5FPSA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 3-aminobenzene-1,2-dicarboxylic acid (at1246) in an alternate binding site.
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
642
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEPATITIS C VIRUS FULL-LENGTH NS3 COMPLEX
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 202
structure length 642
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fpsA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fpsA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fpsA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpsA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpsA03
3NH6A 3P27A 4A92A 2JKHA 1IQGA 3ZZ4A 5C5NA 5E4FA 4DIDA 4CEIB 2AGEX 1CJUC 2CHAC 2A3RA 2ZRKA 1CS4C 2QXIA 4MNVA 1JRSA 3ETLA 2OTVA 1GP2A 4RKJB 2AXNA 3FPAA 3QTOH 4B3DA 5H70A 4PAQA 4II7A 2FOEA 2NO1A 1Z83A 1XX9A 5DN6A 3KKPA 1O3JA 2VU8E 4OHZA 1QR3E 3GJ6A 5EW1H 2C8WB 2QV1A 1CHOF 1KXBA 5CHAB 4INLA 1XTQA 1JR3D 4AB9A 3AAUA 5F9HA 3VKGA 1LS1A 4US2R 1HAHH 1T4GA 4MTBA 3QI2A 2ZPTX 4IEIA 3CX8A 4ZXYH 4PFSA 2H2ZA 1VHLA 4FI3C 5KPDA 3MD0A 4IDOA 1GI7B 4JZDH 5A0BA 4OJKA 2EQBA 1IN8A 3QWCH 3R3GB 2PT7A 1QHHB 4BFZA 4NA9H 3VQTA 4LHVA 3RABA 1TGNA 3BOSA 4N0DA 4CRBA 1UVOA 3TSZA 1YPMH 5F3WB 3BTKE 3HK6B 1NFYA 1MABA 1KI6A 2WV9A 2W58A 3RXMA 3LX8A 4W5JA 3NEYA 2BMGB 1E3MA 2J95A 1ELAA 1JBUH 4HAWA 5IK2D 3QF4B 1TUEA 5FBIA 2C98A 4FUHA 2GMTB 1OH7A 4BPBA 1D2EA 1QL7A 1MQ5A 5EZ6B 3BXZA 3CRMA 3FMPB 1KI3A 5CIQA 5HPYB 1N3BA 3RU4D 4EQ6A 5LPEA 4RCZA 1PPEE 5SZHB 5J4SA 3I29A 3AF3A 3Q8XB 4LHZA 2QBYA 2ZYUX 4PHTA 1XWIA 1QHNA 1PJRA 3PR1A 2PTNA 2GRJA 1HAVA 4V0OA 3AVVA 4KITB 1Z1JA 2O0JA 1A3BH 3FAOA 5JJLA 1GMDG 2VIPA 4UXHA 2HT1A 4ARZB 3TK5A 4YESB 1C1VH 3SE0A 1GG2A 4EJSC 1DXPA 3D3QA 3B5JA 4AYYB 1JXPA 1HAIH 3GCHC 5DE3A 2D2FA 2YYZA 1N5LA 1ZUHA 2IYUA 1CRPA 1E6CA 5JEEA 3I61A 3SQWA 3B23B 1GI4A 1CJTC 1E4VA 2PMDA 1U94A 4RFSB 3BH0A 4ITRC 1MQ6A 3C5HA 4RCYA 1P61B 4MRVA 7KMEH 4EFMA 1Y3WA 2A5IA 4CF7A 3PWBA 2G83A 2QC2A 1QY6A 4ZUHA 2FTMA 4XSGA 1GMDF 2OSBA 3AVPA 1II9A 4QNMA 1OYWA 3GP8A 5TJXA 1O3YA 4ZDIA 1WBGB 2ZHEH 1H8HA 1HLTH 1P2TA 1KLIH 4TYYA 1HYLA 3SR0A 2FP7B 1X8JA 1G41A 2A9KA 1IQJA 1KI8A 1NY5A 3T5GA 2HF8A 3ZVDA 2J3EA 4L16A 3RXFA 4Z1MA 3ZZ3A 3RXJA 5IT5A 4TQUS 3UMSA 1SXJA 1HXEH 1BMFD 3SDZA 1ZNYA 4NE2A 3SQHE 4ABAA 3T29A 5GJBA 2F9LA 4X2VA 5KSPA 3SU1A 5DP3A 3NBXX 2IS2A 5TVKA 1P72A 2PKAA 4TWYA 4D4MA 1O33A 2QRNA 3THYB 1N6LA 2IX3A 3HDTA 2FEQH 1G37A 5IF9A 4DLYA 4LV5B 1W0KA 4ZKEA 3DO6A 1MT0A 1Y5AT 4N1AA 1PQ8A 1LHCH 4E22A 2VWLA 3CENA 3RM2H 2ZAOA 3OIUA 1E2EA 1SGDE 2A5JA 3UG6A 1U2RA 3LH5A 2ZJOA 2WWFA 2CJIA 3IQXA 2Y5HA 3TR5A 1SQAA 1MH0A 3MWJA 2C96A 2IJOB 3HK3B 2BMDA 1OP2A 1AKEA 1DUEA 2P93A 1RFNA 4LX0A 4PAOA 5ANRB 5AUNB 4AZ2B 1XEXA 3ZVMA 1UPTA 1QBVH 3H2YA 2ZI2H 5H1YA 3LJOA 5SGAE 4THNH 1BIFA 2J7PA 1E2PA 2A45B 2G1KA 3M0EA 1DLEA 1WF3A 2ZFRH 2O0HA 1CBWB 1C1RA 1L1NA 1UBCA 1HFDA 1CA0C 3MJRA 2GZ8A 3C8UA 1NVVR 4Q1AA 5I46H 2JJ2D 2CN0H 3OU0A 3UOPA 1AN1E 2RAPA 5FOSA 4GDFA 4H42U 1YZLA 1ESMA 1KDPA 1KSGA 2RMKA 2QMEA 2FX6A 2FSHA 4BLQA 1G3QA 1AQYA 5AUQA 1UVPA 3A88A 5E7JA 4WMEA 2GA8A 2ZTZA 1EFRD 1BBRK 2XNDA 5DPAA 3K70D 1WAYB 3LKWA 1AGPA 1NRJB 2HNTF 2GCPA 4KCGA 3ZVRA 1MTSA 3AVZA 2GK6A 1R8SA 3THOA 2BKUA 3QEOA 2F7SA 3JZ2B 2X77A 3HGPA 1FNNA 4I4LA 4RKOB 1SGWA 3EA5A 3UG7A 4X8SH 1P2KA 4ZROA 5FUWA 2AKAB 2FS8A 4RI0A 3RXDA 1CGIE 1O3FA 1QTFA 4AOQA 4ISLA 4PZLA 3SYKA 4AX9H 1TE0A 1BZXE 4HI0E 1BRUP 3G01A 1F6BA 1U9IA 3T15A 4IVRA 2ZFPH 3DHWC 4L8GA 4A36A 1IHSH 5J47A 3QQ5A 3W5JA 4AG1A 2QQEA 1X7AC 3NWUA 3I1FA 1XU4A 5EE9A 4JVMA 3ZS9A 3RM0H 2ZPSA 4NYJR 4ISHH 3SU8A 3PTNA 2DPXA 3P17H 2G8TA 3PV4A 2F1HA 5TCCA 4FXPA 4TYQA 2E1RA 3RUOA 4TYDA 4URWR 3U4QB 1FONA 3R9XA 3VNVA 3A7ZA 1TF5A 1VCQA 2CHQA 4R8TB 1XTSA 4DSTA 2HNTC 5F98A 3NC0C 3SZNA 1N6OA 1TX7A 3EE0B 3PV2A 1KXAA 2YOLA 4B48A 1HPGA 2NU2E 1GHBG 2Z9JA 2GXQA 1LW7A 1UHBB 5L2YH 5EP2A 1XKAC 4M2LA 4AD8A 3P8GA 1ELGA 2EI6A 1TQDA 4HZUB 3P8FA 3UMRA 1EP6A 2CF8H 4TMVA 3KQDA 4C2UA 4M9ZA 1XCGB 3BF6H 1GBTA 4DY7B 5JBQA 5JECA 2OBLA 3IO3A 2F6RA 3STIA 2OILA 4OK3A 4RD1A 4ABGA 1BYUA 1HXFH 2WMOB 3U7HB 4LZ4B 1C5NH 3BS4A 1ZJ6A 2PKAB 2ZQ5A 3GCOA 3CONA 1ZW6A 5JEDA 3SV9A 4QHSA 4Q7YA 2NTYC 3W5IA 2QAJA 4F4OC 3GLGE 1C9TA 1AKSA 1DICA 2W83A 2J5XA 1OPXA 3MWLA 1NJFA 1HAXB 3M5MA 1UEJA 5CMXH 4NHOA 3S7HB 3TGPA 2ZGJA 1MD8A 4FMCF 1KHTA 3H86A 4AG6A 3T35A 2BXUH 4AN7A 1Q1QA 4BZPA 4P33A 1UMAH 4NKRA 4Q19A 4I8HA 2BCJQ 1G7TA 5EXNA 4I1VA 3ADKA 3THXA 3RXGA 2H9HA 1EESA 3RDPA 1P9SA 3V7TA 5E95A 1GDUA 1FOEB 1C5SA 1F5KU 2BD9A 4ZHMU 3ZH9B 5HE8A 2GXSA 3MU1A 2FOLA 5DYGA 1B0UA 1K6MA 1HJ9A 1NI3A 1XMVA 3KIDU 1KDTA 3IWMA 5FFMA 2ZRAA 1SLVB 4A8JA 2AD1A 2JJ1A 3GLGA 3W34A 3QPUA 4GP7A 3AKYA 4D81A 2ZI6A 3PITA 4E05H 1LTQA 4P0TA 4UNRA 2CDNA 4HYYA 4EJSA 1XVOA 3KTAA 2X2FA 2J1LA 4GBMA 3F0TA 1A7SA 1E9AA 3MU8A 3L0PA 8OHMA 4JL8A 5JWHA 1TMTH 3B78A 2QROA 1GHAF 3UOUA 3QG1A 1GBDA 5AVDA 4U01A 2XNIA 4MVNA 1C5MD 3E5HA 5HKKA 3K9LA 1U9IC 1DXWA 3EWAA 1GCTB 3QX5H 1NSFA 2V1UA 2GAOA 4GPTA 2IYVA 4YONB 2ZAMA 3NEJA 4CIDA 4I31A 2FX3A 1AB9C 4OQMA 3U4QA 3HR8A 1FUKA 5D3MA 