5FPYA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 5-bromo-1-methyl-1h-indole-2-carboxylic acid (at21457) in an alternate binding site.
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SERINE PROTEASE NS3
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 202
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fpyA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fpyA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fpyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpyA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpyA03
4PPNA 4X8SH 2BV3A 1Y63A 3OX7U 1Z0KA 4BXWA 4OQXA 3SBKA 3ZS8A 3CF0A 1PUIA 5E7IA 4ARZB 3I61A 4YM9A 2QORA 1B0UA 4KKDA 2ZNKH 3HYRA 1GGDC 3DT0H 4WA7A 3RRYA 2IS1A 4GUXA 4UFDH 4GZMA 1JECA 4JBXA 3NVAA 1GBCA 5DPAA 5FI0B 1TQ6A 4F92B 1OP2A 4NGAH 1GL9B 2H92A 1O3JA 4MITA 3Q76A 3P26A 4XD7A 2IWRA 4OS7A 1MTSA 3OAAD 2VWOA 1E79A 1OSNA 5DYGA 1D3TB 2QROA 3FB4A 1NPMA 3IEUA 3A84A 3KQCA 2JLRA 1QHIA 1ZBDA 2DE9A 4WMEA 4TSFD 1CVWH 1AKSB 4ZHAA 4RFSA 1TNGA 3C27B 1KSHA 2UWOA 4R8TB 1O2KA 3N2IA 2GK6A 4XOJA 1HJ8A 3TAHA 5FTKA 2QI9C 1V2KT 3TVTA 3T5DA 5F8TA 3D8BA 4GHTA 4JYCA 1WUNH 3KHVA 4LX0A 1GMDF 1BMFA 2PHBA 2QAGA 2WWYA 4AYXA 2ZCLP 4JKYA 4DIDA 1KI2A 1PVOA 3EYDA 4TLBA 4IVPA 5SZHB 3RYTC 3GEEA 2BHGA 3JVVA 4OJQA 3VX3A 2Q21A 4O2RA 2BY9X 2IS2A 5JWOA 1G7TA 1Z8RA 3DEFA 5HYOA 2CLCX 3GY4A 1M34E 4IDNA 4HAXA 1BBRH 2FNAA 1T32A 4LV6A 1T8UA 1NN6A 1PZNA 5JWRA 1U90A 2ESTE 1Q57A 2XSZD 1H1BA 4LJ6A 4P4UA 4X8LA 1P09A 2ZECA 1K5DA 2D7DA 1ZRKA 4JT4A 1PPCE 3HKJB 2NZ8A 1GJAB 2ONKA 2VINA 4CEHA 1GL7A 1EZUC 2AKYA 1VJ9U 1KK3A 3BTDE 1ONBA 4EPWA 3QKRB 5TB5A 5E2PA 3LT3A 1ZJDA 1TX4B 4FMDF 4LV5B 2O8CB 3CRQA 2Q3FA 2FH5B 1UVTH 3HPTB 3SNAA 1E96A 3M3VA 2YC2C 1U9IC 2BVSH 4PC6A 1CGIE 1II9A 1IM2A 4B3FX 1QFKH 5EZ6B 2NIPA 4RZUA 1YPKH 1G7SA 3AK5A 1AJEA 1YBWA 3IEVA 4Q9JA 4TWZA 2ZFPH 2ZPRA 1J70A 2PSYA 3VU9B 4AIIA 5FTNA 3AP2A 2B8OH 3CR7A 2YC4C 4AGKA 1A4WH 2ODPA 1W0KA 4ESVA 2BD4A 2PJRA 3ZH9B 3SO3A 4Z6AH 1VHLA 1TNJA 4DLXA 1MH0A 3LOXA 3CB4A 5JLJA 1AUJA 3K09C 3GJ3A 1VCWA 5DO4H 2DWOA 3GLIB 1AWHB 2NU3E 5CYOA 4OL0A 2GZHA 2IYLD 2OZEA 1BMNH 1VDZA 3U2QA 2Q9BA 2J59A 2GTBA 3SEAA 1P7CA 1C9PA 1M7GA 1DWEH 2JJ8A 1IJFA 1TNHA 2QU8A 3CH5A 1KMQA 4PO9A 3AVZA 2GCHF 3SJOA 1DSTA 5HPYB 4HLQB 4WVFA 2B21A 3LGVA 5FOSA 1W4CA 4TL9A 3AVVA 2NWNA 4CEIA 4FW9A 2FFQA 4C0AC 5L8VA 2OD3B 1HJAB 4DHEA 1AGJA 1HYLA 3BN9A 1A7JA 3HDTA 3ASYA 4YLGA 1TYNA 3ZVAA 3GYLB 8OHMA 5KO2A 2OFXA 1HY3A 2F43B 3QOFA 2CLSA 4PC2A 2SFAA 3SGQE 1CBWC 1NF3A 4NYMQ 5AJVB 2ANMH 2JJ2A 1AU8A 4MYCA 2OXSA 2P5SA 4BLTA 4ZXXH 4DZZA 1ZZZA 3ESTA 5JRJA 1ZTKA 1OFTA 1NBMA 1BS1A 5C4GB 5DP9A 3F8TA 2ALVA 3PEYA 1SG8B 1E9DA 1AZTA 1TGNA 2WWWA 3TGIE 2X2EA 1ANCA 1GTVA 1YZKA 3OHMA 3U44B 1V2ST 5T3HA 1NY22 1V6DA 2GVFA 2HV8A 3UIEA 1SXJD 3IGFA 1XD2B 2IHYA 4V03A 4DIHH 4A15A 2PH1A 4HYYA 2VGCC 2ZRGA 4LPKA 1C5UA 1PQ7A 1H8EA 2NO7A 4WAUA 1V2OT 2CCGA 4N1AA 1AMHA 3THXA 5HM9A 1C1MA 2JJ2D 2BMDA 1G3BA 1E0JA 2X1VA 4B3CA 2QG6A 1AVXA 4QRHA 3HR8A 4N0DA 5SZKB 5C1BA 1H9HE 1PYTC 2ZC9H 3SS8A 3MYWA 2FZLA 2ZM5A 1EAUA 1Z6TA 2D1JA 1C1NA 5EG4A 3GY8A 1S2MA 1Z2AA 3UPUA 5C1UA 2Q9CA 1D8TA 4M22A 1SVOA 5AWFC 1UK4A 2O0JA 2FX6A 3OTPA 5CMXH 4CRCA 3ZZ4A 2GZ8A 5DKMA 3SJ8A 1V2JT 3M7UA 1S3GA 4RD3A 1S96A 3KQBA 4QGAA 4EFNA 4M4SA 1Z0DA 2A3RA 1UBEA 2FEMA 3M5OA 1OIWA 1O2VA 2FOHA 1DTSA 1B0FA 4FI3C 3GLFB 2W00A 4LXBH 4P33A 1NVVR 1GKYA 3ZZ3A 1BMAA 5K0HA 2XC4A 2IWHA 2J95A 2M5TA 4AX9H 1E36B 3BB4A 4HB3A 2GZ7A 1P0SH 1A1VA 4NG9H 5J40A 1TU3A 1OS8A 4AKGA 4MVNA 1RFNA 1ZCBA 4LY6A 4XVRA 4AC9A 4MLFB 1MU8B 4BANB 1IBRA 4YLUA 4NDZA 2JH0D 4FUGA 2ZHDA 4CEIB 4QJ4A 1WU1A 3WY8A 1QBOA 2W6ID 5AJWA 5DI3A 1DAMA 1OOKB 2OV2A 1OE0A 2IYRA 4UXIA 5C4MA 5CB6A 5DK1A 5ETXA 1EFTA 1ZNZA 1UK2A 4KFTA 4MPWA 1U8YA 4AWXA 3UWOA 1W14U 3KX2A 3AAUA 4FUHA 1WTHD 3E0PB 1TRNA 1LF5A 4V0OA 1JXMA 2ZSEA 4NIYA 1DWDH 5EUMA 1RXPA 3DM9B 4KTCA 1GL1A 1SGPE 3THYB 3NZIA 5LPNA 3TJOA 2ORVA 3LGWA 5TDHA 3TQFA 3LAWA 1N8OB 3U61B 1VCIA 5ELXA 1W11U 1DPFA 2QTHA 3RHFA 2XTNA 3MD0A 4XDEA 5FBWB 1C2JA 3K0SA 3AH8A 1MD7A 5DI3B 4OS2A 2A5JA 1TFXA 2G52A 2NU2E 3D49H 1OKKD 1GJ9B 4HAZA 1LHFH 1AK2A 5KSYA 5I25A 3L33A 2J0SA 3N2EA 4A82A 1Y3AA 1KI8A 3FHCB 2Y80A 1C2IA 1LTQA 1GMCG 3PIRA 4M53A 4E05H 5JZVA 1AHTH 2VP5A 3HPRA 1OB2A 1S83A 4G0NA 3M5MA 4LZZA 4HAUA 3BS4A 3E91A 2ZJYA 3FAOA 3A8AA 4YZUA 1HCGA 4K8OA 3B8HA 5CE1A 1D3DB 4Z1MA 1G7CA 2PT5A 1V2TT 1U98A 3I92A 1DLEA 2HJVA 1P2NA 3LGUA 1RRPA 4E7NA 3BE4A 4TYWA 1P60A 5E95A 3QTOH 2DCUA 2AFQB 3LGTA 2Y6TA 4ZHMU 3KKOA 2NQ2C 2QNRA 1QJ1B 1YLCA 2WTUA 2ZI5A 1TPOA 2ZEJA 3BWDD 1H9IE 3NK8A 3VB6A 2ZJ5A 2IS6A 4OK3A 3VR4A 3MWKA 1YZNA 3VFDA 5A0BA 1ID5H 1FMGA 4MPVA 3TE6A 1HURA 1CBUA 1EAXA 1FIZA 3JVUA 4URZR 2REBA 3SJKA 3MU4A 1BT7A 2YWGA 4D0GA 2VLIA 3RXVA 3B23B 4A2QA 2J38A 2ZU4A 1B23P 1SGYE 3QBVA 2AIQA 3SGAE 1YZTA 1ZOMA 2P6UA 3ZS9A 2RMKA 3AKYA 2CGAA 2QCYA 3MGCA 4LJ5A 3TITA 2FN4A 4XSKU 1OJLA 3NXSA 2THFB 2WYGA 1RRKA 7LPRA 3E0NB 3ZV9A 4UD9H 5C46F 1J16A 2W0SA 5EE9A 1DE0A 1C2KA 3NEYA 4RD0A 4B2IA 5CLQA 4GHQA 2CJWA 1QHRB 1ETRH 1DANH 2EW1A 4TY6A 1C2MA 5CK5A 2IW3A 