3BK2A 4GMHA 5CJ2A 3VMMA 4TSFA 4DR6B 1MQ9A 2Z2YA 1GRRA 1HXHA 1PK8A 3A9UA 4JVLA 1PJ6A 1S8NA 3OZCA 1KZLA 3IR5A 3PSHA 4XCVA 2RGNC 4IH1A 4CYMA 3W5VA 4I1SA 1UD6A 1JX6A 4PWYA 1TM7E 2Y1FA 4ZVPA 1FXUA 3G9ZA 5F3WB 1T5TA 5M5BA 4N03A 4Y2TA 5U4XA 3KSRA 2EW2A 4I4TB 3BL6A 9ATCA 3DW3X 3ZXYA 4Q47A 5BVHA 3GHHA 2OXEA 3L7AA 1DG1G 1P4RA 1MJHA 1Z37A 2GYWA 4OGWA 2VT7A 4N0EA 5CH5A 4YYEA 1EFRA 2C77A 5FWNA 3Q12A 1CQZA 2C0CA 3EE6A 1AM4D 3LQRA 2WUVA 1OPXA 5T4FA 3DM5A 5FO0A 1SBHA 3Q88A 1OTXA 3WK8A 4L95C 4PZPA 4LGCA 1PZNA 3PGXA 4ZXPA 5FR1A 1DC5A 5F2KA 3HRIA 4BVKA 1ENZA 1K9VF 3L7LA 2DECA 1N6LA 2PWAA 2QRJA 1JVSA 2H1LA 1QVWA 2ZBQA 2F3QA 3IDOA 2C7BA 4G23A 1E20A 1W36B 1VBFA 2Z1DA 4A8HA 1LV7A 3THOA 3C1TA 3UQZA 1NMQA 4KXFB 3M6MD 3HVUA 5ALYA 5A3RA 5SZJA 1DFGA 4HAXA 2DHDA 5K20A 4X41A 1Y8ZA 5L40A 2XTJA 5D51S 1ZD2P 1QYDA 1R7RA 1UJBA 2ZSUA 3RFXA 4I99A 1XNRB 1HZZA 3VH3A 5C2JB 5LL6P 3R4VA 4RXTA 1CHDA 1XPOA 1D5CA 4A6XA 1Q15A 3DZKA 1QH1B 1RWWA 3FPCA 4QQFA 3RKRA 1FMJA 4YRNA 4GKKB 2DEUA 5CLLA 3VHQA 5BYJA 3LYAA 2ZUSA 1L6IA 3PX2A 4E5YA 3HYTA 1I7DA 5BSGA 2H4WA 1N2XA 4AFNA 1XCLA 1IH8A 2REQB 4TTJA 5K0EA 3HZZA 3QX7A 2ZYHA 4WBXC 1U7WA 2IDZA 3TQRA 3OJXA 2WHRA 4FNMA 1OBVA 4HNSA 1N57A 2QU8A 4NL4H 1O5OA 1YBVA 1L5SA 1OFUA 1QRDA 1XJ0A 2NT4A 2VBTA 2XA2A 2XKJE 2EGHA 2ZB4A 3CNHA 3ENZA 4U5QA 5DHUA 1K4MA 4E2XA 3B3FA 1OMOA 1ZD4A 2E87A 1C3OA 2II6A 3G6WA 4QT0A 5J9FA 4DT1B 2ZXIA 1K6XA 3QGMA 3VC1A 4Z53A 2BJWA 3KU4A 4ZVRA 4C3UA 1P72A 3QXJA 3QPUA 3IMKA 4FILA 4DNFA 2HWWA 3OPYA 3ET4A 5LQKA 3ZR4B 4Y1EA 4HEQA 2PO5A 3BCSA 4C2UA 2ODNA 3WRWA 1TVKA 3PCTA 3PE6A 3A25A 4RDKA 3ADPA 3BC9A 1W49A 5DBIA 4PX2A 