3ECCA 2FPMA 5JZVA 4JYUH 3QNUA 4UQOA 2QYIA 3ZZCA 1NRSH 4PC3A 3PB1E 5HKKD 2RDLA 2PHBA 3THWB 4HTCH 1Z63A 5A0CA 4QJ4A 1E1RD 1WP9A 2PGBB 1TA6A 3C27B 3G0HA 4IVPA 4Q4JB 4DT7B 1S83A 1RYHA 1BTZA 4LHWA 3GLHB 2QQ0A 3CF6R 2GKVE 3NUMA 3ZVCA 7ESTE 4M1TA 4NSVA 2AMDA 5DP8A 4OHWA 2VF7A 3QO6A 3OEEA 4J0QA 1EZQA 1TWXB 1CHGA 5L3RA 3FP7E 5DGXA 2B7DH 2VTKA 2ZRHA 2P16A 3CIOA 4HLQB 1LPGB 1DAKA 4LWZA 2EYUA 3DA9B 1H1BA 1Q1EA 3RXSA 5KDLA 1O3LA 3MSXA 3C14C 4HAVA 1DG3A 5JB9S 4NIWA 2XC4A 1KTVA 1NMYA 3TK6A 2F1JA 2GMTC 2OCBA 1GBFA 4MPWA 2JH6D 1Q31A 2ZI3A 1EPTC 2ZYVX 2ZRGA 2OC1A 2OLJA 1C5ZB 2QBYB 1L0ZA 3RANA 3EIEA 4FMDF 2OAP1 3A1VA 1C9PA 1IONA 1IN5A 1VDZA 3O8CA 3L8ZA 3UR6A 4A0FA 3CX6A 5DI3A 2GETA 4GL2A 1G8GA 6GCHG 3QUSA 4KYUA 2SGDE 4BXSA 1GHVH 1HV7A 3VX3A 1GM5A 5B30A 1SGQE 4F4JA 1BBRE 1ONBA 4KV9A 2QMHA 5A5GA 2QSYA 4V0MA 1GKUB 1A4RA 5GJWC 3D31A 1KJYA 2GF0A 2BQ7B 2P94A 4YLQH 4JYVH 1B0EA 4C0HA 2FI5E 2QAGA 1NS3A 4CRGA 1GWNA 5GJ4B 4BXWA 2NO0A 1SVSA 2VGCB 4GHQA 2J0VA 1W36B 1T3SA 2ZS8A 4RY2A 2A5YB 1UF9A 2ANYA 4EUNA 1XMIA 5CYPA 3UFAA 3P4XA 5HTKA 4HLUC 1Y3YA 2VIOA 1ODFA 2Q21A 5CLQA 1UBEA 3KKQA 3O8DA 2QTVB 1DSUA 3SZEA 2MSDB 3VX4A 4Z0KA 1N6IA 2FNAA 4B43A 4XOIA 3RS3A 2ZSAA 1VITF 3N2IA 2DE8A 1QHIA 4RKFA 1UKYA 4KI0A 1Y59T 5H8WA 1A1VA 3M4YA 1P06A 3OF5A 5KPJA 5F9FA 3VPKA 3W95A 1TNIA 3R0FA 5FH9A 1NFUA 1JI0A 4MRNA 1BTPA 3K2UA 1ZINA 4AYWA 4NFEA 5EE0A 1OWKA 2FESH 3TIFA 1EWQA 4ZMAH 4F4IA 1SOZA 2OBQA 1W12U 2FM2A 1V2KT 2BB4A 5J5CA 1JWTA 3KJHA 3KXIA 1PQ7A 3GLFB 2XOKA 2X19A 2Y80A 4NYMR 2OC0A 1HQCA 4IHQA 1LB1B 1N0UA 4F7WA 1A1RA 1ZR0A 3FKSA 1XJQA 4NYIR 5IDKA 2NO7A 3TW8B 1UTJA 1CR4A 1KXEA 4DCUA 2WMNB 4Z6AH 1AZZA 1KIGH 2JIZD 4TL9A 2R6FA 2AFQB 2SGFE 3AVQA 2BLWA 3DZDA 1TQ0B 2HT6A 1JR6A 1NN5A 1TMBH 4CRFA 2GHIA 3WMGA 1O2LA 3B1XA 1JNYA 1K1LA 1LVYA 2V54A 4IGDA 2CL7X 1V3XA 1HYQA 1HIAB 2DE9A 4URZR 1P9UA 1FMLA 5JB8S 4DHEA 3QXJA 3URDA 3NHBA 1GL1A 1D6JA 2HNTE 1XTKA 2ZR0A 1O2WA 2GJ8A 4OK6A 4AY2A 3HP1A 1U8YA 3SJOA 1SI5H 2WSMA 3GLHA 3T1OA 4DDWA 3C1KA 3VR6A 2EC9H 3Q72A 3QKRB 5AF9H 3ZVLA 4LHYA 1VHTA 4EAQA 4B74A 1EGAA 4ISOA 1GRRA 3ATWA 1XUJA 1CVWH 1SGFG 3AP3A 2WINI 1QNJA 2WUBA 2IHBA 3KFVA 4XIGS 5L30H 4PANA 4Q03A 5GIBA 1CTQA 4Y8XA 4LI0A 3ZS8A 1CF4A 3M1IA 2AGIX 4WWYA 1QJ7B 4M1WA 3A8DA 2W2XA 1A0LA 4DJTA 3TJVA 3CWZA 1BCUH 5HCIA 4U5XA 1I4DD 1C5RA 4X8OA 4YOGA 1TX8A 3B8HA 1JPNA 3DKVA 1S0UA 3SHCH 1EFHA 4JYCA 1IOZA 1T6NA 1NP6A 2O8DB 2WJJA 3W6PA 5T6DA 5A8XA 4DIHH 2GEVA 3BB4A 1DPFA 2ZEJA 4FWTA 2G51A 5HXFA 4MITA 3VXFH 2EFHB 1AVGH 3NKVA 3NDPA 1QHGA 3FWYA 4QBIA 1EK0A 2WPMS 1KI6B 1XD8A 2XOKD 3DDCA 1TEVA 5I25A 4FXGH 4RD0A 2RKOA 3TPIZ 3SJAA 1MRSA 2VQSA 3OIYA 3R9IA 2XJ4A 4KODA 2ZECA 3BH7A 2WPKS 1G2LA 1UVTH 5HGGA 1KDQB 2SGEE 3ASYA 4Q1DA 1DPOA 5EW2H 2XNDD 1P2MA 3K6YA 1U6QA 3BK7A 4MKGA 2REXB 1G7SA 1XTRA 2VHTA 1FX0A 5KNCA 1Q12A 4KLZA 3LXXA 1A0HB 2OEPA 5BWMA 2ZFTA 3RVBA 4JLOA 1GJ5H 2ZKSA 2GT8A 1C2LA 2XXAA 1UTLM 1QHSA 1A2KC 4YM9A 2PKSC 2C9OA 4Y10E 2QAGC 3L8YA 1UBGA 4URUR 1WCV1 2H16A 1YCPK 3U8RH 3DZ8A 2V8OA 1DAEA 3TGJE 3RMMH 1SXJC 5BYJA 1D4PB 1J15A 2UUYA 5GWZA 1TF2A 1ETUA 2O8BA 5K8UA 5CM9C 3SEAA 3ZJYA 2YWEA 1JXOA 4OYHA 4NWKA 4EIWA 2B8OH 2B8WA 2FOMB 2HVXA 4RFVA 1TQ7B 3RS0A 4MPVA 4QNRA 1TNLA 2CCGA 3X1DA 2OQ5A 1ZSJA 3DEFA 3K0SA 1Q20A 3VAAA 3EG5A 2FYQA 3PFIA 1UCYH 2V3CC 3A1TA 1RIWB 4YMTA 2VVUA 3FP6E 2W26A 4Z51A 4CVNA 1H8ED 2OBMA 4DLXA 1F0SA 1W0YH 1V6DA 1P11E 1C1SA 1S3SA 1V2OT 1FTSA 3PUYA 1DVAH 1PYTC 1CJMA 1C1WH 4ILEA 1MH1A 1GJDB 2IWRA 2HRVA 4X0WU 2VH5R 2UVQA 5FTMA 4E7NA 3EQ0H 5BQ5A 1M7GA 5EP3A 2ZRNA 2BBOA 3QY0A 5JI2E 4XVRA 3UY9A 3EWSA 2ODBA 1GL6A 1BMFA 3KQNA 1ANEA 3MAAC 4Q01A 3HGNA 3A1UA 1T3HA 3HR7A 5K8IA 3H1TA 2JJ1D 3ZVNA 4TY7A 4D4JA 1OOKB 1WQSA 2LKDA 2I3BA 1J8MF 3PV5A 2BD3A 2VWOA 4ABIA 5C3NA 2B9LA 2OZEA 1PJPA 2Z4RA 2PFEA 4JVNA 3PUVA 1AE5A 2BDGA 3U3OA 1YZNA 2GCTB 2PSYA 2F9NA 3SV7A 1FLEE 1G9XA 2A78A 3VHLB 3TQCA 4KHZA 1ORFA 1XPUA 1B5GH 3U3MA 2IYLD 3WNCA 2ZDLA 1SLXB 1KXDA 4LUCA 3K9GA 1EOLA 2BKEA 4I8KA 3MU4A 4BLTA 1Q57A 2W3KA 2IUUA 5SZIA 2F43B 3SJ9A 4NH0A 4DLUA 1VYTA 2P6RA 4K1EA 1VG8A 3A86A 5BN4A 3ZV9A 4CR9A 4M1KA 2A2QH 3SJCA 4KO8A 4LJ4A 4GP6A 1N0VC 1H65A 1T5IA 1O30A 5C5OA 4A6LA 2IJD1 3B1WA 2C8ZB 5TXGA 2O8DA 4OGXA 1HA3A 1R0ZA 2AIPA 4YQFA 5JRJA 3GYMA 4BFWA 3VFEA 4KVAA 1O5GH 1Y5UT 3OIWA 2CHGA 2PSXA 1LNZA 1AQ7A 2ZGCA 1P73A 1T31A 1QB6A 2BDBA 4OHYA 2ZU0C 3BORA 1UK3A 2Z6VA 3PEWA 3TVJB 1FY8E 5GADl 4DBLC 1CE5A 2M5TA 5J4LA 4WMDA 1MO6A 1NRPH 5DLQC 1HE8B 5ESTE 5KHOC 1BMMH 3SJZA 3MG9A 3RSLA 4H6SB 4M1OA 1K1JA 2P59A 4S35A 1U81A 3ENSB 3TJOA 1GFIA 1GDNA 4LYHA 1TYNA 1ARBA 2H8KA 1FMGA 3SN6A 1U8ZA 1TIOA 2EVWX 4GAWA 4YDHB 1ZOMA 2SFAA 6GCHF 4TLDA 1EJAA 3I77A 4H4FA 1YBWA 2GZDA 1VIYA 3R8FA 4B1TA 1MOZA 1RTKA 1NSTA 4M4SA 1VCOA 5KDDA 1VCWA 1GI9B 3SBKA 1W10U 2P95A 1EB2A 4DB4A 4WZAE 2YINC 4LZ1H 5A2MH 3DMDA 3NPSA 1O2UA 4O9VA 1N25A 4K8BA 5FTJA 5TV2A 2RGNA 1C2KA 4IOLA 1M7BA 5EQQA 4LBYA 4KVGA 1ELVA 2PH1A 3VB4A 1Q3XA 1SGNE 2RGAA 4PHHA 5CDFE 2BQ6B 2GXAA 1K1NA 3QUMP 4Q9JA 1MMJN 1W5TA 2WOOA 2GDJA 2FOFA 4XJXA 4PQRA 1FAKH 1KI2A 5KSOA 3QLPH 1EAUA 1NG9A 1KXCA 3TLOA 2BEJA 3EASA 2QXJA 