3KTAB 1CJVC 1C1VH 4UDWH 4YO9A 4KHZA 2ZU0C 4O97A 3TW4A 3DPUA 4LHWA 5IT5A 4WBSA 2GZAA 1QQUA 4LHXA 3PXGA 1NC6A 1GI9B 2VGCB 4WY3A 2V3OH 3K8YA 5FOVA 1U2RA 1KY3A 4PPQA 1Q1ZA 5KPJA 3A82A 4TWYA 1ZSKA 1C5WB 4C0BA 2EI6A 3KFXA 1JAIA 2WJHA 4DG4A 2OTVA 3VAAA 3SI7A 2R65A 3A87A 1HGTH 3IUYA 3AB3A 4XVQA 4DLWA 1R10A 1FZQA 4TQ9A 3KL4A 1TBQH 3MU8A 1LNZA 3EZ7A 2FPZA 4Q4HA 1H8DH 2ZVPX 3NBZC 4XIGS 1NRQH 3TH4H 3GD7A 4HZIA 4UNNA 1NVWQ 3M7QA 2GEDA 5EODA 1N0UA 3E16B 4NSYA 2OC8A 3Q3XA 1C5NH 2IL1A 4Q7YA 1VMAA 4WIAA 1P2TA 4I31A 4A0FA 3PCRB 5FPKA 3MG9A 2H1LA 3I5XA 1GG6C 4DDVA 1E38B 4NKRA 1YM0A 1ZW6A 2ZFFH 4EJSC 5C2JB 3GQBA 4HB4A 4L16A 3T35A 2ZU1A 2QZ4A 3ZD6A 1OYYA 3FVFB 1EPTC 2VP4A 2B7DH 1UHBB 1NJFA 2RDLA 1MTUA 1AZSC 4RJLA 1GI2A 4KSCA 4HATA 1IHUA 3URDA 1FAKH 4IS5A 3SHWA 1C5QA 3UQOA 3CH4B 1IHTH 1XXDA 1G20E 3LBHA 5TARA 1P05A 4D4MA 5DP5A 4N3NA 5A0AE 1LVYA 5FAHA 4D80A 2QP9X 1G2LA 1JWTA 1ZYOA 5CYPA 1E2GA 1OH5A 2D8WA 2XNDA 2JLQA 4V0MA 2H5EA 4CYMA 3DFJA 4RN6A 1N2CE 1R4AA 5AJXA 2RKOA 4IC6A 1FMJA 3THWB 3U8TH 5FXLA 3FMIA 4M9QA 4D4LA 4DKXA 2MSDB 1W36C 5D3MA 1K2I1 3S9AA 3GLHA 1U6QA 1UJ1A 2H5CA 1ZUIA 1TNLA 3KDSE 1HAVA 1ZM7A 1KYIA 1KI7A 1CR0A 5HE9A 4FMBB 5FPYA 3UFAA 2A7CA 2ZDVH 1QIXB 1TQ7B 1UTMA 3B9QA 2Y82A 1KI4A 1GHAF 4XWKA 1J9CH 1SVSA 5D3MB 4Z54A 1MBMA 1RJ9A 2BM2A 1NFYA 1E2QA 1V3XA 2V6NA 3G01A 2A5YB 2BZ6H 4A0HA 2IJD1 4PHGA 4NCJA 2BD3A 3C8UA 1C5ZB 4Q21A 2KAIA 2P95A 2HDNB 2IS4A 1XXHB 3MU5A 3DKVA 1LQDB 1O2PA 5G3ZA 1JR3E 2OLJA 1U0JA 4HDQB 5LD2B 3EZ9A 1MR3F 2C5LA 1MKWK 2P3SA 1GJ8B 1KSGA 5FUYA 2VWNA 2IXFA 2VF8A 4NH0A 2G51A 1IXSB 3Q72A 4UFGH 1HAHH 5EUQB 1RE0A 1G2MA 1ZSJA 4INHA 4OJKA 4TYQA 4ZROA 1TA6A 3T25A 3ZJYA 2QMEA 4DJZB 3KCGH 1CXZA 4ABBA 2TMKA 1O36A 1KMHB 4YLQH 2VEDA 1VCOA 1SHZA 1X86B 5CIQA 3OE7D 2VIOA 1W7AA 5AUQA 3RU4E 1F2SE 2IYSA 3I32A 3WMEA 2P8OB 1C5MD 2ZJAA 1MTVA 3S1AB 4AKHA 2R6AA 1SPJA 1ZHMA 1G9XA 4TPIZ 2GEUA 3ATMA 5L3SB 3U4QA 3SYJA 4G01B 2JETC 4MRNA 4MUBA 1ZINA 1E3MA 4JLOA 4GP6A 2D2EA 4O3TA 2AEIH 3AF4A 1TF5A 4ZMAH 1LO6A 3FMPB 1Z0FA 4YXWA 2J0UB 2PUQH 4JZIA 4KELA 2VIDA 3U7GA 1IXRC 4C0LA 3ZZ7A 2WJVA 3A4NA 3F3YA 4YMTA 2EI8A 1V2VT 1T4UH 2CDNA 1YZGA 1UDWA 1E2IA 2RHDA 3KZ1E 1AQYA 2VF7A 2GT7A 2UUFB 5HTKA 4LRWA 3FZZA 3LKWA 4I8LA 2B8WA 2ZU2A 3EAJA 3LU9B 4DLRA 2ANYA 4QFMA 4JZDH 4IKEA 3AVXA 4X8TH 2ZDMA 1W1WA 2Y5FA 1IQNA 2JJ1A 1OXGA 3PMJA 4AGJA 1V5WA 3PLPA 1AE8H 2SGAA 2OC1A 1HAGE 1MABB 4LHVA 2ZDNA 2CEAA 3T1TA 5FBVB 1GDDA 4AYYB 1CP2A 3SOPA 4D6PA 2UZ3A 2QAJA 2BB4A 3B1YA 1DG3A 3P8OA 3K9XB 1C9TA 4TTRA 1QA7A 3I78A 4AB9A 3VHLB 4JLPA 3QKTA 3QXSA 4P4TA 4NYMR 3MH6A 2Z9GA 2GJAA 1HEIA 2HXYA 3K0AA 3UWJH 1P01A 1E98A 3MMPA 1LPKB 4NCHA 3VGCC 3QUSA 4LC0A 1DPOA 1XVMA 4QM7A 3UG6A 2XJ4A 1ARBA 2VIIA 5BN5A 1VYTA 3I1FA 2W2XA 2KI5A 1QA0A 4PSKA 3ZZUA 5BN4A 2RGEA 3VKHA 2ZGHA 1ELVA 1W48A 3B82A 3GJ0A 1SC8U 1C1TA 4LUCA 2BY8X 7KMEH 4F91B 2QXJA 2ZGCA 2HT1A 1FY1A 1MH1A 1OB5A 3RMMH 1QRWA 5EP4A 1MKYA 2XXAA 2HPQH 4K69A 1F2TA 3VTKA 4KYUA 5J4SA 2BCGY 3KFVA 3I8XA 3H2YA 1Z6XA 2YJTD 4DRZA 2G83A 1O5BB 1N5KA 2F9MA 3JZ1B 4JL8A 3TU7H 1BIFA 2K5UA 4TL6A 4PSVA 3ZYEA 4X8UH 1F0SA 1DOAA 1D5CA 1G8FA 3BV9B 2VP2A 4Q66C 2VP0A 2CE7A 4MTBA 2PZGA 2GCPA 2ZJOA 2PKAA 4BPBA 2WVJA 3GY3A 5TCAA 2B7BA 3NPSA 1C4OA 3NWJA 5F3WB 3ZVGA 4YXWD 3T1QA 2N1BA 1IQPA 4WZBE 1SQOA 3L8YA 4H1VA 1GBJA 1A3EH 3K0FB 2VU8E 2BX3A 1DFPA 1GJ4H 3MNCA 1Z28A 2NO0A 2QA5A 4U01A 3THYA 2OAQ1 2V1XA 1Y3XA 1CGJE 1G64A 3W3ZB 1HE8B 1XF9A 3QVVA 1LHDH 4H42U 3G82C 4V0LA 3REGA 2LNCA 3SJBA 4LBVA 1TGCA 5KU1A 2RA0A 2WJIA 3BTEE 1ZPCA 2ZYTX 4HB0A 5DHAA 3EC2A 3RSLA 3OIYA 2LCFA 1LB1B 4BGDA 3EA9A 3ZZ6A 1P2MA 2XEXA 1GIAA 4D7FA 1ZC4A 2G77B 4BNRA 3X2SA 3A1SA 1DICA 1JXOA 3ZVRA 1KHTA 5AVDA 5G3YA 1TOCB 1OF1A 3RRMA 1OWHA 3A1TA 1E0AA 3EW9A 4UXHA 3BRWD 1TMTH 2O8FB 1V2PT 1NJGA 1O3CA 1QTFA 3OYPA 1LQEA 2FTMA 3B78A 1Z06A 3CW2A 3A81A 1W10U 1Z8GA 5KDDA 1OH6A 121PA 2O0KA 3EQ0H 4RFSB 1JIRA 2FLBH 2ZSDA 4YC7A 1E2KA 1ZC3A 1TQDA 1GI7B 3U8OH 1Z22A 2ZHFH 3VHXA 3OF5A 1GI4A 4CT5A 4RCZA 2BY5X 4KI0A 1SVLA 1AB9C 2GXUA 4GDFA 4I8JA 6CHAC 3KL6A 4B35A 1YE8A 4TZ6A 3C7KA 2W6IA 4E07A 1XJ0A 1THSH 1O2JA 5DGJA 2A5GA 2ZKSA 3EIQA 3E1SA 5L3SA 4JSYA 1FI8A 1CS4C 4GCHF 4AD8A 2ZFTA 1ANKA 3AVUA 4A8JB 4GSYA 2IXGA 2J4IA 1OW3B 4MG3A 3QF7A 1CHOG 3EPLA 3MFYA 2IYUA 4TLDA 2OBOA 4Q02A 1DT2A 3CF6R 1PQ8A 1YKSA 1EGAA 3RLFA 4DIEA 2BLVA 1MCVA 2DWPA 3GCHC 2OQUA 2VIVA 1IY0A 2G1JA 5EOKA 4DLYA 4ZIRB 3UMSA 5CLLA 4A1TA 2PEZA 2WWXA 4RD1A 4EQ6B 1UKYA 4ON9A 1EATA 4O9VA 2ZI4A 1ANEA 1JQLB 1TPSA 4DLSA 3TH5A 3IBGA 5B30A 1O34A 4X8OA 3LONA 3QPWA 1WBDA 3U1IB 2R0KA 1ZAKA 4Q4JA 3GLHB 3FYHA 5KNCA 3L0PA 5FL7A 4MDSA 1KSNA 1M7HA 3RC6A 2J45A 2R2AA 4ESTE 1E0FD 2QY0B 4A7IB 3RM2H 1G3UA 5EXXA 4JVNA 1E1RA 1RKBA 2RGBA 1IOZA 1OKKA 2OG2A 4GRAA 3VB4A 1YR7A 1MAXA 1BBRE 2XYAA 1US8B 2BQ6B 3SUGA 1O3IA 3CPEA 3LV8A 4XSHA 1HAXB 4E7RG 3FKQA 4MPXA 1L4YA 3GISB 1QY6A 4ZUHA 4D8NA 1AIXH 1Z6JH 1A0LA 2BDBA 1JR3D 1RGQA 5DG6A 1GKIA 1HV7A 1M8PA 3T1VA 5KSPA 2PL3A 1SGFG 3CS0A 5L2YH 2Z6BD 2HPPH 1LKAA 3ATKA 3GJ6A 1WBBA 3IPXA 2A7HA 4GPGA 2BQ7B 1M9UA 1UJ2A 3EX7C 1AY6H 1ZPZA 2ZCKP 1EX3A 1XKAC 3MJHA 3UOUA 