2BL4A 1N2ZA 2E82A 3I4FA 4OEHA 3S2YA 4CDRA 5KQGA 3QWAA 1HT3A 2RARA 2ZEJA 5JAPA 3K1JA 1UZAA 1VMKA 3V33A 3X3HA 2BOVA 3OA2A 4IWXA 1GU1A 1DRVA 1CY2A 4ND6A 2B8WA 2HDHA 2I2FA 2CRVA 2I62A 3D4BA 4MV0A 1KMIY 5DT2A 1ADJA 4BHTA 2G9RA 3EY4A 4LNAA 1T2EA 2F8MA 3GJYA 2IEAA 3NYIA 4G09A 3UHJA 3IJRA 3ZWQA 5JZMA 1KEUA 4GSLA 1CY7A 4KUEA 3D3WA 1I1NA 2H2DA 5LNK1 5LNK6 5LU9A 4BOYA 3MFQA 1NLFA 4MRMA 4KK4A 1V8PA 3V76A 4YMWA 3MSXA 5MN5A 2X8WA 3UJCA 2YWHA 3IR6A 5TC4A 4EW1A 3K72B 2BGRA 3BY1A 2DQZA 4AP9A 3IJPA 4B82A 2C58A 2JLXA 4OMUA 3QFCA 1J09A 3P9KA 4J94A 2OHIA 4B7AA 3D0KA 1I94B 2PFGA 4EMSA 1L0BA 4O4JA 4KPFC 1K2WA 1LQTA 1US8B 4J7AA 4CL3A 1TCAA 3OPYB 2X77A 4G8BA 4Z4TA 4LTDA 3T3GA 5B7NA 5GONF 1M6WA 3MQ4A 3O8BA 1WETA 1KI8A 3WL5A 1TW3A 3T5GA 3RPEA 1YZGA 3K20A 2HT6A 3UHOA 5J4HA 2VYVA 2CNKA 3WLTA 1Z2CA 4FKBA 3H17A 2DC1A 2IPOA 3HM2A 1UEJA 2P6UA 2VDKB 3MTJA 3WBFA 1XPUA 5TMEA 4UXIA 5CK4A 2CVQA 2I3AA 4N12A 4FDLA 1NC3A 1DARA 5KNBA 1EK0A 1OHHD 2DFTA 1E7WA 3LAWA 4PC6A 3PL5A 5AI4A 2FQWA 4QOIA 1QE0A 3M3DA 3TPFA 2NW6A 1Z2EA 3BEOA 3S28A 2C9DA 3WGZA 3J81A 4BE7B 2C7RA 2W11A 1JYEA 1TQ8A 3Q2IA 2XWQA 5IVPA 2CVOA 3SS8A 4D9EA 3DHNA 3IOEA 4LK3A 3I8XA 3WQZA 4XWGA 1P1HA 4CFZA 4LOHA 1A9XB 4GX0A 1FU4A 1R6VA 5AJXA 1SRQA 3ILYA 4TUYF 5DTJA 1HYBA 2WWWA 3CLRD 4QBIA 5FADA 4WRRA 3ZHZA 4ZI2A 4DREA 1TQHA 1ML4A 5JI2E 1TLFA 4RCZA 5FP0A 2CFRA 1R4NB 1SCDA 4MW7A 3FTDA 1AUXA 5BYBA 4E4TA 3DSRA 4KUHA 1N34B 1JHMA 2RB4A 2KB0A 3O94A 4EHNA 4ALLA 5AW8A 3UQYS 4EM6A 4F3YA 4B73A 1YS4A 3C6ZA 1XZPA 5KTSA 2VT6A 4N9QA 1XNQB 1KEKA 4IDOA 3RYCB 1WW3A 2ZRHA 4C4AA 3THWA 1X7ZA 5T8KC 1NQUA 2QX4A 3DR3A 3KALA 5AWFC