2FLBH 2DUCA 2P8OC 3S7KB 2NO6A 3RMOH 1DAMA 4FCTA 4OI4A 1ZJKA 2Z3CA 3HU1A 4M7GA 5AJVB 2BLQA 4TLAA 3DPUA 8KME2 1F2SE 1YPJH 1LHDH 1ZYUA 2XTZA 2O52A 1Z06A 2VWNA 4A8JC 2GV7A 2YNBA 5ELXA 5JFGA 1F2UA 2H7VA 1KLJH 3OESA 1OP8A 4GOXA 4MUBA 2GCHG 2Q3FA 3O8BA 3FMFA 3VMFA 1IQLA 1Z6GA 2BY5X 3LGTA 3BFXA 3SV8A 3AW1A 4NIVA 4XTRA 2EI8A 3SORA 4PQYA 1NLZA 4HUQA 1TBZH 4Q7ZA 2R6GA 2J7PD 1XUGA 2ZYTX 4DSNA 3VB3A 4I7YH 3A7VA 3VR3A 1IOEA 4LPKA 2P6UA 4MRSA 4BASA 1VG1A 2EU8A 1UEIA 4BAMB 4LJYA 4PPGA 4UFDH 3GDUA 1TU3A 3CS7A 1Z6JH 5EQSA 3SI7A 1IBRA 3E8LA 4YMUA 2CF9H 4M22A 4JLAA 1TFXA 1T8TA 4A0GA 3KZ1E 2A5DA 1BTXA 2PUQH 4CRWB 1HAZB 2WWHA 1RJXB 2FEMA 3GCHB 4B3BA 3C15C 1OT3A 3EC1A 1O2ZA 5GCHG 4DCDA 2ZA5A 4KSBA 2CK3D 2ZANA 3PLBA 3PV0A 1FQJA 2CVFA 3SJ8A 1W4CA 4KU4A 1FPCH 3RXKA 1MKWH 4Q1BA 3LGVA 1DANH 5J4YA 2BBSA 5GJVC 3A7TA 3ICQB 1CGJE 2ZFSA 2R2WU 3RRYA 1X8LA 1MBMA 1M8PA 2NU3E 3GLFE 1KK2A 3KX2A 1YGCH 1IY0A 3KQUA 2WWYA 3F9HA 4Q4HA 3TSWA 3CNLA 4NZYA 3SBEA 5E2PA 4WZ6A 1G30B 2TRMA 2G0NA 4LJ6A 4UXJA 2MMCA 1U0LA 2P6NA 3KXLA 3C4JA 1E2NA 1XKBC 4YLGA 3VGCC 4BEJA 2HYDA 1CJKC 1MAYA 4QBGB 2H1LA 3Q85A 4GLYA 3TAUA 3JVVA 3UNRA 4TWZA 2BZAA 2QUZA 3LA6A 1G3EA 3IPYA 5F2EA 3V9PA 1WCZA 4IFBA 3IEVA 3A84A 1VECA 3A89A 1MCVA 2F91A 4A2QA 4Q48A 1NIPA 2H18A 3K9NA 3PMHB 1W0JD 4O0MA 3BFKA 4C7OB 1Z07A 3B9QA 5FL7A 3FP8E 7GCHG 1WRBA 1P3CA 2J0UA 2A7CA 1K21H 1QZXA 1TOMH 4X6OA 1A5HA 3P32A 3PXGA 2FO9A 3DUXH 1Y3UA 1T8LA 3T1TA 3H4MA 3GDSA 1TL7C 1D6RA 3SOPA 8LPRA 4O97A 2P2LA 2W0SA 2HPPH 1U0JA 4BRWA 1OPHB 4TTQA 3FFGA 3CF0A 2OLGA 2IS1A 4HDOB 2W6JD 5FR1A 1N6NA 4EPRA 4UNPA 1V2WT 2JDIA 3U1IB 1MTNC 4DJZB 3IDQA 1S85A 2F1RA 4MRRA 5DISB 2OBOA 2ODQA 4AG2A 3N70A 4URXR 2A7HA 2WPHS 4C0BA 1GI2A 4P3YA 4QBFA 2WV4A 2GV6A 2VIDA 3CS0A 3BWDD 3BTME 4NTZA 4IDHA 4Q66C 1P2SA 2PL3A 4MUAA 1GHYH 1V2PT 5TY0A 2GVFA 4MKFA 1O3HA 2WJYA 1KIMA 2BLOA 2XNSA 1W7AA 2FX4A 1W11U 1P6XA 4OJQA 5K0HA 3OZXA 1H9HE 4PQFA 3GJXC 3OAAA 1FL9A 3K70C 3A8BA 2ATXA 1KMHA 5CITA 3EW9A 1I2MA 4NYIQ 5L2ZH 4XSKU 1Y63A 3KF2A 4ABHA 3C16C 1FTNA 1E0KA 1TAGA 4NCYA 5AK0A 4DEYA 1JOUB 2J41A 3EPKA 3A85A 3E70C 1G3DA 2D26C 1K2I1 1YM0A 4Q47A 2FE4A 2ZRMA 4TYWA 5FOTA 1KSFX 1OHHA 2KJQA 4GMXA 3LONA 1GJ6A 1G3IA 1BRCE 2VH6A 3UQOA 3O8RA 2QIQA 3AVUA 1KZGB 4FU9A 1RRFA 4KFRA 4QG7A 4NYJQ 4EJSB 1D3PB 4HAUA 3F9FA 4W5WA 2A5AA 3EPHA 3TH5A 1KTTB 4MGZR 3MUFA 1FY5A 1U90A 1YLCA 1W0KD 2OC8A 3EX7C 4KJZA 1D5CA 4G5QA 3R9WA 3LGYA 4C0KA 2AL7A 1NLYA 1BYIA 3KKNA 3CPJB 3RXRA 4EPVA 1ZHMA 2ILNA 2XBXA 3GFPA 4DEXA 4JBXA 1FFHA 3ONWA 1SKYB 1K8RA 4MKHA 2F9UA 1NBMA 5JHGB 2IEZA 2FGJA 1D3QB 3BTHE 1MO3A 1GMCF 2XGJA 5GNDA 2V6IA 4Q1FA 1P7CA 3CUEF 3QXHA 4A1FA 3GLIE 1WDTA 3U60B 2NPFA 4D8NA 2QSZA 1RD3B 5B58C 1JIRA 1CT0E 5JHHB 4Z8YA 1OXUA 3MO3A 1TPOA 1OSNA 1O2YA 4X1PU 4EFLA 2RGDA 1JQJC 4OQLA 1P4SA 1KI1A 2ZE8A 4C3ZA 4ZPXA 1TU4A 1COWA 1E1RA 3BEIB 4BTIB 4EPYA 4Q4AB 2DHRA 2A30A 3RHFA 2WYJA 1TPPA 1XMJA 4DLZA 1L7VC 4YXWA 1TLDA 3NCLA 2ZCHP 4X2WA 1TGTA 2RHMA 1HJAB 2FFAA 1SLWB 2IN2A 3PM3A 5EP1A 2GCOB 1ETTH 1WXRA 1E2HA 1S0QA 1CU1A 4ZI2A 1MZAA 2QY0B 4DB2A 4DLVA 5DP9A 4ZKSU 4A9AA 2YOHA 1NVWQ 5IHPA 3EXAA 1ZC3A 3PQCA 2ZCLP 4JMPA 2C03A 1E9FA 1ZD1A 4Q18A 1R0YA 1O5DH 4GOKA 3SW2B 4I81A 1RPZA 2B7CA 1U99A 4UE7H 2A2ZA 1IQNA 1DG1G 2GD4B 1PZNA 5JI3E 4CEJA 2ZI9A 1NIJA 3MH5A 4NA7A 2TIOA 2QA5A 1II0A 3MJHA 1X8KA 3E2IA 4EPXA 1UTKA 1E34B 4KKDA 1BMLA 2FA9A 2IYWA 2ZU5A 2CCJA 3SYNA 2X2EA 1GMHG 4C0QC 1INCA 1S0RA 1C1QA 3ZIAD 2G52A 1ESAA 1V2VT 4JIMA 4ZXXH 1G18A 1VCPA 4GT1A 2IL1A 1VYVA 2OUKA 2QZ4A 1O35A 1YRAA 1YR6A 3UWJH 4Q4AA 3LLUA 5AR1A 5FHTA 1TPZA 2B7BA 2IT1A 4M1SA 1PQ5A 4K1SA 2IK8A 4UXIA 2SGQE 3U3KA 3UWKA 3U2QA 3NKKA 1GBJA 4AORA 3KL4A 4BGDA 5F8ZA 2LKCA 1RTFB 3D49H 2VA8A 2ZO3H 1FMJA 3U69H 1YKTA 1C1OA 3U98H 4TL8A 2O8BB 1G3MA 4M0LA 4LJ8A 3BJIC 2CGAA 2G88A 1OHHD 821PA 2F9OA 2NOAA 5SZJA 1SVPA 3B6EA 4QJ5A 2ULLA 3RU4E 3PVSA 3B9FH 3I5YA 3IGFA 1IXSB 2Z3DA 4GFDA 4PAMA 2ODPA 1FZZA 1EPTB 2J59A 3EZ6A 2V0BA 3LV8A 1PPFE 3I92A 4UFEH 1UKVY 3DM9B 2VP4A 1G7CA 4ZDWA 4A1TA 2F9PA 1LCYA 1DY9A 1ESTA 1L1JA 1UJ2A 3VKWA 2RHDA 1B7XB 5EU8A 4LBZA 4ZCIA 2Z9KA 2BYAX 2UUJB 2QE7D 1F92A 3PCRB 4Q00A 1W49A 1T3LA 4L15A 2QORA 1O38A 3K9HA 4DIEA 5A8YA 4NMMA 3U6KA 4DKXA 1P75A 3QEJA 1TGSZ 4HAXA 4DVGA 3W94A 1RFLA 2Z0MA 2D62A 1O2SA 2ZWLH 3U1JB 2Q6TA 3KN2A 4TY6A 1LF5A 2W2TA 1LS6A 1BTHH 2ZE7A 3P26A 1EUFA 2JLRA 5KNDA 3CZPA 2ZIQH 2AFHE 1G7RA 1E2KA 4BLRA 2W6JA 4OKSA 2SGPE 5BRRE 3KJGA 4K69A 4X2XA 3I5XA 4AYTA 1LMWB 1WQVH 1Y3AA 2VIVA 1YPHE 4D76A 3C41J 4Q02A 3SUDA 2QM8A 3LNCA 2ZCKP 4YOJA 4D25A 4BE7B 4DDVA 1KY9A 3TITA 2O8FB 1ZIPA 1N6PA 1ZGVA 4LJ5A 3TUIC 2VBCA 2Q6DA 4CGZA 1GCTC 3HU3A 5CYOA 4FCWA 5LD2C 2HDNB 1TRMA 4JCNA 5EXSA 4K8YA 1YPGH 4KFSA 4E07A 4KTSA 1XCPA 3ZD7A 3GMTA 3THYA 1C1TA 2FPLA 3LGWA 4K3JA 3IPXA 1KOFA 2P8OB 1BO6A 4WXPA 3SBDA 1QHYA 1DOAA 2BY7X 3VKHA 2ZRIA 1PPGE 1FW6A 2XB2A 1W14U 1FAXA 3OYPA 4RZXA 3W6OA 2XTNA 2I1QA 2JGNA 4M1MA 2R3YA 4LRWA 1UCYK 4HB0A 2FPKA 2J2UA 3UK6A 5JWRA 1KSHA 1N6RA 3GPLA 2NZJA 1GHXH 3TR0A 4Q80A 1P05A 4ZKOU 1M7HA 4D0LB 1GJ9B 3F68H 3B82A 4D7FA 1P01A 3PEVA 4TMWA 1ZMLA 2YC4C 5C20A 1VGCC 