5FCRA 4PTLA 3M0EA 4AFSA 2ZP0H 2QY9A 1QB6A 1F7ZA 1MAYA 2ZHQH 3M36A 1SGDE 3HGNA 1O5DH 1FY3A 1ZSLA 4Q7JB 4OQLA 1XPUA 1XUGA 2FFBA 1S5SA 3A7ZA 3RXOA 4I99A 2E9SA 3AM1A 1UCYE 1K9OE 1NIPA 4U7DA 2TRMA 1ZYUA 1LV7A 4M9XA 5FBIA 3ICEA 4ABHA 2SGDE 4RKEA 1OH7A 2W3KA 4IDPA 1TEVA 2C8XB 4XWAA 4O03A 2C4FH 1DXWA 4FINA 2Q0HA 1NS3A 1P9SA 4Q47A 1P9RA 4ASUA 4JVMA 4I32A 4CBNA 3PLBA 2QQEA 2ZU5A 1G8PA 1U94A 2I6QA 3EG5A 3K0FA 4IN1A 1EWQA 2IYYA 3ZZ0A 1BTUA 3FDIA 4BLPA 1F6BA 2WWFA 2ERYA 5JCZA 1NLFA 1O39A 2RA3A 1AN0A 4TYYA 4K3JA 2DB3A 4X2YA 2P94A 4GLYA 4YMVA 4EPXA 3BEUA 4YQFA 1NI3A 3R8CA 4DWJA 1G8YA 2QP3A 2QE7A 1IQGA 4WVPE 4ABYA 1ZGIA 5DN6D 3GYMA 1E2JA 3WMGA 2AK3A 1W12U 1FN6A 1WP9A 2V55B 2EWWA 4P4SA 1L4DA 1Y5AT 2AGIX 2I6SA 4UNSA 5FL3A 3V00A 4C30A 1Z5ZA 1EP5A 1O3LA 1KNQA 4B2BA 1T3LA 5J4QA 1FUKA 5BYJA 2WPHS 4MRVA 2BD7A 4GZLA 2Z0MA 1YZQA 2ZYVX 4A0GA 4UEHH 1OXSC 3CZPA 5DP6A 1MT0A 1G6HA 4OS5A 5BW8A 3SI3H 3NBFA 1ZMXA 3REFA 2XTMA 4LC1A 1UCYK 4PSAA 5G40A 1JIMA 1Z71A 1NRNH 2NTYC 5HR5A 4B34A 2P65A 5HM2A 2GVZC 3RXEA 3SQHE 3SV2H 7GCHG 3DOEA 2C8WB 3CX7A 1F60A 1VIYA 4DT1B 5FOXA 3P95A 4X0WU 3TJNA 1MRSA 1K1OA 2WUBA 5H8WA 2J7PA 2IOTA 2BDGA 2ZI7A 3U4QB 3FHTA 2FOFA 4OQNA 1B7XB 1E9AA 5FL7D 3LC3A 1E2FA 4MKIA 4RKOB 5JB8S 2FOAA 5GDSH 2F9OA 4M9ZA 2JIZA 3UUZA 4LOYH 1WXQA 1XZPA 4URWR 3CX6A 2P3FH 4IXNA 1Q3HA 2ECKA 2WBLC 5DO9A 1J2JA 3CO5A 2GXAA 2PX0A 2AD5A 2PFEA 2PMKA 1FAXA 4MRSA 3FP8E 1CA0B 1RTFB 1BMMH 2J7PD 4D76A 2IA5A 6GCHF 2BBWA 3TSWA 3A89A 1VIAA 4FUIA 2UUKB 1O3DA 4JLJA 2Z9LA 4KSBA 3ZZ9A 2O8UA 1NU9A 3SDZA 4RZXA 2ZRHA 1MO4A 3DHKH 2O52A 4ACBA 1HQYE 1UBFA 2SHKA 2ZSFA 4M9FA 4Q4AB 2BLWA 2ZIAA 4BXSA 1AIPA 2FWRA 4CRWB 3QEJA 4WXVA 5FPHA 4GVUA 3QLPH 4FXPA 2ZITA 1F5NA 4GAWA 1XUJA 2I1QA 2A9KA 1P2OA 1ZD1A 4HUTA 5KDLA 2ZS8A 2PUXB 3MWYW 3QF4B 1HAZB 4KP0A 4A1VA 5HZKA 2AIPA 1MMJN 1I4LD 4EFLA 3LQRA 4PZLA 1ZGVA 4BFYA 4QKQA 1J8AA 1FFHA 2PGBB 3P8NA 1LF0A 4U32A 2BZAA 1OXXK 3DZDA 3OEEA 1OIVA 2IYQA 3RANA 3QTVH 3BOSA 2XWAA 3ENSB 1F0RA 3K70C 1XU4A 5J4YA 1UBGA 2QQ0A 2TGDA 1T3SA 4K8YA 2Z43A 3TK1A 4WMFA 4BAHB 1NP6A 3VKWA 2DFNA 1H8HD 2XCFA 2YZ2A 4NIVA 4F4OC 1YF4A 1XMSA 5LPEA 1W2HA 1A3BH 1GMCF 3V12A 1O2MA 4YT7H 2ZU3A 4MQAA 4FVDA 4W5JA 1HAVB 2WSSA 1GDNA 2PR3A 1DITH 3RXUA 2WHXA 3HGPA 4UNRA 1YCPM 2R6DA 1NMXA 2AFHE 1NZQH 3NDBB 1VGCB 2ZYUX 4OK6A 5KHOC 4CEJA 1Z29A 1KTVA 1T0HB 3TGKE 1L4ZA 1DUEA 2FI4E 3P27A 3TIFA 2NU0E 1XPOA 5GVSA 2X19A 4Y7AA 3HP1A 2AWOA 2F83A 2WPJS 2OCYC 1U81A 1J15A 2HOBA 3KXKA 4LYFA 3H09A 1RFLA 5K8LA 4QBIA 1KO4A 2WPDA 3SJAA 1XCMA 4NYIQ 3LBIA 1K21H 4M1WA 1D3QB 1EJNA 1QNJA 4DCNA 2BDCA 1ZU4A 5J47A 3RXFA 3WMFA 1NVXQ 1CU1A 5DP3A 4ZI2A 3B5JA 2VPPA 4SGBE 1G41A 2STBE 3EA7A 1O3NA 4PO1A 1QB1A 1N1LA 2ZA5A 5C20A 4IFEA 1UVSH 1W49A 1SKQA 2P3UB 1OIXA 2NO6A 2ZVQX 3QBTA 2BDAA 1BMFD 3R20A 4DXAA 1DAHA 3ZVDA 2LKCA 1JR3A 5FTLA 2XWBI 2WJYA 1RRGA 3W5IA 3F6UH 4FU8A 1S8FA 1W0JD 1T7CA 3SFVA 1GVKB 4UXJA 3KJEA 3KQKA 2GF9A 1AKSA 4BTUB 2WIAA 4KFUA 1HTWA 1II8B 2GP9B 2BYAX 3GEHA 4FCVA 4Q9IA 2QIQA 2YOLA 1TGSZ 4BFSA 2QPAA 2ZFRH 1YJ5A 2F9UA 1DAKA 2VB0A 5GJBA 2CMYA 2ZRJA 1PPHE 3B13B 2VH6A 5LD2C 2OUKA 2H17A 1H8HA 3FFBA 2XCNA 1D2MA 3H7TA 1KXBA 3U3KA 1WOFA 1ELOA 3DA9B 3B1WA 3U6BA 2H7VA 1P3JA 4DDTA 4K1TA 3BEFB 5A8YA 2A4OA 2FOCA 1KAOA 2ZJ2A 4D2IA 1RYFA 1ZM3A 3GY6A 2BD9A 1SB1H 3CS7A 1KJYA 2NO9A 2OSBA 4TY7A 4CR5A 4A2WA 4W5HA 3RMLH 5F8XA 5JHGB 3UATA 2PTCE 5T6FA 1E94E 2ODNA 1E0KA 4I1OA 2OQ5A 1XFAA 1TUEA 2IUSA 2YHSA 4XE4A 3GJ4A 3PV2A 2QRZA 4V0ME 1H8IH 4GMXA 4FCTA 5L3VA 1MQ6A 2REOA 1CE5A 3EASA 2A4RA 2EFCB 1NO9H 2RCNA 4C0KA 3WYGA 1IN6A 2D74A 4WXRA 2QP4A 3M4YA 1N5IA 1G37A 3Q77A 4UNQA 3GLFE 1E9RA 2QEQA 1ZIPA 1SLVB 2JASA 2BC9A 2AKAB 3SZEA 1GBFA 1AA9A 3T5FH 4EUNA 2AMDA 1MKXH 5TXGA 3BK7A 3PTNA 4D25A 2ZANA 1P5ZB 1JRTA 1VPLA 5CJPA 3QZRA 2Y81A 2EFDB 4OM9A 1T4GA 5JJIA 4B75A 4ITRC 3LH1A 1LS6A 3AQ4A 2F91A 3I4LA 3V13A 1FPMA 4HGCA 2FWWA 1F92A 5HZHA 1WSSH 1G3DA 1AFEH 1X8KA 2BCJQ 3AUXA 2PLXA 1DY9A 4HLDA 1IN7A 2B5TB 2E1RA 2JIZD 2QE7D 3TLXA 1KDTA 4ZAEA 2CK3D 3A7VA 1W4AA 3CIOA 2V9PA 2R6GA 3WY9A 2HCJB 1O3KA 1DDJA 3TSZA 1KKMA 2JLVA 2GCNA 3BFKA 1JEEA 3AW0A 1SGIB 2YV5A 4HZUB 1PPBH 2WOJA 3LJOA 3I29A 1LHGH 3SV9A 1C4Y2 3LD9A 4JVSB 1IXZA 4BRUA 3K53A 1GL6A 3ZVNA 1SFIA 2EC9H 2VHJA 1VJAU 1XEWY 1UVUH 3ZQ6A 4IOJA 4RKFA 2PKSB 1ZUHA 2ODQA 2PMDA 4Q80A 4HFPB 4LJ8A 2J94A 5FUWA 3FKSA 4ABGA 5GXPA 3SQEE 5CHAC 1N6YA 2UZIR 4AKEA 5EE3A 1ZHRA 4CF7A 1A46H 4DVAU 1E9EA 1FN8A 1P72A 2R9VA 2A4GA 2ZRPA 1L2TA 1W0YH 1SGNE 5IYTA 2FDAA 3OAAA 4PC1A 3AVPA 3R9XA 1K1NA 5KUTA 5AR1A 2WKPA 4JS0A 4QGHA 2ZUDA 1RC8A 4EJSB 3ZDQA 1ABJH 1TPPA 2WPIS 3RXSA 3FTQA 3ZYDA 4K60A 2Q6TA 3FKSD 1CO7E 2SNWA 2GDJA 1TLDA 2ZE8A 2WJJA 4OYHA 4AG6A 3W6NA 1C2HA 4Y0AA 2BX4A 2ZTZA 4Z1MD 8GCHG 1GI3A 2BD5A 4MPUA 3RXMA 4K46A 2D06A 2V7QA 3MNBA 3HPQA 3C16C 2OT3B 1W7GH 1EP6A 2D62A 1ELCA 4HZHA 2Y5HA 3NUMA 2QSYA 2C90B 4Z0KA 2O8DA 2ATVA 2VVVA 2MMCA 2BD2A 4ILEA 4TYPA 1AKYA 3PQCA 2OLKA 4I81A 2AS9A 1TOMH 3K0CC 4B32A 5DYIA 2ZU6A 4Q1FA 4JLKA 1P2VA 3WP1B 3RXCA 1K5GA 2VH0A 2V1UA 1UAAA 3ZV8A 3KUCA 1JOUB 1WCV1 3D65E 2OE2A 4IW3B 3AAVA 1NESE 3LGIA 