3K9XB 2ORIA 1GVNB 1XEWY 1F5NA 4DCNA 1R5NA 3L33A 1XDBA 3SJIA 3KUDA 1P2IA 5TCAA 3FMOB 4DT1A 1FIZA 3AGPA 2MSEB 3A7XA 1H8EA 3R8CA 3CRRA 4ASHA 1FN8A 2ZDKA 2JETC 4LSGA 2FDCA 1Q0UA 1O5BB 3NIBA 4PZZA 1BHXF 1ACBE 1O2QA 3SHFA 1H4WA 3GCTF 2QY9A 2EFEB 4OHXA 2R2MB 4CYMA 4G01B 1WA5A 1Z6YA 3GY2A 4BTUB 2F4LA 2FWWA 1CJVC 3W90A 2ZJ2A 9ESTA 1BTYA 4IKEA 1YZTA 1Z0KA 2G77B 1C5LH 5HM2A 5C4MA 1NRNH 1W2KH 2ZGBH 3KNXA 2KAIA 4BFYA 2ZITA 3KXKA 4FUBA 4B44A 3TRFA 2TBSA 2WBLC 1CBUA 1AVXA 1O32A 1KMHB 1LKBA 2AMQA 3DL0A 1O3OA 4FMCB 1Z3IX 3LVQE 2IUTA 3ADCA 3NG1A 1MTVA 1Z8JB 4Q7JB 2EFDB 3PMAB 4OI1A 1WUNH 1RVDA 3K0AB 1G291 2RGGA 5FUYA 3E16B 2CBZA 3BBPA 4ACBA 2J87A 3GEIA 1T5LA 3EZ7A 1E2GA 3ND8A 3F9GA 2PZGA 3GY6A 6Q21A 1KDRA 3TBKA 2ZU4A 3FFBA 1XP8A 3K0EA 3GD7A 5DSZA 2FLRH 2WPIS 1SXJD 1ZIOA 2W3IA 1Z0JA 1EXFA 1CHOG 2G3YA 3OIVA 4PXAA 3BN9A 3LVRE 2UWPA 5BN5A 3LFUA 2QU8A 3FFAA 4NP6A 3QN7A 721PA 4Q1CA 1ZAKA 3PG5A 1QJ6B 4BANB 5T1VA 2RGBA 2FOAA 1ZZZA 1GNPA 1JEEA 1NNEA 2WPLS 2RGXA 3TNTA 4YOIA 1YE8A 4PX9A 4BLOA 1FPHH 2GWHA 1HIAA 1QHHA 4VGCC 2UUFB 5KU1A 1K1IA 3N7OA 1FUJA 2AWNA 2FI4E 4JLJA 5JCZA 1W0JA 3KGPA 3X1ZA 4UKDA 2D1JA 2BM2A 1TA2A 5J4KA 1XF9A 3IEUA 3ZZ7A 2FV8A 1HT1E 1QB9A 3T12A 4NCJA 5DN6D 4OGYA 2J45A 1ZM2A 2OXRA 1RS0A 3DFJA 1OV4A 1O3BA 1ZCAA 2Z6BD 3AASA 3BTFE 2QT0A 2C4FH 3W8NA 2ECKA 4AFZA 2ZHQH 3TKLA 1EX3A 2LCFA 2OC7A 1KGDA 1SGTA 3T26A 1CRQA 3OY5U 1FNIA 5EODA 1YVDA 1AS0A 4UJ5A 1XZPA 1ABIH 4LZZA 1O3GA 1QRWA 4O2RA 3A83A 4J1YA 4OL0A 1IQMA 4MDFA 1DOJA 4P4SA 2ORVA 1NN1A 2Y7XA 2WWIA 1GMCG 4U7DA 1AMHA 1VCMA 4X8TH 1MTUA 5LPNA 5JS7A 4HAZA 221PA 1AIXH 1SVOA 3H5CB 4G0NA 1ZJDA 2ZYWX 1EAIA 2J92A 3A80A 2JASA 1SQTA 2PGQB 4MYUA 3WYAA 1S4QA 1GPZA 5TARA 3OFNA 4HDQB 2JLYA 4BQSA 5JJIA 1EASA 2D3WA 1Q2WA 1V2TT 2AX4A 1O5EH 1GBKA 4B73A 2A4QA 4ABYA 2Z43A 4TT3A 3AB3A 1M74A 3K53A 2IXGA 3ZZ6A 2IS6A 1VR1H 3Q5EA 4XFQA 2BMJA 3B8JA 2BOHB 3E1SA 1GVZA 3PIRA 2IHYA 2CE2X 1KY2A 5E0JA 1W36C 3DFLA 1GHZA 2FOGA 2ZVQX 2FOHA 1AIPA 1C1PA 3FHTA 1ARCA 3V0XA 4IN1A 3NC1C 2VYFA 1US8A 2QAGB 1W5SA 4J2YB 1SR5C 2ZGXH 2J38A 4LBVA 4DLRA 4W9MC 4R0IA 3A7WA 3MFJA 1PQAA 3E3TA 2WJGA 1AS2A 5EE5B 4JLKA 1E38B 2A5FA 4JVSB 2TMKA 3SI3H 2FZZA 3BGWA 1W4RA 4PHFA 1EPTA 1G6HA 3LXRA 5JDUB 2GBLC 2NPIA 3URCA 2JH5D 3LO5A 1HAOH 3P4YA 1GI1A 4IOKA 1E9RA 5GXPA 3BTDE 1GMHF 3DMNA 2IBMA 2P65A 4X1QU 1HT2E 2ZRFA 1GCDA 2BD4A 3H0KA 4JVLA 1JR3E 4B2IA 4WW0A 4I8LA 3RC4A 3T62A 2ZREA 1R5OA 1YPLH 1XUKA 3ATLA 1F0RA 1ZD8A 4IRUB 4RZ3A 1ZBDA 4A5TS 5C2ZA 2BXTH 1TTTA 4QFMA 2QA9E 1K1OA 3EA0A 1COWD 3RWOA 3V4RA 4Y0YE 4I99A 1YZKA 4IXMA 3K70B 2XBYA 4IMQA 3P6ZB 4XH9B 1TRNA 4Y7BA 1P2JA 4UFFH 1AKYA 1ZPZA 1XNJA 1QG2A 1N6XA 1XXDA 3WBJA 1O2TA 4IXNA 3PO1C 2OFXA 5GPIB 4AK9A 5HE9A 3BSQA 5EUMA 1BA8B 1WB9A 3SU0A 3FVFB 1YR7A 4MNWA 3ZYEA 1SQ5A 5D3QA 5FTNA 3RC6A 5CIWA 1ZM9A 5DIFA 2QXHA 5AHGH 1MTNB 4HB2A 1ZUNB 1C5PA 4Y79A 2DFTA 2BY9X 3NXPA 1FQ3A 1THPB 5EPYA 2WSSD 3A4MA 3CKLA 4ZHLU 5DP6A 1BT7A 5DO9A 3TK9A 1AGRA 3MHWU 2WVJA 1AA9A 3SUGA 2D06A 3SZRA 3QXCA 2VHJA 4Q7LA 2YWGA 1OXSC 1LQDB 4F49A 5P21A 1L1GA 2BLVA 5J4QA 3RS7A 1W1WA 4PSKA 1DITH 3DT0H 4CT5A 1E2FA 5EJEA 3RXBA 2BD5A 2ZFFH 3VR4A 3UMFA 1TNGA 2YKGA 5A0AE 4KAXA 3QBVA 4D4LA 5LD2B 2HYIC 1N0WA 3GJ5A 1NF3A 2Z83A 1GSIA 1P12E 1NFXA 1J2JA 4RD6A 1AZ8A 3RS5A 3K09C 2DYKA 1OIWA 2WAXA 1JEDA 2BD7A 3D62A 1NRRH 1KDQA 3LH3A 2P3UB 1S6FA 2W00A 5C1BA 2XCFA 4INHA 3QSYA 1HBTH 2IOTA 1AZSC 2GJKA 3WY9A 3JZAA 2DFKB 5G41A 1Z8IB 2HF9A 2J4IA 4EDHA 3MLEA 1VCNA 1V2RT 2F83A 1XUFA 3TH3H 2ZRBA 1DUAA 2AH4X 2GCNA 5DGJA 1WBDA 2W2VA 3EYDA 3WHLA 1HAPH 4RD4A 2UZIR 3M7UA 2JH0D 2JA1A 2E87A 4QRHA 2RG3A 2R0KA 2A32A 1QF9A 4ASUA 2O8LA 2FF7A 1ZSLA 1ABJH 4B33A 1TX6A 3QGNB 1G17A 2RCEA 1TGCA 2BM1A 2ESTE 1UVSH 3LLMA 4Y76A 3FANA 1GBAA 4NBSA 1NMZA 4AFSA 4Y8YA 4WF8A 2QN6A 3W3AA 2QE7A 2OFWA 3UUZA 1THSH 5GVRA 2HEIA 1GBIA 2BD2A 1IQKA 1C9KA 1EWRA 2ZP0H 4LDJA 4FIDA 4F91B 2JCSA 4DSUA 4ABDA 1C2HA 3TNFA 3LT3A 4JLDA 2OCVB 2Z5FA 3FTQA 1G5PA 3A82A 5IK2A 4ARZA 4AURA 3N5CA 1QHRB 5FI1B 2KSQA 1GJBB 2ANKH 1AN0A 2XZOA 2HCBA 4IOJA 5C46F 1O36A 2D4HA 3VXEH 2B0FA 3WMEA 1FPMA 2AERH 3MMGA 2G00A 4DOQA 4BLSA 1C1YA 2GDDA 5IYTA 2D7CA 4HSEA 1G8PA 3CR8A 1VIAA 1GBEA 5L3SA 5JBBS 1PPCE 1TPSA 1OWHA 2FZ4A 4H1UA 2BQWB 2G4UA 5LB2A 4ZIRA 4DG4A 3RXAA 5CK4A 1EAWA 4AWXA 3C7KA 3KQKA 1ETRH 3AUXA 2ZDAH 4BFXA 3SGQE 1S2MA 2GBLA 1ZMJA 1OW3B 2W6ID 1ZNZA 1N6KA 3A1SA 3F1SB 3U8TH 3T34A 2VF8A 4ON9A 5JJKA 1H8DH 4ABJA 2O0KA 2C9CA 3LBHA 1DWEH 3BRWD 4JT2A 4POAA 1HJ8A 3MH6A 2QM7A 4BEBA 1W4BA 1MZDA 1ZTJA 1YQTA 1YPHC 1BMNH 4OK5A 2NWNA 1OSSA 4PHGA 1DM4B 3MI4A 3P95A 2C90B 1TB6H 2IPHA 1A5IA 4UD9H 3V12A 5CLLA 1LHFH 3LU9B 1V2ST 3H7TA 4C7OA 1EOJA 1WBBA 1FNMA 1V2JT 1IJFA 4YLUA 1WOFA 4M9SA 3K1JA 1RTLA 1MO5A 1JMOH 1ZRBA 5E0GA 3A4NA 2Q3HA 2WWXA 3EA7A 1QB1A 1GG6B 2XC5A 2XRCA 2KB0A 4US0R 4B35A 2BDAA 1O2VA 1RGQA 2O9QA 4I33A 1W2GA 4LYJA 4GCHF 2WWWA 2GK7A 2Z9GA 5LPFA 3FE2A 2HOBA 2H6MA 3GLFA 3H7OA 1C5UA 1BTWA 3ZVAA 2UUKB 4M9FA 4A4DA 4D2IA 2XCNA 2G5NA 3WMFA 3SU2A 1J8AA 4NPHA 2O8EA 5J4HA 3TJNA 1MBQA 2WIBA 3H84A 3BIUH 4LC1A 4JLNA 4Y6DA 2IS4A 4R7ZA 1XJCA 2R44A 3NXSA 4HUTA 4WVPE 5FPTA 3MRSA 2BTCE 2GTBA 4WXRA 1NESE 4GCHG 2WZQA 5HM9A 4GHTA 1KO4A 4MLFB 3BE4A 3Q00A 2XSZD 1KO8A 3AAVA 2IXEA 2PCLA 1NBMD 4LJ7A 3RRMA 2EFCB 4XD7D 4BLPA 3AKCA 3GY5A 3V3MA 4A1XA 1Z2CA 1Z8RA 1F2UB 2DWPA 1P57B 3S1AB 2OD3B 4DXAA 4LK4A 4KFTA 1GJ8B 2V3HH 1OXGA 3TW4A 1P2UA 2FFBA 4JT4A 1OB2A 3S9CA 1JPJA 4EPTA 3ZLJA 1KI4A 4PO9A 4WXVA 2OP9A 1N8OB 1TEXA 1YR9A 4AFUA 2QMUA 4NU0A 1YPKH 1VJAU 3SUFA 4OS1A 2JJ2A 3UPEA 4MYTA 3REFA 5EP4A 3TVTA 1TUIA 1O2JA 1E37B 3V00A 1O34A 1WE2A 3ELAH 1EG7A 4LGMA 2EFGA 4WAUA 2OG2A 1G4UR 1SHYA 6CHAC 3VR5A 4BAKB 1A82A 1FV9A 2QXGA 1DE7H 4PPNA 1XM1A 2GVZC 3SJKA 2GEUA 3D23A 2WOJA 2ALPA 1DELA 3L3TA 3QK1A 3AGQA 1GWAA 1ZM3A 2PZEA 3MGCA 3F6UH 3VB6A 3I73A 2BC9A 2J0SA 2NU4E 1DADA 3T1VA 1QRZA 1ESNA 1ZM7A 3THWA 3X1YA 5FTLA 1YU9A 1OFHA 4F4CA 2ZTSA 2OT3B 4Q7MB 1DWCH 3RXTA 3B85A 1SOTA 3P20A 4OS5A 1LY1A 3U5ZB 2NG1A 1QJ1B 4BECA 2JEOA 3TH4H 4MGKR 2XZLA 3HATH 3LJJA 1M34E 1NPMA 3TUZC 1G64A 3IBYA 4ERNA 3OX7U 2Z4SA 4INKA 3M36A 1A3EH 3K0FA 1CA8B 3GY3A 4Y7AA 2Y81A 3GOVB 1XRJA 4OS7A 2ZRJA 2CNWA 4ZAEA 2IYYA 4MA4A 1OF1A 2VSFA 1GBCA 2FFHA 1IXZA 1VYUA 1VG9B 3I4LA 2NU1E 2JAQA 5FPYA 3NZIA 1O2MA 3LOXA 4U2WA 1PPBH 4NGAH 4WH8A 3SNCA 2KWIA 4FMDB 1HAVB 4MYHA 1D3TB 3CF2A 1S1MA 3QXSA 3ZVFA 1GI8B 2QN5T 3HWSA 3L43A 3MU0A 3X1WA 2O8FA 5AFYH 4B2BA 4ZIRB 5DP4A 3SU5A 2AKYA 4DSOA 4NFFA 3AH8A 4RD2A 3K0CA 2HLCA 4WH6A 2FOBA 4TLEA 4MDSA 1E2JA 5DJ7A 2VB0A 5JBAS 4JJZA 4B3GA 5K8TA 1VJ9U 4CREA 3VB7A 3FZDA 2IYTA 1IQEA 3TJZA 4M21A 2P3FH 5CK5A 1NBME 2XZPA 3K65B 1TMUH 3EGKH 3ZD6A 4TTRA 4A82A 3I62A 2W5EA 1C4Y2 3JZMA 3GISB 1CQQA 3M6AA 1G3CA 1TF7A 3ESTA 5DI9A 1VGCB 1GJCB 4MRPA 2QGNA 4IBLH 3RRNA 3D8BA 2H92A 1NKSA 3T2NA 3AM1A 1KY3A 4B3CA 3IG6B 1R4AA 2ZFQH 3VB5A 3UREA 2XXAB 1FJSA 3ATKA 4AKGA 2FFQA 3SS8A 1BRBE 4PC7A 3NHAA 1E0FD 2WUCA 3QJYA 1C2GA 4M9QA 5CJ2A 1IY2A 2FWRA 4Z54A 3P1JA 3RS2A 2ERXA 4L4UA 1WTGH 4MPXA 1R6BX 4PC6A 2A4GA 4JK6A 3RXOA 2AYWA 2AN9A 4A0HA 5C1YA 1GI3A 3E91A 3UR9A 1KI9A 1UADA 5E3HA 1SHZA 2OCPA 4D0GA 1DY8A 3L2OB 4ASUD 2ZQ1A 1JB1A 1GOTA 4PSAA 2SHKA 2PCJA 3BB1A 4QBHA 1KK1A 4X8HA 2C99A 3KUCA 3WP1B 4B75A 3ZIAA 3BTGE 3I72A 3AVTA 3Q3XA 2HLDD 4NWLA 1WSSH 3M35A 3RXIA 1ZD9A 1D9XA 4XDEA 5EE3A 1RJ9A 3SUEA 2ZDVH 1SB1H 2Q0HA 1NJGA 2CLDX 3LW7A 2L0XA 4LYAA 4AYXA 2AFIE 3CPHA 2H5DA 3CM0A 4FW9A 4SGBE 1IHTH 1UK2A 4CEIA 4KBGA 1E2IA 3ZVGA 1EZXC 5DG6A 1GRNA 1F0UA 1T0JB 2H9TH 2Q9CA 1GHBF 1KDOA 1E96A 3T61A 1HDTH 4LYFA 2BX3A 2GP9B 2BY8X 1B0FA 3H09A 2OK5A 4GZMA 2YWHA 3AVYA 1C1MA 3B13B 3CPEA 4UNSA 5L3QA 3OAAD 2JLSA 2VIIA 2FPZA 4XBDA 4WVFA 1NN6A 5JPMH 3AVWA 4JK5A 1ELOA 1T4UH 4Q9IA 3LY5A 4JYTA 1G8HA 9LPRA 1O5CB 1W7GH 3CLVA 4PO1A 2ZJBA 2RGEA 2XWBI 1RRPA 2MSCB 3PLKA 1YYY1 4OQNA 1NLFA 1QIXB 3OSYA 4RSGA 1CO7E 3GLIA 1CEEA 1GDQA 3GFTA 2STAE 1GIAA 4V0KA 2HJGA 1BS1A 4TSFA 4JLMA 3SI4H 1NMXA 5TMPA 2VHQA 5ESBA 1ZMXA 5IDVA 2BVRH 1YPEH 1BDAA 3RP2A 2GJSA 3ZZ8A 4NYMQ 2FMXA 3G82C 1UCYE 2F1IA 3E1XB 1XBTA 1GITA 1XB2A 4NG9H 2OLKA 3Q76A 4X8VH 3KTAB 2ZF0H 4X1NU 1UKEA 1GNQA 4KFUA 4DCVA 3SU4A 2VO1A 1C5TA 4CZ2A 1EFCA 3SNHA 4AKIA 1VKJA 4MQAA 2RA0A 4NCIA 1W13U 1OWDA 1O3NA 1OWIA 2UWOA 4A6PA 4QHYA 4C0JA 3KJEA 1JAHA 1SGRE 4DW2U 5FPKA 3WHKA 3F8TA 2H1UA 2OO7A 2ZNKH 4XBCA 3JVUA 1T4VH 1NVVQ 4OS4A 1X1SA 1TQ6A 2NGRA 1W46A 3STJA 3D7MA 2JLUA 3IIKA 5EXTA 4B3FX 3LBNA 1AO5A 3AVOA 1FN6A 3SU6A 2GF9A 1NT1A 2CMKA 1XFAA 1KKMA 3GEEA 2RH5A 1KI7A 2H5CA 4GSYA 2G55A 1O2NA 4DCTA 5A8ZA 4UDWH 2I4IA 2GZ7A 1QRXA 3S9AA 1C5QA 4Q1EA 3A81A 3HKJB 4U30A 5C2JB 5AJXA 2B6HA 1D9IA 2DY1A 5LGOA 1J17T 4WJG2 5DO4H 5JWOA 1H9IE 1ZYOA 1L4YA 4PO8A 2ZU2A 4WZBE 2IYRA 2ERYA 1LO6A 5CDFA 3S9BA 5EPNA 4JJKA 1TALA 1UTPA 4TYPA 2ZPQA 4TMZA 3HPRA 3TE6A 2XSZA 1CULC 4OHVA 2V55B 2J0QA 5DP7A 2BDTA 3PUWA 3ODDA 1AY6H 2ZHFH 2G81E 2ZR9A 3E0NB 3PYHA 1ZSKA 2Y8EA 2AD5A 3T5DA 2BHGA 1GBMA 3SJBA 3EA8A 3CR7A 5E8EH 1HB0B 4FVBA 1TAWA 1XZQA 1E1QA 3FHCB 1JIMA 3CH5A 4CHAB 2Q9AA 3CRVA 2LNCA 2GGVB 4MQBA 1EB1H 2PW8H 1GZSA 3W3ZB 1C5OH 2GEDA 1QURH 2PTCE 3T27A 1P60A 3RS4A 1G2MA 4KELA 2RGCA 2IF2A 1BUIA 1WTHD 1EXMA 1KZ7B 5LBIA 1T9HA 1TQ4A 4QHTA 1RJ9B 4EQ6B 4AC9A 3G5UA 4D82A 1N2CE 2PJZA 1ZU5A 2ONJA 3AUYA 2R9PA 2ZI4A 4RJLA 4CRCA 5ABWA 3B1VA 1G21E 2BHRA 1SMFE 1GI0A 4A2WA 3M61U 1NY6A 1HGTH 1GVLA 5FBWB 2JLXA 2SNWA 1UTQA 4GVUA 3T5FH 1VPLA 2V9PA 1GHAG 1Z8FA 3LW8A 3OFND 2I6QA 4URVR 2JATA 4O3MA 2CHAB 4AIIA 1IN6A 5FBVB 3ZZ5A 4XD7A 3A36A 3MNSA 5C18A 3Q3YA 2JJ8A 2XAUA 4D26A 1OLOA 4Y11E 2CK3A 1G8FA 2IWHA 1F7ZA 8ESTE 2OE2A 2QENA 2X8AA 1G3BA 5G40A 3RLFA 1Z28A 2ZSBA 1R2QA 1U98A 3RXEA 3W8RA 1D2MA 1XEXB 4TMKA 2ZI5A 5KTYA 1W8BH 2K1QA 4E7RG 1GL7A 1S96A 4B6FA 2XC0A 1C2IA 2V35A 4C9BA 2A7QA 2VJ1A 4JMYA 5D3MB 4F92B 1HUQA 1P0SH 4JZIA 2PJRA 3MTYA 1IHUA 2FXRA 2D7DA 4MYCA 3VR1A 3TJUA 5DNYB 3TSOA 1RYFA 4LOYH 4Y71A 1TNDA 4QJ3A 1QA7A 1T8OA 3CB4A 1CIPA 2G4TA 1A7JA 2SNVA 1FUUA 3MU5A 1IXRC 1DARA 1NC6A 1GG6C 1BB0B 4PPFA 1VG0B 2ZS9A 3K0FB 1NTPA 2PR3A 1H8IH 2SGAA 2JLVA 1SGYE 4HLUA 4YTAA 2BD8A 1GJ7B 3KDSE 4DWJA 1RRCA 4NCNA 2XBWA 1BOQA 2RGNC 4R2HA 2IYQA 5JMTA 4OS2A 1MD7A 5H68A 1ZU4A 4R9UC 3TGKE 5J4VA 2V7QD 5B2ZA 2OCAA 4PR0A 1OXVA 1P2NA 2ZPRA 3AW0A 