2QMUA 1QZXA 3SU4A 5EXMA 5H70A 1Z1IA 3SZRA 2BWJA 3MH7A 2YNBA 3NHBA 3RC4A 1GI5A 1BZXE 1F2UB 1CIPA 3OZXA 2VA8A 2RGCA 2X2FA 1G8HA 1AB9B 3EA8A 1XNJA 4BAQB 3L0IB 4DVGA 4ISIH 1HH4A 1T8TA 2ASEA 4ABJA 5EXPA 4ERNA 1EPTA 3WRXC 1KI3A 2HWLB 4NA8A 1XJQA 4IRUB 4JZ1A 1PPZA 3A8CA 2PX3A 2C96A 2K1QA 1DS6A 4JKIA 2ZDKA 1SXJA 3UPEA 1P6XA 4B3DA 1GBMA 5IRCD 2OBQA 6Q21A 4JZKA 3HU2A 3SHCH 2L0XA 1TADA 5C5NA 1MV5A 1WYKA 4DSNA 1P2QA 3RS4A 3AVWA 3LX5A 1QHHA 1UO6A 1XEFA 4A2PA 4OBEA 1VKJA 3QGJA 4BOHA 4PANA 1TX6A 5AK0A 3H0KA 1GI1A 3THXB 3F9HA 4M7GA 4CHAC 3A1WA 4OQMA 1YRBA 2C77A 1I4DD 3IKJA 4AB8A 1J17T 3ECCA 4FCWA 4ZDWA 1Q1BA 1THRH 1W7XH 1K6MA 1VTKA 1K1PA 2LKDA 3RRNA 3NXPA 4KTUA 1DADA 2C98A 3X1YA 2WUCA 2CHAC 1E2LA 1SKYE 1QG2A 3QJYA 2ULLA 2PLRA 2AR7A 1GMHF 4JYVH 5LH8A 5C3NA 3M3TA 4WF8A 3T12A 2ZJZA 1I2DA 3VXEH 4QT8C 1MZAA 1QJ7B 3F1SB 2NG1A 4Q18A 5B64A 2VNTA 1SBWA 3DM5A 2JDIA 3LW7A 5A0CA 3Q7QA 4GMDA 4OQFA 1O3OA 3KKNA 5JJLA 3FPAA 5JYIA 3U6KA 5A8XA 3GLIA 4ZI3A 2VJ1A 2CV3A 3C14C 3GLGB 1T3HA 5E0JA 1D6JA 3D31A 4AYWA 3ONWA 3VPKA 1P9UA 3O8DA 1W47A 1QHYA 4YESB 2BVXH 421PA 4B44A 3QN7A 5HE8A 3LC5A 2JLZA 3BFVA 4NMMA 4HUQA 2R6CA 1RPZA 3VMFA 4C0QC 2HLDD 4A1XA 2Y5GA 2O9QA 2BQWB 1VITH 3F9FA 1VCNA 2FEQH 3TNTA 1MD8A 3PO1B 1AS3A 3F9EA 3KB2A 4PQFA 4I8HA 2W26A 1W4BA 3FP7E 1XJCA 1GNRA 2A32A 2SNVA 8KME2 4D82A 3MH4A 2AHOA 4KYIB 1DVAH 2ODYB 2QT1A 5A2MH 1Q20A 1DVRA 4B1TA 2H6MA 4IEEA 1QQ4A 4A0RA 5CB8A 4OGXA 1T4VH 2X8AA 4JLNA 3W8NA 5JFGA 2R62A 4O3UA 3IHLA 6CHAB 3K9LA 1GRNA 4B3GA 4HAVA 2QTFA 3P20A 4H4FA 1BRCE 4DCDA 3CM0A 1GJ5H 1OWEA 4X6MA 1ZM9A 4K2YA 3H5CB 1NROH 1U8ZA 3EA5A 1S9HA 4PQRA 4A9AA 4Q7MB 3BGWA 3KXLA 4NIWA 3THOA 5EGMA 2C3SA 3P70B 2GV6A 2I1VB 1EFCA 1O3AA 2DWQA 2BTCE 5AJYA 1GDUA 3RU4D 1FNNA 1T5LA 3A8BA 3BG8A 2DYKA 4XWOA 4KLZA 1Z07A 2WV5A 1YR6A 1UTQA 2CE2X 4ZKDA 1ZUNB 5FCKA 1EB2A 1Y5UT 3QXCA 2ZR0A 4FIDA 3RNLA 1CJMA 4GT1A 5GJCA 1FW6A 3I72A 4EJSA 2F1IA 4WJG2 4Q9KA 1YYY1 1ORFA 5DISB 2GV7A 2QAGC 2YKGA 1SGWA 2C9CA 2WWGA 2GNOA 4JLMA 4DDUA 1P10A 2KBEA 4IC5A 1KTTB 4MGKR 2P2LA 1O35A 221PA 1A5IA 4DSTA 1GBDA 1JI0A 4INKA 4MGZR 1W2GA 5GJVC 2W0MA 1O2QA 1R0WA 3UY9A 4WW0A 2QPTA 4CRDA 1XCPA 1R0ZA 3I5YA 1O5FH 2SGFE 3AVTA 4D4KA 2F1RA 1GKUB 3ASZA 3BB1A 4LSGA 3LVRE 1THPB 3PWBA 1RTLA 5JEDA 3KJIA 4B2PA 2Z9JA 2WMNB 4E09A 5M04A 1S0UA 2H9TH 2FLRH 1JBKA 1Z3IX 1A5GH 1X6VA 4JJKA 4F4IA 2P8OC 4A4DA 5GCHG 1UTNA 4EQ6A 4NFFA 1W44A 2LWIA 5AJZA 1DXPA 3P92A 3ZYCA 1O3MA 1BOFA 2NPIA 4NWKA 2XNSA 1ZPBA 1HUTH 2PBRA 2ZRKA 1L8QA 3WNCA 1YPLH 4X6PA 3BIUH 4LHYA 2BMFA 2HUPA 2FDCA 4Q1EA 5C1YA 2IEYA 1W8BH 1G18A 1BUIA 4JBYA 1VG1A 4MH0R 2AYWA 3K2UA 3PO1C 5FOUA 2P3TB 2V3CC 3LPRA 3NBXX 1OWJA 3K9NA 3SUFA 2HRVA 2XITA 1YRAA 3JZ2B 2EFGA 5EXSA 3GPLA 1TQ0B 4POAA 1SXJC 2IJOB 1CJTC 2UUJB 4Z8YA 1XUFA 1ZD9A 4LJ9A 1SVMA 1PUJA 2G00A 4ABIA 6GCHG 3PG5A 1F2UA 3ZZDA 1CR2A 5KSOA 1YHNA 3VB3A 4AYVB 1BHXF 1XEXB 4BEJA 2QXIA 3KNXA 2TBSA 4AZ2B 2BDIA 1SOTA 2J9NA 1GWNA 2V6JA 1G5PA 3KUDA 4KU4A 1HAIH 4FXGH 4C0JA 1UEIA 4XSGA 1TE0A 1QBKC 1KIGH 2VO1A 1NG1A 1XCGB 1VCPA 4U5XA 4XVUA 1KXEA 2KBFA 2GT8A 3T29A 2CNWA 3KXIA 4DLZA 3R9WA 1NLYA 2AERH 2GF0A 1N0VC 1AZZA 4AK9A 2QGNA 1AZ8A 1O32A 1IQIA 1XTSA 2E87A 1F3OA 4I8GA 4DEXA 2A5KA 1BJVA 1XKBC 2WKQA 5TJXA 1DARA 1E2NA 3UMRA 4X2VA 2GEVA 2DHRA 1GHZA 1EESA 2GDEH 4J2YB 1W0ZU 3QIAA 4KFRA 3RRZA 1ESNA 4NL4H 4IN2A 1EWRA 3WXMA 3GOVB 3P32A 2HEIA 2GJKA 3TK9A 4TPYA 3BF6H 3RDPA 1HT2E 2P67A 1N0WA 3QUMP 4ZO4A 1O2RA 2WSMA 1JJ7A 3V4FA 5DIFA 2VHTA 3KQUA 2N42A 3T15A 3B9FH 1ACBE 4DW2U 2B8TA 3EPKA 3IPYA 3LA6A 5KNBA 4B43A 1YLDA 5SZJA 1KDQA 3MFJA 2FS8A 1IQLA 4XJXA 5TV2A 2QF3A 2YOHA 1YPHE 2QC2A 4LYJA 1SVPA 5CITA 1ABIH 3MJRA 2AD1A 3B1ZA 2F55A 3GCTG 3KQHA 3GJXC 4MKHA 3A8TA 2OM2A 1MO3A 1ZJ6A 1AVWA 2AGGX 2PKSC 4YOIA 5JBCS 5FFMA 2CL6X 4LDJA 4JBWA 3V3MA 3AVYA 4Y10E 5LBIA 4ASHA 1GJCB 1RVDA 2AH4X 1SQAA 4JMPA 3MNSA 1P06A 4YMWA 5T6GA 4NU0A 3STJA 1C5SA 4F4JA 1XXFA 2BXTH 1FP7A 2O8DB 4Y71A 1LCYA 1VCQA 2V3HH 1N5LA 1JPNA 2XNIA 1F0TA 1QL8A 1R5BA 3GJ7A 1RRCA 1TIOA 2OK5A 4A6PA 3F9GA 1OHHA 1KI6A 5F2EA 4QJ5A 3SU5A 1J7KA 3GDUA 1T91A 4Q4JB 1LKBA 4G1UC 1N6PA 5JWHA 4TT3A 4BRWA 4L9SA 1UTLM 1GCTB 4XFQA 4BZPA 1CT0E 3SU2A 2J41A 2AK2A 1KJWA 5KOYA 3K0CA 4ZIRA 1NNEA 4OHVA 3DD2H 4PAOA 1FPHH 4P4SB 2H16A 2C9OA 3KQDA 1G36A 4ZH8A 1GBLA 4HLUA 2ZRFA 1E34B 3AV0B 3IO5A 4GOXA 3BJIC 1XD2A 1ELEE 3HKIB 1TTTA 1XMNB 2DY1A 1ZJKA 3FVQA 3ZZCA 2GCTC 5EQRA 1E35B 1O2OA 2GZ9A 3IWMA 4JZFH 2R3YA 3CWZA 4XBBA 1Z6YA 3E6PH 4CH8B 3CNLA 1EQ9A 3SU3A 2WV4A 4GOKA 3W34A 4UJ3A 2NZJA 2FGKA 1AD8H 1C5LH 3E1XB 1BA8B 2FM2A 3IO3A 4K81B 4IW4E 3LVQE 3QE0A 4B3XA 4YT6H 2D26C 3S9CA 1ZNWA 3I3SR 1YCPK 1A0JA 3GCOA 4I33A 3QX5H 4O25A 1R8QA 4URYR 2FGJA 1T9HA 3OTJE 3TJZA 4M1YA 2ZETA 2C9YA 1C1PA 1O5CB 1AFQC 1E4YA 1VG8A 3QF4A 5P21A 1K28D 2GAAA 4CREA 3EGKH 4TYDA 4AN7A 3PJRA 1D4PB 1A2CH 2P6NA 3VR2A 3K9HA 2KAIB 3T62A 5F9HA 1GJ6A 1GI0A 3GMTA 4RY2A 1P2SA 1V2LT 1CEEA 1HNEE 2O5VA 1E2PA 9LPRA 4D0NA 2ILNA 1RIWC 2W58A 1TX7A 2FOGA 1BJUA 1XUIA 1EZSC 1XEXA 4S2EA 5BQ5A 2VH5R 1TAWA 5LGOA 1A2BA 1E2EA 4R71A 2OHFA 2ZG0H 3NC1C 4DY7B 5FPTA 1QRAA 1F5LA 3ZVCA 3EIHA 1W46A 2BM0A 1GILA 5TCCA 4EPYA 1KGDA 5KSZA 1NN0A 2D7CA 4MQBA 2IUTA 5ESTE 1E37B 2R9PA 2BD8A 3DKPA 3X1XA 1AWFH 1ZLRA 3AASA 1JBUH 2W2TA 1GJ7B 4HI0E 1G4AE 1SGEE 2BVRH 2KJQA 3KQLA 1XUHA 1EXMA 1U8AA 4CGZA 2J2UA 3TAUA 3K9GA 5JB9S 2D2FA 3B8JA 2O8FA 1G5TA 1T5IA 4D0LB 1BO6A 1COWA 3C41J 1Y3VA 1ELDE 1T8LA 4TWWA 1UTKA 3T61A 5FUVA 4TYNA 1EXFA 4MNYA 1W36B 1CHGA 1SL3A 1PJRA 2G4UA 4CIDA 4ISOA 3DL0A 4CRGA 2JCSA 1IAUA 3AF2A 2QYIA 2JATA 7GCHF 5GPIB 2H1UA 2RGNA 1NM6A 4XD7D 1GRQA 3VGCB 1LMWB 1GCDA 5EXTA 2ZF0H 1DG1G 4IEIA 2W3IA 3L8ZA 3HR7A 3RXJA 1ZHPA 1NSTA 1P9WA 2ZAOA 1ZD8A 2BEKA 2QBYA 5B58C 4W9MC 1GDQA 2C95A 1XP8A 2XGJA 1ESAA 2J1LA 1RS0A 4B73A 5J4HA 1C5TA 3TRFA 2GMTC 1B0EA 3LH3A 2PZFA 5KDOA 4LJYA 1UHBA 4F38A 2O8MA 4CRAA 3W8RA 1S82A 3U1JB 3LJJA 2PGQB 1GG6B 3VR6A 5C5OA 3UWIA 1M74A 4GP7A 3WNBA 4A6LA 2QGZA 1NRPH 1MBQA 1FZZA 3SV8A 4X2WA 3OIUA 3R3GB 1G5RA 2J9RA 1HFDA 621PA 1ELGA 4ABDA 1BQYA 2PEYA 1N6NA 4LYHA 5L6NH 4PPFA 3EAQA 2R44A 3SNBA 2F3RA 5JEEA 5KNDA 3TK5A 2ZRAA 4TN1A 4V02A 5IK2D 5B57C 1K1MA 2ANWA 1XTRA 1Z0JA 3MHWU 3MSXA 4PC7A 4NZLA 1F2TB 1KO8A 2Q6GA 3HU1A 4FD2A 3PTBA 3V4RA 3SU6A 2DFKB 2VIPA 1HQCA 4KLNA 4S35A 5AUNB 1DAIA 3LNCA 4UFEH 1BRUP 1C1OA 1X3SA 5JHHB 1G7RA 3TNSA 1OT3A 1R0YA 3VFEA 1D9XA 4ZCIA 3G0HA 3OESA 1Q3XA 1SFQB 2WKRA 1ESMA 4FUEA 3A85A 1DE7H 1N6OA 1C2LA 3GJ8A 2ZTYA 1VITF 4DCUA 4AG5A 2A7JA 1S3SA 1KO5A 3UIRA 5DJ7A 1B5GH 3VX4A 2RGGA 3T34A 3TNFA 1TUIA 1MU6B 2FESH 2A5DA 2XZOA 3LGYA 2FOMB 1E2MA 3A7XA 1GJDB 2IXEA 1EJAA 4RZ2A 3A8DA 1ZTLA 4OS4A 1GAJA 1RJXB 2JEOA 3TW8B 2ZEBA 3QQ5A 4WH8A 1C5VA 3RWOA 3UR9A 2YVUA 1EASA 1E1RD 2XBVA 2JLYA 1EFRA 5FOWA 2RHMA 3GDSA 2A78A 3RS5A 4O3MA 2ZRIA 3ZZ5A 4LYAA 3CPJB 1NSFA 5TY0A 5T6DA 3BIFA 2VIQA 3Q8XB 1K1IA 3QO6A 2RG3A 3OFNA 4JK5A 1OP0A 1P02A 1NG9A 1G17A 4I4LA 1K1LA 4KCGA 3TUIC 3H7OA 3E8LA 3GFTA 2IF2A 5T1VA 3UTUH 2FPMA 2BIFA 3RMOH 1GHYH 1J14A 3SJZA 2ZDAH 2Z4SA 4PFSA 3HU3A 3B1XA 3NDPA 1Z8FA 1PLJA 5JCPA 4HUQB 3GY5A 1L0ZA 4L8GA 1K22H 5GADl 4Q7ZA 3F68H 4Q9HA 4Q2KA 1P62B 1SHKA 4TSFA 1P73A 4Q00A 4U2WA 1L7VC 1GBHA 2VSFA 3RC5A 4CEJB 2Z3EA 2C8YB 3FGNA 1V2UT 1OXUA 1ESBA 3IIJA 3U3RA 1DX5M 2SGEE 5JRZA 1JR6A 4DGJA 1N6KA 3K09A 2IHBA 2Z9KA 4JVLA 2GCOB 1KZ7B 1FUJA 2YINC 3VKGA 3ETLA 1KNXA 5FX6A 1GHBG 2YYZA 3P6ZB 3HATH 3O8CA 1OP8A 2FPKA 1YPMH 5F03A 5E4FA 2ZQ2A 3DHWC 2EFEB 1H65A 2W2VA 3QI2A 3MNXA 1NKTA 3TVDA 4DB2A 1ZNYA 5K8IA 1YVDA 4ZV4A 3SHFA 1COWD 4EKDA 1OLOA 4D9RA 2QN6A 4JJZA 1LHEH 4MNXA 2ZUBA 5EXNA 1K1JA 1VECA 1SHHB 1P4SA 2Z5FA 3PITA 4PHTA 4FMCB 1GBAA 3SC3A 2DFLA 2G88A 3BBPA 8ESTE 1SVIA 1XMVA 4IHQA 2JH5D 4NWLA 3BXZA 1MZDA 2R3UA 1AFQB 1P3CA 5E0GA 1H4WA 3C5CA 4A5TS 4BFZA 3QKSB 4TTQA 4HDCA 4OI4A 1TQ2A 5C1XA 1BYUA 2QM7A 4Q03A 3S7KB 1XDBA 4JL5A 2GRJA 3RC8A 1GBIA 4YDSA 1DAGA 3UOPA 2NO1A 3MO9A 4TLEA 1TA2A 5LB2A 2ZI2H 1C1RA 3LY5A 2JLUA 3SI4H 3PV0A 4AG1A 4X6NA 3VR3A 2JLWA 3CPHA 1C4V2 4U02A 5LDDC 2A0QB 4WH6A 3RXRA 3H86A 2HF9A 2GK7A 4CRBA 4Q4AA 4QNMA 3AW1A 1MTNC 3MMGA 5DP7A 2IYVA 2CL7X 3S69A 1N6XA 3TGJE 1YZUA 1TGBA 1NKSA 4JLBA 5EXLA 2CL0X 3WYFA 2H9HA 1F5RA 4ZKNU 1IOEA 1ODFA 1RZ3A 3KIDU 2ZE6A 5FH9A 4VGCC 1KIMA 5FUXA 1E1QA 1NLZA 2OINA 1Q2WA 3NKKA 4Q4LA 4J1YA 2VHQA 2EQBA 3RS2A 2WZQA 2AXPA 1UKZA 1F48A 1OFHA 4Y0ZE 1UTJA 1ZVQA 1PPFE 1C5RA 4GL2A 1HT1E 2CXXA 3LXXA 1M7BA 3S0NA 4MYTA 2YOGA 4Q48A 4Z51A 3LXRA 2V54A 1INCA 1WBGB 2VHUA 4CBOA 4LJAA 3SJIA 1O3EA 1VYVA 2IF0A 3UR6A 4RZ3A 4OHXA 3U5ZB 4RCYA 1GMHG 5DLQC 1HIAA 1KZGB 3NBYC 3AVOA 2HVXA 1MQ5A 2FMJA 4G3XA 4P31A 3RSOA 3AP1A 2IYWA 2ZUCA 4QHYA 4INLA 3CONA 3KKQA 2AMQA 2GKVE 5GJWC 1Q1QA 1RRFA 1ZMLA 4EPVA 1E32A 2PLFA 3W9YA 4NZYA 4PZZA 2GCOA 2GVDC 1TMBH 1X8LA 1N6IA 1CA8B 3NH9A 3SBDA 1BTPA 4QNRA 1AKEA 2ASUB 3NTUA 2Y7XA 3IIMA 2B6HA 2BJWA 2VWLA 4I1SA 1C1UH 6ESTA 1QCPA 4IVQA 4LBZA 4M1SA 4WOPA 3KQNA 2HCBA 2C93B 3WBJA 2B7CA 4TQAA 4AOQA 3KKPA 3SR0A 2ORIA 4BAOB 1P75A 4MNWA 2HXSA 2Q3HA 5IF9A 3SZNA 3I77A 5K8TA 3BSQA 2WICA 5C18A 5EP3A 4X1PU 2ZQ1A 5A4JA 1AGRA 4ZCLA 5E2OA 3R7WB 2GD4B 4YMUA 1WXRA 4FUDA 1GJBB 1G8GA 1W0KD 3PEVA 2CN0H 1NMYA 3C15C 3FMOB 3N7OA 3GDVA 1YPEH 2OESA 1S1CA 1O3FA 1XMIA 2UWPA 4DCVA 1R5OA 3ZVMA 4DLUA 1NN1A 4A92A 3SN6A 4DIIH 3GY2A 3RXKA 1DS2E 1BTZA 3L6PA 3SFZA 1LPZB 1BTHH 1P12E 1QURH 1JQJC 4D26A 4IFBA 3MO6A 3ZVFA 1AS0A 1RD3B 4FUJA 4GCHG 1UK3A 1JB1A 3EZ6A 4QGFA 2XB4A 5E8EH 4CHAB 1QHSA 3GLFA 2CHAB 1JXPA 1E1QD 4I8KA 1DBSA 4NCNA 5JSZA 1VG9B 3H84A 2ZTXA 3OIWA 4XTCS 3CBQA 2ZPTX 1EFHA 1VYUA 4NPHA 1EAIA 4UNPA 1HJAC 1ZMJA 2O8EA 3FWYA 1SGQE 1FX0A 1CJUC 3SU0A 1YCPH 3A80A 4E5UA 4YOGA 3Q3JB 5EE1A 3BH0A 3K0AB 3EA0A 1ZTJA 4NYJQ 2HF8A 3RABA 1WQSA 4EPRA 1QJ6B 1O5EH 3SU1A 4C3ZA 1QHGA 4JYBA 3TLOA 1KDOA 1Q22A 1X1SA 4CZ2A 1WF3A 4EDHA 5J4LA 1M1YE 2WPKS 2FFHA 4JK6A 5EQQA 2ZI9A 2ZPSA 3UXMA 4Y7BA 3X1WA 4DLTA 4DCSA 1HUQA 1YP9A 4D81A 2WINI 4BFWA 2A2XH 3BD9A 3T1OA 1BRAA 1Z8JB 3QY0A 2PZEA 1SHYA 1VR1H 4TL8A 4NFEA 1HXEH 3I73A 2ZR9A 4BZQA 1UCYH 4M1TA 3KEEA 1Z7KA 4IDQA 1XB2A 1XXHE 1E0SA 1NU7B 4UFFH 3GCGA 1NFXA 1KJZA 1GVLA 2O8BB 2PW8H 2G0TA 3KF2A 1L1GA 2GESA 4RD2A 1IN8A 3CRVA 1J90A 4BFTA 3Q9LA 1Z8IB 4AY2A 4I1VA 3CENA 4OI0A 4FWIB 