2ZE5A 5KO2A 3CWQA 3GYLB 3LQRA 3ITIA 2BWJA 1SG8B 4LXBH 4HB4A 2XXLA 1XX6A 3D6TB 2YVUA 3KL6A 2C78A 1TABE 4AGJA 2A7JA 4ZKDA 2FS9A 3U9AH 1YP9A 4B3XA 3LH1A 1HAYB 3QVUA 4B47A 3LGIA 5F6MA 4D7GA 2GCHF 3M7TA 3UTUH 2VLIA 1AVWA 5FOWA 4XTCS 1DO2A 3PROA 2ZGHA 2BCGY 5FL3A 1VITG 2VGCC 4IW4E 4Y0AA 2PUXB 1HRTH 1CT4E 1G8YA 1HJAC 3RNLA 5DK1A 1V2MT 2CL0X 1ZPBA 4AGKA 4JLVA 1AFQB 1P5ZB 1XXHE 1Y3XA 2WV5A 4OS6A 4O25A 3B9PA 3LC5A 4UNNA 1AD8H 4IEEA 1AS3A 2RB4A 3KQBA 3RXQA 2F3TA 2QI9C 2ZVPX 2FG5A 2PLFA 1Q1ZA 3LC3A 2Q6GA 2BVNA 5KNBA 1RW4A 1C2MA 4NA8A 4IFEA 4B32A 5G3ZA 4QKQA 1NROH 3R7WB 1GAJA 4D80A 2AHOA 2JLQA 1AFEH 2BDCA 7LPRA 1CLUA 1L4DA 2YJTD 1R8QA 4XVUA 5EQTA 5T3HA 3T28A 2CE7A 1KO5A 3SGBE 3UIRA 1DFPA 1GVKB 3B2EA 3RRZA 4JLPA 1AWFH 4TWWA 4XWKA 4B34A 2VP5A 2GVDC 2OAQ1 1QHXA 4Q9HA 1XJ0A 4YMWA 5ETXA 2G6BA 1W47A 4BTTB 1DX5M 3B1ZA 2QPOA 3W9YA 1NFWA 1VCIA 1NO9H 5L3SB 3CP7A 1DDJA 1SXJE 2B8TA 4X1RU 3C5CA 1S81A 4W7SA 1D6WA 2FSGA 5DI3B 2AGGX 3R20A 4CBOA 4C2TA 4LCBA 1KKLA 4JZ1A 3KCGH 2YV5A 2QG6A 4TZ6A 3A1WA 4GPGA 4FUFA 3CRQA 3ODFA 2H5EA 5FL7D 4ISIH 4ZHAA 4DZZA 1XPOA 3ZZTA 5IRCD 1O3CA 3IITA 4NZLA 3IHLA 1HNEE 2ZJ5A 5C1UA 4KYIB 4E5UA 4WMFA 5J40A 1A5GH 3RLWH 3VEQB 2WAYA 1Y8TA 4LPSA 1RKBA 2QP9X 4V03A 4DLSA 4DDUA 1OFUX 5DKMA 3OHMA 2ZSDA 1UKZA 2WTUA 3MNXA 4WXIA 1F60A 7GCHF 4S2EA 1DVRA 4A8JB 1RXPA 3BAFA 4OI0A 1OE0A 3VGCB 4EFNA 3BEFB 1VTKA 5CB8A 3GICB 3QZRA 2PEZA 1GNRA 3HKIB 4A1VA 5AFZH 1XMSA 1YC0A 4JBWA 1SVLA 2ALVA 1ANKA 1MV5A 2KBFA 2VH0A 3MWIU 3RWMB 4K5ZA 1SVIA 1G3RA 1MO4A 3SN8A 4AKHA 1AM4D 2VNTA 3GY7A 1R5BA 2PMKA 2REBA 2AK2A 4D4KA 4MDEA 1C2DA 2GZ9A 3GY4A 2ZSEA 1PFXC 421PA 4X8UH 4BZQA 1II8B 2ZHDA 4HZUA 5DP5A 1O3AA 2P5SA 3BG4C 2QMOA 1OYTH 4JL5A 3FHOA 2ASEA 1SULA 5LB4A 1DAGA 2G5VA 3SNBA 4E06H 2YOGA 2Y6TA 1KK0A 1TMKA 1XUHA 3MNBA 1S3GA 4BAQB 3Q7QA 3TLXA 3DVLA 5FTKA 1Z0FA 1ZTLA 3RU4T 1C1NA 4O3UA 5LH8A 1ZC4A 1A46H 1ZPCA 5FX5A 2FDAA 4OQFA 4LBWA 1W44A 1S6HA 2F43A 1JQLB 3SGAE 4M9XA 1K28D 3W6NA 1QDEA 1OIVA 3A7YA 3D65E 1KO7A 4TTPA 1MKWK 6ESTA 1Z0AA 1ID5H 2A0QB 2AIQA 4D6PA 3CRW1 3RXVA 1UDXA 1OXXK 1UM8A 1R10A 1LQEA 3DD2H 1AHTH 4B2LA 2O8CB 3E0PB 3BERA 3IQWA 5FBQB 1S9HA 2BY6X 1XCMA 4XWAA 1G1MA 1ETSH 2UWLA 2BJWA 3REGA 5KUTA 1KMQA 4Q7XA 4TMXA 1GGDB 2ZEBA 2F55A 1SGFA 4OI2A 2CMYA 2F3CE 3BC1A 1QBNA 1GDDA 1JJVA 2VP0A 5EXMA 1Z8GA 1AJEA 4FUCA 1UK4A 2LPRA 3EIQA 4TSFD 3SHWA 2YNAA 1EX7A 1N5KA 3LQQA 2VVCA 1KNQA 2AWOA 5JS8A 1YJ5A 1D2NA 1P2OA 4NIXA 3U3RA 2D8WA 1RE0A 2C8VA 3RDZA 4C0LA 1KJWA 1WMSA 5B6LA 1MU6B 3ADBA 2JDID 4MPUA 2GDEH 1PLJA 2R6AA 4V0LA 4ACAA 4ZV4A 1ELFA 1EATA 4ZKNU 2EWWA 3GCNA 2YWFA 3U44A 2ANBA 2NIPA 4BWYA 1LHGH 1OS8A 2ZDMA 5L3QB 1Z0IA 4BFSA 4FN5A 5PTPA 5DH9A 4IN2A 5AJZA 1HAGE 4I1SA 1QQ4A 1E2DA 2P3TB 4IVQA 1GJ4H 1OX1A 3WNDA 2QPAA 3SYLA 1NZQH 4Q7KA 1O2RA 4TPYA 1FY1A 3EZ2A 4IS5A 1X1RA 4GOJA 3OY6U 4RFSA 1BITA 5CJPA 4DIIH 3KKMA 4QGGA 4B2AA 1PV4A 4ZKRU 1T8MA 1ZTKA 1E2LA 2ZUDA 1CSOE 3B7GA 2ZDNA 2ASUB 2IW3A 1Z6AA 1QQUA 1YZGA 4RSPA 2MMGA 1SVKA 1E4YA 3GDVA 5DHAA 1V43A 4H1VA 4ZDJA 3QOFA 2O8WA 2HV8A 5FAHA 1QBKC 3QKSA 1FQKA 2PBRA 1BJVA 1HEIA 2CXVA 5KSZA 1TX4B 1TONA 3ZQJA 2PV9B 1GHWH 2HUPA 1LFDB 5FBRB 1DAHA 1FP7A 2V1XA 3K0CC 2BM0A 3GEHA 4O2LA 1S9DA 5AWFC 2GKSA 4UEHH 2HGTH 3VTKA 3AEZA 1F48A 3LPRA 3SNAA 3S1AA 1J99A 4AI6A 4F93B 4YDSA 1KYNA 4A7IB 2CV3A 2DFLA 4OBEA 3S0NA 2YOFA 1C2FA 3WXMA 2GZAA 1LDTT 4U32A 1LPKB 5L8VA 3QF4A 1W0ZU 4HDCA 2BEKA 1GI5A 2WIAA 4WBSA 4QGHA 2IYXA 1FP6A 4BOHA 1ANDA 1SKQA 2CHVA 3QF7A 4HEJA 3WNBA 2Z94A 3VHXA 4FUJA 2ZHWH 5TDHA 6LPRA 2O8EB 4JZEH 1G19A 2GESA 3A6PC 2FU5C 1EQ9A 3FDIA 3KQLA 3LX5A 2W6IA 3U61B 2WJIA 1SQOA 4TLCA 1G5RA 4BFTA 3V4FA 5JBCS 1O87A 1M1YE 2FMJA 4K60A 3NTUA 4K46A 1X3SA 1O2XA 2C77A 1Z08A 4Z8XA 1AUTC 1ZMNA 2VWMA 4JZFH 3OEHA 1KO1A 5AUPB 5FPSA 4TPIZ 4VGCB 4YT6H 2TGAA 4OQXA 2DCUA 4ZDKA 4QT8C 1EFTA 1MU8B 1RIFA 3RXLA 2J34A 2VHUA 4TLBA 2F9BH 1W4AA 2GCOA 2REOA 5CHAC 4V0ME 4NIYA 2PLXA 1OKXA 2PKSB 2ZRLA 1NM6A 2FZLA 4B2PA 1O0DH 3KEEA 1F2TB 2UKDA 1TBQH 1DAIA 2BIFA 3MH7A 2C5LA 2J9RA 2QP3A 1UBFA 4G5GA 3GJ3A 1SPJA 2R3UA 4TQ9A 3RC8A 3MO9A 3KB1A 2HALA 2D2DA 1AQUA 1O2PA 2IA5A 2ODEA 1TOCB 2G9NA 3NBFA 4IOMA 3OTJE 1OYYA 5CE1A 2YNMA 2QP4A 1MKXH 3QKUA 1E79A 3OE7D 1O3PB 2BOVA 4A6XA 1XD2B 1L4ZA 5C4GB 1ANBA 1E9CA 4FUDA 3MMPA 3K8YA 1T0HB 2ZU1A 4YO9A 2P67A 2WPJS 3U8OH 3U7EB 2Y82A 4QM6A 1DAFA 3KFXA 5G53C 1H9LB 4JKYA 3Q3KA 1E2MA 4ISNA 2J0UB 4MH0R 2CJWA 1N5JA 4M8NE 1OFTA 2F9VA 5BYKA 3PTBA 4MG3A 1B23P 4HGCA 2NZ8A 1N5IA 2QPTA 2TPIZ 5GCHF 3NDBB 2QF3A 2ZM5A 1JECA 3EZ9A 1AU8A 1ELEE 3EC2A 1YKSA 4GI7A 5K7RA 5JSZA 2QTFA 3ND9A 3PUZA 1YZQA 3MNCA 3A8AA 4M1YA 4WOPA 4M53A 1PVOA 4CRAA 3WRXC 3Q7PA 5KSYA 4DDTA 1N6HA 3KB2A 2YHSA 2V6JA 4HAYA 1Y5BT 1PLLA 3UATA 1SVMA 2D74A 2XYAA 3GJ0A 1US8B 3CBQA 1YCPH 2BBTA 4Q2KA 5EG4A 3M7QA 4LJ9A 1SHHB 2VINA 1GBBA 3CNOA 3LD9A 1SXJB 3RSOA 1D3DB 1G4AE 4QGAA 4IC5A 1VITH 3WYFA 3TUJC 1YF4A 1AB9B 1PLKA 4B2CA 2OINA 1ZHRA 2H57A 2R62A 3BTEE 4PC1A 3KHVA 3IILA 3ZZ9A 5FX6A 4BUJA 5BXQC 5FR2A 4FINA 2V7QA 5SZKB 2IF0A 3SYJA 3RMNH 2FGKA 3QKTA 4L5BA 3IBGA 2QGZA 2ZI7A 3L82B 3TIUA 2R8RA 1E69A 1FDPA 1ZLRA 2NO9A 1XTJA 1TRYA 3E90B 1AZTA 4Q4LA 1RRKA 1D9ZA 4MNXA 3HJNA 1YR8A 4L9WA 4ESHA 1ZP6A 4GMDA 2QRZA 2NU0E 3TMKA 3I8SA 2QEQA 5DHFA 3M5OA 2R0LA 2R2AA 1HCGA 3MWYW 1IN7A 4XWOA 3SV6A 2DR3A 4UJ3A 2PZFA 4Q9LA 4A15A 1E35B 5FOXA 1S1CA 2WYGA 3DM5A 1SGPE 1P02A 1ELCA 4GZLA 1AFQC 1JAIA 4NCKA 4LV6A 2OXCA 2A31A 2GAAA 2XWAA 1VMAA 3QGJA 1O3KA 3SQEE 2G0TA 2R9VA 4D9RA 2ZUCA 3Q77A 2BDIA 1EZSC 1T8UA 1OYQA 1RIWC 2XBVA 2PX0A 2R6CA 2V6NA 4URYR 1HY3A 1HURA 2ZRPA 1CGHA 5EZ5A 1FZQA 4XSHA 1MUEB 3M5NA 1AI8H 5A0FA 1QG4A 4Y0VA 1P9RA 1K5GA 1KAOA 4C0SA 4X8MA 1T32A 2Y7ZA 3HPTB 3TK1A 3AF2A 2FSFA 4FVDA 2VP9A 5JRZA 1XXHA 2ZXUA 4KXFB 1BTUA 1ELBA 1G6OA 3EPLA 3J81k 3OEHD 1MKXK 4KP0A 1O3IA 521PA 1GBLA 4KSCA 3X2SA 3LDAA 2WKRA 1SGEE 1AUJA 2H9EH 1JALA 3RXCA 3L6PA 3FB4A 3ZQ6A 3L0SA 4P4TA 3Q3JB 2B5TB 1XTIA 4R98A 4G5SA 3PLPA 2PX3A 2J9NA 4O03A 4W5HA 3EIHA 1J9CH 1WXQA 2C9YA 2PWXA 1WU1A 1UTOA 1E2QA 5HR5A 3WYGA 2C93B 3SU3A 2DWQA 1C4U2 1H8HD 4TYNA 3AP2A 3DKPA 4TQAA 4AKEA 3PUXA 1Q21A 1QVRA 1ZHPA 2XB4A 3AKDA 1E9BA 2IC5A 1TQ2A 1O2KA 2ZIAA 3U7FB 3DHKH 4YXWD 3TGIE 1LKAA 5FBLB 4R2IA 2C2HA 2XX3A 2FSIA 2JIZA 1XPRA 3SOSA 2ANCA 4P4UA 4NONA 2BV3A 1GGDC 1QFKH 2P3SA 3QXXA 1OKKD 2C3SA 3UNSA 1HTWA 1YRBA 1XXFA 3UWIA 3TVDA 2C04A 5M04A 3IIJA 2A4OA 1P2VA 3BH6A 2AEIH 4FD2A 1KYIA 4K1TA 3A8TA 4ESVA 1DS2E 1EAXA 4HLDA 2HLDA 3GLGB 4IDNA 2OQUA 1UO6A 4TMTA 4OM9A 1CR2A 1CR0A 1LVBA 4H9GA 1R7RA 3BEUA 2FYRA 4RZ2A 3TQFA 5H4IB 3CH4B 2GTPA 1XEFA 1E0AA 5DYIA 4L9SA 1K1PA 4YMSA 1UTNA 4N3NA 3ZZBA 4X1SU 1DSTA 1SZPA 3VU9B 4R71A 1IM2A 4UNQA 4IW3B 4X6MA 1DEKA 1D8TA 2W0MA 1V2UT 4I1OA 1BH2A 3PWCA 2WJVA 2J46A 1SL3A 3U44B 2QCYA 1MCTA 1XD9A 4DGJA 2BVXH 3IHWA 4H6TA 1IQIA 4LHXA 1MRNA 1C4OA 2DBYA 4PSVA 4RD3A 2HCJB 1AKSB 1DBSA 1QL8A 1K22H 1SSXA 2ZJYA 1M9UA 4PTLA 5HZHA 3ADDA 3RLYH 1J70A 2D2EA 4GRAA 3UANA 1G3UA 3VR2A 4PPQA 1PPZA 1Z6EA 3ZZUA 4JSTA 2WKPA 2Y5FA 3HPQA 1XUIA 1DLKB 1RC8A 4BNRA 1Y3VA 2Z9LA 1L2TA 2ORWA 4BAOB 4CEHB 5EXLA 1O2GH 5FUVA 4XBBA 3IIMA 4SGAE 4CBNA 5FI0B 1EP5A 4BAHB 1T91A 5AJWA 2FH5B 3EPJA 2XEXA 5TB5A 1TGBA 4JZKA 5L6NH 3PMBB 2FIRH 3PENA 1FXYA 4I8JA 5C1XA 1GKIA 3ATMA 1QBOA 4U02A 2ZRDA 1BOFA 1QL9A 3CZQA 3I32A 1E79D 3OE7A 4YT7H 1W3CA 4NCHA 5E7MA 3BD9A 1NL3A 5FUXA 4TL6A 1LPZB 1A61H 4G5RA 2XTMA 2ZSFA 4K8OA 1SFIA 1Z2AA 2O8CA 1V2QT 3A87A 4I32A 2WSSA 1Z6XA 2RA3A 3V13A 2R6DA 2EI7A 1LHEH 2DWOA 1E9DA 1MTWA 3K6ZA 2FJUA 2FTLE 1A5TA 3IUYA 2VSOA 3BIVH 3L0IB 4PC2A 3ZZ0A 4TT3D 4LC0A 3RAPR 1DWBH 1KK3A 1M2OB 3Q9LA 3FKSD 2ZE6A 2F9MA 2QT1A 3F9EA 1ZUIA 3R7WA 4ESTE 2GT7A 4JLBA 4A0RA 3BFVA 2CLSA 2ANWA 1S5SA 1NU7B 5F03A 1UFQA 2Z7FE 4GUXA 3CNNA 3EZFA 1KAGA 2VIWA 3T06B 4F38A 4D9QA 4UFGH 4V02A 3ZGXA 1TBRH 4TN1A 2BBWA 1E1QD 4QXAA 3K0AA 2X1VA 1QA0A 3NH9A 1G16A 3ZDQA 1BRAA 1TNJA 4CR5A 5AUOB 3QPWA 1EKBB 1NVXQ 3HYTA 3WRYC 1GILA 1O3EA 1GUAA 2P5TB 5UKDA 4PROA 1LVGA 1ELDE 4B6EA 4Q9KA 1M6NA 2CCKA 4TL7A 1LF0A 1I4TD 1ZRHA 1FIWA 5K8LA 1GJAB 3M5LA 4CH2B 1ZRKA 3BV9B 4JS0A 5EUQB 2A1DB 4AG5A 1Z71A 1C5VA 1FI8A 3A37A 4MGIR 4QL3A 2DB3A 1OH8A 1UJ1A 1DS6A 3I78A 1GL0E 2E9SA 2BVSH 3A4LA 4DLTA 2EA3A 5C67A 2STBE 1U8AA 2JETB 1P3JA 1GI6A 2ZTXA 1XVMA 4IC6A 3BTQE 3P8OA 3KQHA 4D0NA 1MR3F 1O5FH 3CO5A 5HYOA 4ABFA 3P92A 4G3XA 2ZJAA 3E6PH 2YC2C 5FBEA 4HB3A 3QTVH 4JBYA 2IUSA 4C0AC 2BDYA 4YZUA 1X86B 3IO5A 5JLJA 3P70B 4DCSA 1KSJA 3QZQA 4P32A 1Z7KA 3GCGA 5HCNA 3EAJA 4FWIB 4QOSA 1NY22 2O5VA 2QL6A 1S82A 4Y0ZE 1I2DA 2O8UA 2CXXA 4XE4A 3ZVBA 2ZROA 2AMPA 3DOEA 3QKRA 1F3OA 1F5RA 1WV7H 3ZV8A 3IKJA 3LBIA 4JSYA 3T25A 1GTVA 1KSNA 4MNYA 4ZO4A 2HXSA 1SHKA 4QM7A 2WWGA 3LIWA 1P09A 1C5YB 2VEDA 1UDWA 5KOYA 1IAUA 1MKYA 1RZ3A 2AR7A 3GJ4A 1O37A 3BG8A 1UVUH 5E0HA 2Z3EA 4YMVA 5GDSH 5E2OA 1E94E 1GKYA 3LDXH 4UONA 2BOKA 5T6GA 1QGFA 3FYHA 2OM2A 3KQEA 2HPQH 3ZVEA 3TU7H 3P8NA 2O8TA 2GXUA 5JBTA 621PA 3HYRA 3BTWE 3ZYCA 2KAIB 2GJ9A 4E03A 3RC5A 2B92A 1P2QA 1CKEA 1U0HC 3DOFA 1GL9B 121PA 2Q6FA 4HLCA 2THFB 3ASZA 8GCHG 2XITA 1W7XH 1EX6A 2JLWA 2LWIA 5G4BA 3KJIA 4P4SB 1J7KA 1E98A 3NVAA 1ZCBA 3QDZB 1KJZA 5G3YA 3SFVA 3CX7A 4I1UA 1T7CA 1C2EA 4G1UC 1L4UA 4KBFA 2ZJ8A 1AE8H 2O8MA 2G1JA 2JLZA 2QAAA 2WPDA 4DC9A 1W36D 2ODWA 1JRTA 4EPWA 2Y5GA 3MCAA 1HH4A 4JYBA 1P9NA 1WYKA 4FMBB 3QPVA 3RXPA 1VZQH 3SQXA 2R65A 3SHAH 2OXSA 3KKOA 4HATA 1PUJA 1BIOA 3U7GA 3FKQA 1E99A 3PEUA 1ZGIA 4LJAA 5GVSA 1P3EA 2P0EA 1ZNXA 4RVCA 2KBEA 3LGUA 2N42A 3GCTG 5L3VA 4X2YA 2WPDD 2QNRA 2VVVA 2ZU6A 5B6OA 3U6BA 2CNWD 2QGRA 2IXFA 1NN3A 1NVUQ 2V4ZA 1EJMA 4ABBA 3QBTA 2AS9A 3MO6A 4GNKA 1F0TA 2N46A 3UIEA 1CBWC 1YHNA 1AK2A 1G9IE 3PEYA 5BPEA 1DTSA 3SFZA 2FEOA 4GSOA 1MABB 1OFIA 1P62B 3ZZAA 3TAHA 2QTHA 2A5KA 1ZM4A 2VP6A 4HFPB 1O31A 6CHAB 2VPPA 2WJHA 1OP0A 2A2XH 1PYTD 4HZIA 1AGJA 3NBYC 3QIAA 3TH2H 1BBRH 2ODYB 1X6VA 1JJ7A 5E7IA 2FI3E 3ZZDA 5BW8A 1BKDR 3T1QA 1E32A 5EGMA 3GJ8A 2ZU3A 1A0JA 1K5DA 2VHCA 3VFDA 2ODNA 1O39A 2GCTC 2ZC9H 3MYWA 3THXB 3CW2A 3LAWA 2W7UA 2FOCA 4NSYA 3OTPA 4FU7A 4CHAC 2GILA 1ANCA 3SNDA 4I8GA 4NZQA 5JYIA 2PT5A 2ZUBA 1ELTA 2AXPA 3N2EA 5JCPA 2QF0A 4RKEA 3RXHA 2CLCX 3PMJA 4AFQA 5EXPA 5T6FA 1P03A 2VP2A 3AF4A 3AK5A 4BRUA 5GJCA 5LDDC 2WM9B 1G20E 3SC3A 1Q3HA 3EA9A 2IYZA 5HMAA 1XMNB 