3B60A 2BLOA 3U7FB 5EZ5A 4QL3A 2XB2A 1QBVH 4X8VH 4YOJA 2PT7A 1YPJH 5PTPA 1NFWA 2ZPQA 3FANA 1MTNB 1MO6A 3BH7A 3NH6A 2ODEA 2VSXA 3BORA 1G19A 5H4IB 1CRPA 1QGFA 1ELTA 1QHHB 2ZHEH 4IMZA 2FO9A 4B47A 5CDFA 5B6LA 2ORWA 1NBMD 2JKHA 5F8ZA 5DN6A 3CRW1 3IDQA 3GLIE 1WMSA 5L3RA 4PPGA 4BZXA 3P4YA 4IOMA 4ZCMA 2XOKD 2VIWA 4NCKA 3AKCA 4ISHH 2UKDA 1OWKA 3MU0A 1MUEB 1D9ZA 3BB3A 3D6TB 1J8MF 3RDZA 3TIUA 2FPLA 1JRSA 3W94A 1QR3E 3SNEA 4G5RA 4L9WA 1UTOA 3WP0A 4B3BA 4QXAA 3CWQA 1O3GA 2XSZA 2P16A 1HIAB 1IY2A 3FMFA 4OI1A 4QM6A 2QTVB 2DE8A 1F0UA 2ALPA 2ZS7A 2ZIQH 3RXHA 1QRZA 5E3HA 1XUKA 2EVWX 2GKSA 4H1UA 4EFMA 1DUAA 4X1SU 1O38A 4QG7A 3MLEA 4US2R 3RS7A 4OHZA 1BTXA 1M6NA 4Q1CA 1XX6A 2FSHA 4OS6A 1KLJH 2D4HA 3A86A 1AN1E 4ABAA 3VR5A 3DUXH 1FQKA 3SV7A 4JSTA 5FTJA 1P2JA 1OYQA 4M1MA 4NSVA 1WB9A 4DC9A 1D3PB 5SGAE 1NL3A 1XVOA 4KVGA 1TPZA 1HV8A 4RSPA 1U9IA 3UREA 2ZRCA 3S7HB 1AS2A 1SQ5A 4ZDIA 3ADCA 4EPTA 3T28A 4URVR 1IQFA 3PMHB 4ZHLU 2XZLA 3P8FA 2JLSA 1MKWH 2ZI6A 2ZFQH 5F9FA 2F7SA 4H6TA 1JNYA 1N6LA 4E03A 2A5IA 3QKUA 3T06B 2BKUA 1DAFA 1FY5A 3TPIZ 2ZQ5A 1AI8H 3RXQA 3RS3A 4B48A 1W0JA 3IG6B 1A4RA 2J7KA 1Q1EA 1ZP6A 1AGPA 3PMAB 1KI9A 1G32B 1A0HB 4Q19A 2ONJA 2V8OA 2FG5A 3WNDA 4L4UA 2VSOA 1Q21A 1Q3TA 4JLVA 2FI5E 3S9BA 1SZPA 3UK6A 4LK2A 5K7RA 3BEIB 2QAAA 4RI0A 1YC0A 3GEIA 2UWLA 3R8FA 1TU4A 1TALA 2VYFA 5SZIA 3ZIAD 1GCTC 2TGTA 4ISLA 3LIWA 2QMOA 2O8TA 2P5TB 1P8VC 1VZQH 1GFIA 4L15A 3SUDA 4LJ7A 1P61B 1CQQA 1XD8A 2STAE 4TLCA 3EWAA 3OFND 1GP2A 1O3PB 5FHTA 3RLYH 4NONA 4TMZA 3IQWA 1NRSH 5JDUB 1HXFH 4Q01A 1C5YB 3JZAA 4QJ3A 1QG4A 3FFGA 4B6FA 4W7SA 3RUOA 5EP1A 1Y3UA 3RLWH 2RGAA 3PR1A 4JLAA 1C2GA 1TBZH 1J8YF 4B33A 2FS9A 3CX8A 3AKEA 5JS8A 5C67A 1IN5A 1Z6AA 3M5NA 3SHAH 2VTKA 1GRRA 1FV9A 2R2MB 1ZMNA 2X77A 1O31A 1HAPH 3DDCA 5JECA 3JZMA 2BEJA 1YZLA 2CBZA 1BYIA 2VVUA 2HNTE 5JS7A 2MSCB 1NIJA 2CJIA 3UNQA 5CJ2A 1G9IE 3OU0A 1BMLA 4FN5A 1SGCA 1CLUA 4O0MA 5E7JA 4MRPA 1JEDA 2BDTA 4BLRA 2ODWA 1CT4E 3MAAC 3X1ZA 3K70D 3MWIU 2ZE5A 1K8RA 4B2CA 3ADBA 5L3QA 3RXAA 3OEHD 2ZAMA 1R2QA 2ZR7A 2ZI3A 4DSOA 4BTIB 5JBAS 2CVFA 4B6EA 1O87A 2Z9IA 1S84A 4LCBA 1GNPA 2GA8A 5EPYA 2GJSA 4HI3A 1XTIA 4M8NE 1A61H 2HYIC 2SGQE 4PO8A 5TMPA 2R6FA 3W5JA 5DI9A 4FU7A 3OE7A 1TNDA 3VB7A 5L3QB 2BMGB 3SV6A 1V2NT 4ZKEA 4V0KA 2CF8H 2FV8A 1O2HA 1AUTC 4KVAA 3RP2A 1DWBH 3E3TA 2ZYWX 3J81k 1S0RA 4CDGA 3EARA 1EX6A 2H2ZA 3A6PC 5DH9A 4P0TA 1L1NA 3MUFA 3QPVA 1IQEA 5AF9H 2RB4A 2F3TA 3TR5A 4NBSA 2H9EH 3PB1E 1UADA 4K5ZA 1LVMA 4LBYA 4WWYA 3L0SA 3DZ8A 3ZIAA 3AKDA 1GHAG 4BE7B 1BDAA 3QVUA 2JH6D 1C1YA 3V7TA 4AFZA 3GJ5A 3U3JA 1KAGA 2QA9E 5I46H 1W5SA 3ZLJA 1TBRH 4FMCF 2IUUA 1KMHA 4QBGB 2HT6A 2XTTB 1KSJA 2G1KA 2FFAA 5HMAA 1IQMA 8GCHF 1OFIA 3MH5A 2BOHB 3GLGA 2GDDA 1G4UR 1E6CA 4UJ5A 1P2KA 4CT4B 5D3QA 2R8RA 3TUJC 4LI0A 4P32A 3S1AA 4MDFA 3U9AH 5AFZH 1UDXA 4Q1DA 1OSSA 2A7QA 3WBKA 1IN4A 2IBMA 2QF0A 4PAQA 5CDFE 2AMPA 1G6OA 2FSIA 2RGXA 3WYAA 2SGPE 4G5OA 5EE5B 4D9QA 2GZDA 2IYXA 1VITG 1SVWA 3CF2A 3A88A 4BAKB 5H68A 1ETTH 3HK6B 4C2UA 4FU9A 1TB6H 2OAP1 1V2QT 2GTPA 1MOZA 2XBWA 3VXFH 1KI1A 1II8A 3A58B 3GFPA 1C4U2 4C0SA 3BTQE 1LVGA 4IOKA 4LBWA 1P2UA 1O2YA 1Q44A 1KDPA 4DT1A 1AE5A 1SQTA 3BERA 1LTOA 2W6JA 3URCA 1ZRHA 2GBLC 2WM9B 1NT1A 3TR0A 2A4QA 4PHHA 1E2HA 1XZQA 4A8JA 3TQCA 2GAOA 2XBYA 2NMVA 4KXFB 3GICB 5HKKA 521PA 3DFLA 1LDTT 4IOLA 3LWNA 1DO0A 1SLXB 3T27A 3LBNA 4AG2A 2V35A 4XOIA 4ZXYH 3U8RH 4BLOA 5B6OA 2CVHA 3OIVA 4QHSA 1XPRA 2RGDA 4MGIR 1X7AC 3U44A 5GNDA 4PZYA 3DMDA 4THNH 3BIVH 4EAQA 4P3YA 1GVNB 1WV7H 4MYUA 1TWXB 4B71A 4JMYA 1VGCC 2JETB 5FBEA 1KK0A 4JYUH 2Q6FA 1G16A 1NTPA 2FOEA 3G5UA 5ESBA 1ZNXA 3FE2A 5AUPB 5KPDA 1DOJA 2Q6DA 3SNDA 3BFXA 2XTZA 4BASA 3PUXA 1T6NA 1G3CA 3RXDA 5CM8B 2P59A 2PCLA 1X1RA 2CHGA 2W7SA 4RD6A 4TL7A 2J0QA 2Z7FE 2Y7ZA 2OC7A 2EI7A 3BH6A 5G53C 2QMHA 2G55A 1TAGA 3IILA 3QGNB 2IPHA 1SMFE 2Q1JA 2ZHWH 2OILA 4ZKSU 2FIRH 1A5HA 4AFQA 2FF7A 2D3WA 2NU1E 4Q7LA 2XBXA 3U7EB 4Y0VA 1UFQA 2OCPA 1V2MT 2AGEX 3ADKA 2WWIA 2XZPA 5DNYB 5FBLB 1XTKA 4IVRA 4R2IA 4M21A 2G5VA 1Z63A 3A4MA 1G3RA 1PLLA 1GHBF 2WYJA 4Z8XA 4Q9LA 4O2LA 1TABE 1E4VA 2BJVA 2QGRA 1ZM4A 5BXQC 1UF9A 2ZRDA 3T2NA 2PKAB 4MDEA 1DWCH 1DEKA 1YGCH 3BTHE 4IMQA 4YONB 4BECA 1T8MA 1Z6GA 4Y11E 5K8UA 4M1OA 1OKXA 2WAXA 4AURA 1C5XB 4I1UA 1HA3A 2NOAA 1ZM2A 3FZDA 1A5TA 4K8BA 2OBMA 1CJKC 4QBHA 2GCTB 2ANCA 4GNKA 3PUVA 1FPCH 3QG1A 3DO6A 4CEHB 4HB2A 1W13U 2EWVA 3E2IA 4ZDJA 4RFVA 4G5SA 4AFUA 1VHTA 3I8SA 3W6PA 3OY6U 4C4PA 1HBTH 3CRRA 1W3CA 3LLUA 2O8CA 3PVSA 2QBYB 2A1DB 3R0FA 1D6WA 3AGPA 2I4IA 1TF7A 4C7OA 3HWSA 3SBEA 1O2TA 3TJVA 3VQTA 3CRMA 4BWYA 3ATIA 3LDXH 1S6HA 4ABFA 3NCLA 2ZS9A 1O33A 2V7QD 4Y8ZA 6LPRA 4CVNA 3PYHA 1P3EA 2WAYA 2O8LA 1KI6B 2JJ1D 3AEZA 1KYNA 1MTWA 3SE0A 4HAWA 3SNHA 4X8HA 2GCHG 1NRJB 2AX4A 4YMSA 1SULA 4BQSA 1OWIA 2BOVA 3HK3B 1NRRH 4R0IA 1T8OA 1Z0IA 4ACAA 4I7YH 1VG0B 3LH5A 2C2HA 2A2ZA 2FYRA 1KO7A 1RJ9B 1W36D 3QWCH 2CXVA 4OI2A 1LY1A 2ZRLA 2ATXA 4OKSA 1MABA 5UKDA 4IBLH 8LPRA 1FNMA 4F4CA 1XBTA 5F6MA 2FZ4A 5FPSA 3UG7A 3K0EA 1Y3YA 2F9BH 2GBLA 3ZZBA 4DLVA 3CP7A 2BY6X 1UMAH 4FUBA 2G4TA 2WV9A 3PUZA 4KAXA 1KXDA 3D23A 2NU4E 4MA4A 3UMFA 