2IEYA 4RZUA 3UPUA 4KGAA 2F3RA 1YLDA 1SBWA 1SGIB 1Z47A 1UAAA 3M3SA 5EOKA 4XVQA 3PJRA 4V0NA 2NMVA 4AYVB 2GNOA 1CP2A 1DWDH 3MOCA 4BFUA 2HJVA 4LY6A 2A4RA 1R0XA 4FUIA 4WA7A 5HZKA 4EKDA 2OHFA 4ZCMA 2C95A 1JXMA 3NBZC 2GZHA 1EZUC 4DT1B 1CA0B 4CDGA 3HU2A 4CRDA 4IDQA 2VRWA 2TGTA 4MKIA 1OXTA 5KYKA 2EWVA 1LVOA 4YC7A 2CJWB 1NKTA 1BJUA 1DO0A 3B60A 4CH8B 4LOAA 1Z1IA 4FUEA 1SLUB 1V2LT 3QENA 1E0SA 2OCYC 1OWEA 4JL6A 2BMEA 1THRH 4MGYR 2Q3MA 3M3VA 2OESA 2H17A 4FU8A 1HE1C 4B71A 1C5WB 1L2EA 1XD2A 3QKSB 1Q22A 3LRPA 3B1YA 3BG4B 3VU9A 1G32B 1II8A 1QRAA 2J94A 1YZUA 3QE0A 3RXUA 2WICA 3AKEA 1J8YF 2ZQ2A 2BX4A 3L0OA 1CXZA 1NU9A 4DURA 4KLNA 1HUTH 1ESBA 3A58B 2WKQA 1IN4A 2V3OH 4LK2A 2K5UA 2ZETA 4QGFA 2KI5A 5FOVA 1C1UH 5FOUA 2KE5A 2ZS7A 2OUAA 1Z6TA 1ZNWA 4JKIA 1BHXB 5BN3A 2ZRCA 4Z1MD 1LVMA 3AQ4A 1E0JA 1TADA 2OBNA 5A4JA 4Y8ZA 3AF0A 1TNHA 1SGCA 2GJAA 1PUIA 2A5GA 1OH5A 4X8LA 1G5TA 2HWLB 5EXXA 5EQRA 3AF1A 2UZ3A 1JBKA 1BMAA 1I4LD 5FXLA 4CEJB 2VSXA 3EDXB 3UKDA 1J16A 5F8XA 1V5WA 3RC3A 5CB6A 2ZG0H 3GQBA 2ZTYA 3BB3A 3FMIA 1A2CH 3FOZA 1S8FA 4Q4JA 4A2PA 1F2TA 2YZ2A 1K9OE 1OIXA 1G36A 2B21A 3EARA 1LV7A 3KQCA 4DUGD 3WBKA 2HXYA 5A09A 1N6YA 1MAXA 1IAQA 2FODA 1KLTA 3UXMA 1HV8A 1GBHA 4C30A 5FCRA 3BIFA 4NDZA 3WP0A 1L8QA 3GLHE 4DLWA 3EAQA 3Q5DA 1JR3A 3AP1A 2EW1A 4XOJA 3MH4A 1R0WA 2XTTB 4DRZA 4WY3A 4ZH8A 1T8NA 4CEHA 1A4WH 2VIQA 2FN4A 3U3JA 1EFUA 3UQVA 2TGPZ 1W48A 1Z0DA 5B57C 4G5OA 1XXHB 1J14A 1C5XB 1J90A 5KDOA 1QCPA 1P8VC 4C4PA 4QC2A 2ZZUH 4KTUA 2NQ2C 2PEYA 1KTSB 2TGDA 4NL4H 1E36B 1F5LA 1NN0A 3OEED 5FPHA 4K81B 3I3SR 1Z5ZA 1IQPA 5B64A 3O47A 2GX4A 1SVWA 3X1XA 4IJMA 4US1R 1ZVQA 1P10A 1GRQA 5LPRA 1FY4A 2ANMH 1HQYE 3GFOA 3I8XA 5EE1A 1OJLA 3F3YA 4AB8A 4IMZA 2BZ6H 1CR1A 4FCVA 1A2BA 4P31A 4E09A 4WIAA 3S69A 1SC8U 2DFNA 4U00A 2Q9BA 1XEWX 3QVVA 3GY8A 1NG1A 1W2HA 2PLRA 3NWJA 4N0EA 4CT4B 3MWKA 1O3DA 3NK8A 1YCPM 4DUGA 1BQYA 1S84A 3AVXA 3BTTE 1Z22A 2BJVA 2ONKA 3UNQA 3RYTC 5AJYA 4DVAU 1IJEA 2ZJZA 1E9SA 4LV8B 4Q4HB 4PZYA 3K09A 1FX0B 4BZXA 4B76A 4K2YA 2I1VB 3ZYDA 3JZ1B 2WHXA 2J7KA 2C8XB 2CL6X 1KXFA 3SO3A 2IYSA 2VL7A 4CW7A 2N1BA 2AK3A 3VNUA 5CM8B 1E9EA 4ABEA 2W7SA 3GJ7A 3LWNA 1C2JA 1IQFA 2EYQA 4RN6A 1K1MA 2XJ9A 4BFVA 1V2NT 4HI3A 3FGNA 4IDPA 1N1LA 1SFQB 2XW9A 2CEAA 3MFYA 3FVQA 1N8OC 1Q44A 1DE0A 4X6NA 1O2IA 1SKYE 1DT2A 4Q21A 1AWHB 2RCNA 4ZCLA 1OWJA 4FUGA 2BMFA 3PO1B 2CVHA 1OH6A 3F5FA 1NRQH 1O2OA 1EFRA 2EEKA 3M37A 1LTOA 1UHBA 1RRGA 1P9WA 3ICEA 5F8TA 2OFOA 1OKKA 1IY1A 2Z9IA 3ATIA 3RMLH 1Q3TA 1OB5A 3FZZA 1TPAE 3SNEA 3WY8A 3GLIB 5JSZB 4HZHA 1FY3A 3TNSA 4HUQB 2ZR7A 1PPHE 3AV0B 1O3MA 1WQ1R 1EJNA 1KNXA 8GCHF 1QVAA 1IQHA 1UTMA 2BDHA 2OV2A 2Q1JA 2ATVA 2C8YB 4Q5IA 4O3TA 5FCKA 1TNKA 4ZI3A 3A8CA 4KTCA 4TZ0A 3UWOA 3QG5A 1CT2E 1O2HA 1Q1BA 1C4V2 1P04A 2I6SA 3SV2H 1Z29A 1O5AB 3M3TA 4X6PA
chains in the Genus database with same CATH superfamily
3PQDA 3UO8B 4IFTA 5DTMA 5TJ9A 2JAPA 1BXKA 1X7WB 1ZGZA 3NH6A 3P27A 1OLSB 1PW7A 4GSLA 1LK7A 5YASA 3LFHA 2CGEA 2HSGA 3EOZA 1QYRA 4A92A 1SQRA 4GXQA 5FLYA 2JKHA 3RFVA 1IQGA 3PL1A 3ZZ4A 4FE7A 3SZ3A 1IUOA 3BTVA 5JXJA 2FAXA 4RM3A 3RG2A 5E6SB 1H3EA 3OBBA 5C5NA 4V3CA 2O3UA 3NDJA 5E4FA 4OH7A 4RQUA 3PVZA 4DIDA 4CEIB 4C4OA 2Y1KA 1V26A 4ECAA 1P17A 4EG4A 5JH7F 2J5QA 2AGEX 3OWOA 5CA1B 1KZHA 3KTDA 1SA0B 3TR6A 4Q6WA 3QTLA 1CJUC 2Q5JA 3PC3A 1SJ9A 2CHAC 3OIFA 3HCRA 2FOXA 2IXBA 3I6BA 2VA9A 1DG9A 1DIRA 2A3RA 3G7NA 5KTOA 2XDWA 2ZRKA 1AHPA 1CS4C 1T15A 2QXIA 3TKAA 3Q87B 4MNVA 1JRSA 3GXBA 4FYVA 3ETLA 4ZZ3A 2OTVA 4DDKA 4MPPA 3USCS 2BDEA 2OOSA 1Y37A 3I0ZA 4EHKA 1GP2A 4RKJB 4Y9TA 3I1JA 1UFOA 2AXNA 3D8NA 3FPAA 4BXOA 2XUOA 3QTOH 3HC7A 4KLRA 3G8CA 3LI2A 4B3DA 3KAQA 4HNTA 2I9KA 3BK1A 4MLPA 2BKVA 3SG0A 1G60A 1Y9EA 1DEAA 2NV2B 5H70A 1IXYA 3P8ZA 4PAQA 4II7A 4ANFA 2FOEA 2NO1A 3UK2A 3IUBA 5CTJA 1Z83A 1XX9A 4G41A 2BFPA 3ISJA 2P30A 3ESZA 1O3JA 3KKPA 5DN6A 4AULA 2VU8E 1UK9A 4OHZA 3EGIA 1QR3E 5B55A 1VP9A 3VYTB 1C0PA 1VE1A 2BSAA 3LGAA 3GJ6A 2KM0A 3KZCA 5EW1H 4IRMA 2C8WB 2Q3CA 2QV1A 1CHOF 1P81A 4YECA 1ABBA 2HDHA 1BGXT 2AJCA 4H7FA 4KR2A 1KXBA 2KW5A 2O2ZA 5CHAB 3NWEA 4KX5A 4INLA 4MS4B 3TIGA 2OFFA 3A32A 4IHAA 2BE7A 2QTBA 4RVFA 1XTQA 3G3EA 3DMTA 2VDLB 2Q1TA 2CUTA 1TMOA 2WJPA 1JR3D 4O4HA 3AR3A 4AB9A 2GPTA 4P93A 1DKUA 1DX6A 3AAUA 4J1SA 4J2HA 1KFEB 4UBLA 1CERA 4XM2A 2VQ3A 1LS1A 1BDMA 4Q3NA 3TW8A 4E3WA 1HAHH 2QB5A 4US2R 4FNGA 1PZHA 1PIWA 1T4GA 1EVZA 3TGLA 2ZIXB 1ISIA 1NDHA 5KJ6A 1L8AA 1GY8A 1P0IA 4FU0A 2VZ9A 4MTBA 1RYNA 1IQUA 2GUWA 3MLAA 1EFPA 2ZPTX 1QH0A 3QI2A 4L08A 5ALDA 4IEIA 3CX8A 3ILXA 4XA8A 2B36A 3FPSA 4ZXYH 1JHVA 4PFSA 2WEKA 3P9PA 2IRWA 5A3QA 1R12A 1NUQA 2H2ZA 1VHLA 1RXYA 2XQJA 3MD0A 4FI3C 4FHEA 2ENWA 1UMCB 1GI7B 4JZDH 5A0BA 3IP7A 3NOXA 3O4FA 2EQBA 4G24A 4G9BA 4OJKA 1IN8A 3U5TA 3QWCH 5MN5A 3R3GB 2PT7A 1QHHB 1Z4PX 4BFZA 3EZNA 5IP5A 1TQHA 1U2SA 5EJ4A 3CXRA 4NA9H 3VQTA 3AEKB 2D13A 4BMCA 3ZDCA 4P7GA 4OHPA 4Y6QA 2HV9A 3X1KA 4KMMA 3ZPXA 1SCBA 4BS9A 4LHVA 3RABA 1E6WA 1TGNA 3BOSA 3HHPA 4N0DA 4U2BA 3GZTB 4CRBA 3DEJA 1MU0A 5EFZA 1MQ9A 2PNFA 2YFQA 1UVOA 3TSZA 1YPMH 4AN1A 5FH9A 5F3WB 4YV0A 3BTKE 3IUNA 3HK6B 3B70A 1Z3CA 1NFYA 1UZUA 1MABA 3U7JA