1UKEA 3V9PA 1N5JA 4HAYA 1Q0UA 3QDZB 5A5GA 2C04A 2H18A 4ARZA 1SGRE 4U00A 5C2ZA 3AF1A 2OLGA 1XD9A 5FBRB 5KTYA 1AQUA 1EJMA 3HYTA 3SGBE 1TPAE 1A1RA 3O8BA 2EA3A 1C5PA 2ANKH 1Y8TA 4NIXA 1G291 2B92A 2F3CE 1LFDB 2FTLE 4OK5A 2VQSA 2Z3CA 3SYLA 1G3EA 1WCZA 1GVZA 1OV4A 3F0TA 4GPTA 3PV5A 4D4JA 2OXCA 1ANBA 1KDRA 1PYTD 3KJGA 2XC0A 1SSXA 3QENA 4NA9H 2G6BA 4ZKRU 3MRSA 1J99A 2G3YA 3BAFA 1IQJA 3ZQJA 5E7MA 3ATWA 2J0VA 1DSUA 2FA9A 3PFIA 1Z0AA 1FLEE 3TJUA 5BWMA 4DUGD 2C99A 3MU1A 1YQTA 4NTZA 1G1MA 2WMOB 5IK2A 2IT1A 4TQUS 1YU9A 1SR5C 1OFUX 1KY2A 1HPGA 2FP7B 1ELFA 2C8ZB 1SLWB 2JAQA 1LW7A 1KY9A 4PROA 1W2KH 1JPJA 4IDOA 1FTNA 1UEJA 1AM4D 2O8EB 4JIMA 2WPLS 1V2WT 9ESTA 3K70B 2AXNA 1JJVA 3D3QA 4US1R 5GIBA 4B2LA 2QRNA 2OBLA 3N70A 1KLTA 4BFXA 2V6IA 4DOQA 5L30H 4F7WA 4ABEA 4DUGA 1Z6EA 3U3OA 1Z83A 2AN9A 1BHXB 2FU5C 1GWAA 1E79D 5CM9C 3PWCA 2DPXA 3P4XA 1O2UA 4EIWA 2Z94A 2ZJ8A 4MKGA 3BTFE 1O37A 1PV4A 1EFUA 2IC5A 2ZRMA 5EQTA 3QEOA 1GHVH 2IK8A 2FJUA 1LVBA 2F9LA 1GBKA 1KXCA 2BBSA 1O2XA 1BB0B 3U3MA 5JMTA 3B1VA 4DJTA 3MOCA 1EZXC 3BTTE 1P2IA 2VBCA 4PQYA 4RVCA 1FOEB 3L2OB 5DP8A 1C1SA 2ANBA 4LJ4A 1FJSA 4AYTA 3T5GA 1E99A 2FXRA 1O2WA 4LGMA 3X1DA 4IJMA 4RD4A 2XRCA 2FOLA 4R7ZA 2Y8EA 1MKXK 1TNIA 1P9NA 2FSGA 3EE0B 2FODA 4ESHA 3LRPA 2OUAA 3P1JA 3MI4A 4LZ4B 5L2ZH 1HE1C 1WDTA 3EWSA 4DCTA 4TLAA 2J46A 4KV9A 2A45B 4TMTA 1ZU5A 1HAOH 3NC0C 4X8MA 2OCVB 4Y76A 2F9VA 3Q3KA 4K1EA 2G9NA 1RIFA 3ND9A 3R9IA 2XC5A 2CHQA 1BTWA 3Q00A 2XAUA 3D7MA 4KFSA 1O2LA 1ELBA 2GILA 3A1UA 1GGDB 1DO2A 4TMXA 1NN5A 1O2NA 2B9LA 2GMTB 2IEZA 2Z3DA 3RS0A 5J5CA 1EOJA 3A4LA 1JAHA 2YNMA 1S9DA 4Q7XA 1SXJB 4JLDA 3ICQB 5DE3A 1Y3WA 1S6FA 4W5WA 4BTTB 3TBKA 3GCHB 1N8OC 3QPUA 1T0JB 3E90B 2IN2A 1XMJA 4Q5IA 2V0BA 3F5FA 2QXHA 2YNAA 1I2MA 3K1JA 5GWZA 1N6RA 3FFAA 1DM4B 4DB4A 1O2SA 1KDQB 3SU8A 2D2DA 2ZDLA 2ZJBA 1C2DA 4A36A 1BBRK 2QPOA 2J3EA 2F1JA 2XW9A 2WOOA 1W4RA 1CGHA 4GOJA 5AFYH 1TX8A 1SLUB 4Q1BA 3RMNH 4Y8YA 5BRRE 1NY6A 1N3BA 3A37A 2QN5T 1V2RT 1GMDG 5JI3E 4LHZA 2EU8A 1ETSH 3VEQB 5A09A 1M2OB 1GITA 1XEWX 5JI2E 3WHKA 1D2EA 1OWDA 2ZE7A 1ZR0A 2ZRNA 3O47A 1LPGB 4BLQA 3DMNA 1O2ZA 3SQWA 3KB1A 4QOSA 3A83A 3NWUA 3VB5A 2PSXA 3MTYA 4V0NA 1ELAA 1G30B 4QC2A 1FDPA 1I4TD 5HGGA 1RW4A 2JA1A 2CCKA 1TNKA 1OXVA 5H1YA 1U0HC 1FX0B 2XXLA 4BFVA 3RXBA 3GFOA 4WXIA 3VU9A 3UNRA 5DP4A 4C7OB 1WA5A 1HRTH 4FUFA 1GHXH 4YTAA 4TZ0A 3BTGE 2W83A 5GCHF 4B76A 5EPNA 1DLKB 2Z4RA 2ERXA 2TPIZ 4HEJA 2CMKA 3H4MA 5CK4A 4J0QA 1O3YA 4HLUC 4HLCA 4Y0YE 4Y6DA 3MWJA 5CHAB 1LHCH 2LPRA 2WWHA 3SOSA 1LVOA 1PPGE 1OYWA 1TEXA 4AI6A 1ESTA 2BKEA 2YWEA 4GFDA 3GY7A 1FQ3A 3M35A 4XBCA 2HGTH 3W6OA 5A0FA 3V0XA 3E5HA 2ZWLH 3KQEA 3TH2H 4PHFA 3SW2B 3CR8A 2BVNA 3P17H 2HYDA 2HNTF 2CNWD 4HSEA 2AWNA 3TUZC 3EZ2A 2ZCHP 4FMDB 1FNIA 2RGNC 2XNDD 2VVCA 3BTWE 5JBTA 2VRWA 1OHHD 3FP6E 4BUJA 1EKBB 1C1QA 2XOKA 1TRYA 3IITA 3UQVA 2A31A 2OBNA 1WTGH 2CHVA 4QBFA 5JPMH 4IDHA 3QSYA 3M37A 1S0QA 4DDWA 1QVAA 1Q31A 3UNSA 1W5TA 3MWLA 4BLSA 1SI5H 2N46A 4LPSA 4DEYA 1WAYB 4OS1A 4C9BA 1TONA 1R5NA 2OC0A 4US0R 5DSZA 2QV1A 2PWXA 3PUWA 3CUEF 4K1SA 2MMGA 5IDVA 4JT2A 3BG4C 1BKDR 1Y5BT 5BPEA 1NVUQ 1BOQA 5JBQA 4X6OA 3U69H 1E9SA 4DURA 1U99A 4KITB 1KSFX 3O8RA 4Q4HB 1U0LA 3QZQA 3MCAA 4LK4A 4E22A 1KOFA 1UPTA 3ZGXA 1HB0B 4UQOA 5HXFA 2H5DA 1GL0E 3WRYC 4KODA 1L4UA 4KGAA 4RSGA 3SQXA 2PCJA 1MO5A 2OFOA 3VR1A 4URXR 2Z6VA 1BIOA 1O2IA 2YWFA 2FOBA 1HYQA 1RYHA 1KKLA 1PLKA 1WQVH 2YWHA 1GUAA 1E2DA 3L43A 4GI7A 5EJEA 1N25A 2Z83A 3EC1A 1IHSH 3M5LA 3DOFA 4B2AA 2ZTSA 3A7WA 1Z2CA 4ISNA 3VNVA 3IHWA 1GBEA 1TMKA 4BAMB 2W5EA 5DHFA 4MRRA 4H6SB 1CF4A 3M61U 1KK2A 4BEBA 1ZRBA 2O8WA 3BG4B 1UKVY 3RC3A 2GXSA 1G3QA 3PV4A 3R7WA 5ABWA 4NYJR 1VCMA 3Q85A 1XRJA 3ZVBA 4H9GA 2NPFA 4F93B 2CK3A 3QNUA 4WXPA 1O30A 2ZO3H 1CKEA 2PJZA 1MCTA 1QHXA 5EU8A 2EYQA 3A1VA 5GVRA 1GI8B 3A7YA 1ZIOA 1XM1A 3RXLA 2FI3E 3QXHA 2OCBA 1TMUH 1KXFA 1CR4A 1AO5A 4VGCB 5CIWA 3AVQA 3PUYA 1FP6A 1Y59T 1TGTA 1HJ9A 3K6YA 3Q7PA 1KO1A 1G21E 1SKYB 3GLHE 1N6HA 1GPZA 3QK1A 3SJ9A 2WPDD 2BOKA 3WHLA 1GG2A 1O5GH 2J87A 3ELAH 1UTPA 1XXHA 1DAEA 2BDHA 4MNVA 4DBLC 2A5FA 4II7A 4PC3A 2F4LA 2GETA 2W7UA 4R98A 5ANRB 4WZ6A 3STIA 1EAWA 4JCNA 3ZZ8A 3L0OA 2ZFSA 4Q1AA 5EE0A 2JDID 1UBCA 4B74A 3NG1A 2ZSAA 1FY8E 1CA0C 1V43A 2FE4A 5EP2A 1NMZA 2QM8A 1PJPA 5JJKA 1CSOE 2XJ9A 3RXPA 2BMEA 4LV8B 3GLGE 2R2WU 1UVPA 1CRQA 4BFUA 4TT3D 2OEPA 2HLCA 1BITA 2EYUA 2VL7A 4C0HA 4UONA 3NKVA 2A30A 2TGPZ 1T31A 1EFRD 4LWZA 3GCNA 3UANA 2GXQA 1YR9A 2GGVB 1C1WH 4WMDA 5HCIA 1GI6A 1HDTH 2NGRA 1FMLA 2QL6A 3TSOA 1WQ1R 1S81A 3LX8A 2CJWB 2UVQA 2OP9A 5G4BA 1C2FA 1EUFA 3LLMA 4A8JC 4X1NU 1E69A 1FONA 1HLTH 4OGYA 1KK1A 2VHCA 1IQKA 1E9BA 2KWIA 3QKSA 4M0LA 3OEHA 2J0UA 3SYNA 1UVOA 3T26A 3N5CA 5E0HA 3RM0H 4MKFA 2ZRBA 2O8BA 4PAMA 3EXAA 1WE2A 1BRBE 1IJEA 3SNCA 2VP6A 2IYTA 2HJGA 3L3TA 3GCTF 1P11E 1NVVQ 2REXB 1O3BA 4TMVA 3RU4T 3NEJA 2ZROA 1XX9A 2DUCA 3U7HB 2P93A 5IHPA 1EB1H 2A2QH 2OXRA 3NIBA 3Q5DA 2G8TA 3K65B 1FTSA 5J4KA 2ZXUA 4NZQA 3EPJA 3LFUA 1E9FA 1P03A 5FI1B 4KO8A 4ZKOU 2JLXA 1ZCAA 4OHWA 4NYIR 1AQ7A 2F1HA 1X8JA 4CR9A 4TMKA 4KJZA 2FYQA 2CLDX 4CRFA 1QB9A 1IY1A 1HAYB 2W6JD 2C03A 4XH9B 2IX3A 4NP6A 4NCIA 3C5HA 1KXAA 1GZSA 5FBQB 1GOTA 3LDAA 5JBBS 1R7RA 3M7TA 3UKDA 1EX7A 3W90A 3CZQA 721PA 1QF9A 2I3BA 2WJGA 5B2ZA 1QL7A 2HALA 1CR1A 1JMOH 2ZGJA 3RXTA 2A5AA 4HDOB 3KN2A 1PQAA 4NE2A 1TF2A 4JYTA 2FEOA 2BLQA 1IAQA 1UM8A 1QVRA 4N0EA 4AKIA 4C2TA 4M2LA 2GJ9A 2KB0A 3I62A 1L2EA 1SOZA 4D7GA 1RIWB 2QT0A 3ADDA 1XTJA 3OEED 2YOFA 3SUEA 3TVJB 1YR8A 2JGNA 4KTSA 4Y8XA 1SGFA 1O3HA 1OH8A 3RAPR 1IQHA 3A7TA 2C8VA 3PEUA 3AUYA 3THWA 2BXUH 3EPHA 3PM3A 3NHAA 5FR1A 2GX4A 3QKRA 2XXAB 3SORA 2OFWA 4FVBA 2TIOA 4RKJB 1BCUH 4A6XA 1D2NA 3SYKA 3ZVLA 3FOZA 3IBYA 2P6RA 2QXGA 3QXJA 4HTCH 2G81E 1QHNA 2VP9A 4G5GA 3Q5EA 5HKKD 1II0A 2G0NA 3W3AA 1C9KA 2J34A 1PPEE 2GJ8A 3B85A 4HZUA 1Q12A 2FSFA 3P8GA 5BN3A 2V4ZA 2QSZA 5F98A 3ND8A 3ZZTA 5FR2A 2C78A 4M9SA 1O0DH 3W95A 1IONA 4YDHB 5LPFA 1S1MA 3PROA 1KTSB 1CBWB 1E9CA 1NN3A 3H1TA 4CH2B 5LB4A 3K6ZA 3QG5A 1G3IA 2HNTC 2F9NA 2BMJA 2OCAA 2BM1A 3B6EA 4R2HA 2CCJA 3A36A 3IIKA 5TVKA 2QAGB 4SGAE 1D9IA 4KBFA 1JALA 3CNNA 1QRXA 3ODDA 4GBMA 1XTQA 2FZZA 2ODBA 3TGPA 5AHGH 3M6AA 3RWMB 2MSEB 3LW8A 2ZZUH 7ESTE 4FWTA 1QBNA 3L82B 4A1FA 3GP8A 1SGTA 2G5NA 1OPHB 3IQXA 4Y79A 4NHOA 1H9LB 1YPHC 1OPXA 4F49A 4WZAE 3AF0A 4Q7KA 1Z47A 1US8A 3MO3A 1EZQA 4MYHA 1PQ5A 4IXMA 4G5QA 2TGAA 5EQSA 3RXIA 1RTKA 4LOAA 5A8ZA 1NBME 1CTQA 2CF9H 4M1KA 4UE7H 3CKLA 4ZDKA 1LS1A 2Q3MA 1QDEA 3KTAA 1ANDA 3M3SA 1D6RA 2F43A 3BC1A 1GSIA 5KYKA 5G41A 4XBDA 2VWMA 3PLKA 1OYTH 2RAPA 3TMKA 1DELA 3CNOA 3CLVA 1R6BX 1ARCA 4NA7A 4GSOA 1H8ED 2F6RA 3B2EA 4JZEH 2BDYA 4QGGA 1QL9A 1FIWA 2ZGXH 3C4JA 3UWKA 1G3MA 1Z08A 1TQ4A 1DY8A 5AUOB 1CHOF 1GM5A 4U30A 3ZZAA 2HLDA 3SJCA 2PTNA 3QXXA 1S85A 3ZD7A 1A7SA 1C2EA 2DR3A 3Q3YA 3HJNA 3EIEA 4XTRA 1FQJA 2J92A 2R0LA 1FY4A 4AORA 3EZFA 4FUCA 4DT7B 4E06H 1ETUA 4X1RU 5DGXA 1T8NA 3E70C 5FTMA 1NFUA 4X1QU 2B0FA 1L1JA 3VNUA 1YKTA 5LPRA 2UUYA 3C1KA 3U98H 1AVGH 1TL7C 2H8KA 4TTPA 5HCNA 4LZ1H 4TMWA 3LO5A 1OXTA 1O2GH 2WIBA 5BYKA 3D62A 1KLIH 1WRBA 3ZVEA 5GJ4B 2P0EA 5IDKA 2WSSD 3BTKE 4JL6A 2XX3A 2IYZA 4OHYA 5J4VA 1EPTB 3AF3A 3M1IA 4ASUD 4PXAA 4X2XA 2ZGBH 2Q9AA 4IGDA 3B9PA 1OX1A 3B7GA 2AFIE 1GBBA 3TK6A 4ZPXA 3OY5U 3AGQA 2EFHB 1FL9A 3ODFA 3EDXB 4MUAA 1FXYA 3PENA 3BTME 4PX9A 3KJHA 2EEKA 4QHTA 1R0XA 2KSQA 3OSYA 2ZREA 1P57B 1XWIA 2O0HA 1EK0A 3LQQA 2ZSBA 821PA 3FHOA 1EG7A 5FX5A 1BH2A 2GHIA 1TRMA 1P04A 1SXJE 3TH3H 2AL7A 2FX3A 2QENA 1GHWH 1NY5A 4PR0A 3PEWA 4L5BA 2RCEA 3DVLA 2WPMS 3AP3A 5EW2H 4R9UC 2F9PA 1BTYA 2H57A 2DFTA 1Z1JA 1R8SA 5JSZB 3SN8A 2BBTA 2PV9B 1GBTA 3ATLA 1CULC 4CW7A 5FOTA 2BBOA 3RVBA 1S4QA 3TKLA 3PMBB 1PFXC 1F5KU 1MRNA 2GWHA 5EW1H 4MGYR 1O5AB 1SVKA 1EOLA 2BY7X 1C5OH 1GNQA 1FUUA 3ITIA 1A2KC 3KGPA 1A82A 2RH5A 2OO7A 4UKDA 4DSUA 1CT2E 2DBYA 3U60B 1YPGH 2BHRA 4KBGA 3RXGA 3KKMA 2FX4A 2FMXA 2QUZA 4NCYA 2KE5A 2J5XA 4URUR
chains in the Genus database with same CATH superfamily
1GKLA 4PPNA 5HOQA 3I5MA 1YXMA 1FXUA 1QXSA 4X8SH 2BV3A 1KS9A 3OX7U 1Y63A 5EIBC 1Z0KA 1Z13A 2P5UA 1Y80A 4BXWA 1T2NA 4OQXA 4INAA 1K89A 3FYCA 3SBKA 2SECE 3KOZA 1E6UA 3ZS8A 3CF0A 4LX8A 2CXRA 1PUIA 2GM3A 4UFNA 4XUCA 5E7IA 4ARZB 4YCNA 3I61A 4YM9A 2QORA 5CTJA 3KVYA 5IKOA 3UQYS 4F4UA 1AKUA 1B0UA 4A82A 3OE5A 4YJFA 4KKDA 1IM8A 2CGEA 1TJYA 1VMIA 3GHYA 1LC0A 3OZTA 2FLWA 1B43A 2ZNKH 5I7AA 2R1VB 5CT8A 1U3VA 2PGDA 1Q0ZA 1T5DX 4YY3B 3PD1A 3HYRA 1GGDC 3DT0H 2YH2A 4WA7A 1W1UA 3F5DA 4GWLA 1HRKA 4J0CA 3K4PA 3RRYA 4DV7B 4EMTA 3STVA 5I48A 5BUCA 2O2JA 2ATIA 4MA5A 5DLDA 3OU7A 2IS1A 1P8JA 2FFRA 4Y6RA 4GUXA 5JCJD 2OQRA 2W2NA 4UFDH 1QVVA 4DG9A 1E1DA 1JECA 4GZMA 4JBXA 1A5AB 3GI1A 3NVAA 1RHMA 4ZI7B 1GBCA 1NNSA 1HM5A 4H4DA 1B6SA 5KVCA 5DPAA 2I7XA 1PE0A 5C35A 3MA0A 4KQ6A 1OTXA 4ZI5A 4HDRB 4ZD6A 1W5EA 5FI0B 1TQ6A 4DLNA 1N4DA 2MDTA 2RJNA 3D8HA 2ZK7A 4PSDA 4ZVMA 4F92B 1OP2A 1DHTA 2ILTA 4NGAH 1GL9B 3DB1A 3MT0A 2H92A 2PIAA 1FSFA 2ZIEA 2ZTMA 4H3KB 1C50A 2P2CA 3GRYA 2XOXA 1O3JA 1AXEA 1V5GA 3OM1A 3ZLUA 5F23A 4MITA 3Q76A 3P26A 3AQIA 4PLZA 4OS7A 4KX5A 4XD7A 2IWRA 5U9CA 3WLIA 2BGNA 1TC2A 3O95A 2HA7A 1WP4A 3BMNA 3ZCQA 4P80A 1MTSA 4R01A 2EZ9A 4B84A 3P2JA 1O9HA 1YQGA 3OAAD 5HBGA 2VWOA 3PNSA 5KNBH 1Y5IA 4LNUA 1E79A 3IIIA 4G41A 1O5IA 5KYWA 1OSNA 1SG0A 1Z5VA 3P96A 5HW0A 1EJ0A 5DYGA 3SLGA 1D3TB 2AG8A 3RS8A 1JDNA 2QROA 2QN9A 5EJZA 1GUDA 3COZA 3E15A 1VGQA 3PDIA 4LSZA 3VOAA 3FB4A 3VR2D 3SC2A 5JTTA 1NPMA 3IEUA 3A84A 3KQCA 1V8PA 1YCDA 2IH5A 4E5YA 2JLRA 2Y68A 3OLYA 1GCAA 1QHIA 1YJQA 1ZBDA 2DE9A 4TSFD 4WMEA 1RZVA 3KV1A 4JR2A 1DXYA 4Z86A 4IYRA 1CVWH 1AKSB 4ZHAA 1K5PA 1ULTA 2B35A 2FSVA 3E7DA 3E84A 3KWFA 3LG2A 4RFSA 3GLSA 3QYAA 4TMYA 5DGHA 2FEWB 1TNGA 3HM9A 1W9HA 3C27B 1KSHA 1OGYA 3NANA 2UWOA 1SPBS 5FB3A 4R8TB 1O2KA 1DEHA 2GK6A 3N2IA 2BGJA 3N59A 1SU6A 4EKNB 5A04A 4QFDA 2WZCA 3QKWA 4XOJA 1HJ8A 2LPMA 3M3DA 3TAHA 2YZGA 5FTKA 2QI9C 1V2KT 2OZLB 2PWZA 3R4VA 3RVRA 3T5DA 2YHUA 3HLYA 5F8TA 3TVTA 4ZV4A 3D8BA 5IJWA 3AFMA 1AHHA 1B8VA 2NSDA 1NVBA 2ZFUA 2XQKA 3BCUA 4GHTA 2PJDA 4UQPA 5AI6A 1ODLA 1TW2A 1X7ZB 2FPUA 5ECWA 3GBSA 4JYCA 4ED9A 3QJGA 1WUNH 3E7XA 3KHVA 4LX0A 1GMDF 2BW0A 3OOSA 1ZITA 2VRNA 2WQZA 3LDFA 4CLXA 3DSRA 5A02A 1RFGE 3WKEA 1BMFA 2PHBA 3A3NA 2QAGA <