5FR1A

Double acetylated rhogdi-alpha in complex with rhoa-gdp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
190
structure length
184
Chain Sequence
IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQASGCLVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN RHOA
publication title Rhogdi Alpha Acetylation at K127 and K141 Affects Binding Towards Non-Prenylated Rhoa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 62
structure length 184
sequence length 190
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fr1A00
1KAOA 4LJ8A 2CL6X 5M04A 5JHGB 2W6JA 4TL7A 2ZRHA 4UJ3A 1AKYA 1CIPA 3ADBA 1W4AA 3KJHA 2V6IA 4M9XA 3R20A 1T5LA 2FZ4A 2ZJZA 1NJFA 4TWZA 4CVNA 2GJAA 3I73A 1DAKA 5HE9A 1GRQA 2YC2C 1F2UB 4P4SB 5AUPB 2ZS8A 2J46A 5HZKA 3QSYA 2RAPA 3ICQB 3LAWA 3RAPR 3F8TA 3K70C 1NSFA 3Q5DA 1Q1BA 2JLQA 4QBIA 4DRZA 2FDCA 1IJFA 2BM0A 3CLVA 3PEWA 2A3RA 1U8AA 1Z47A 4M2LA 2JJ2A 3KXKA 5F9FA 5L3VA 1E32A 2WJGA 2HUPA 1CXZA 2Z43A 3W8NA 4YXWA 1BYUA 4BLQA 1DG1G 2XX3A 1QDEA 3BB1A 2IYZA 4Q21A 1ZVQA 1W36B 2QAGC 2YKGA 2JCSA 2W6ID 4GRAA 4DLZA 1DO2A 3GLHE 2NO9A 4JBXA 1W4BA 5UKDA 2O8CA 4A6XA 4LYJA 4ZI3A 3CPHA 4WIAA 2RGBA 3UMSA 1G5PA 2WM9B 3SJAA 3THYB 4TYPA 1MRNA 2RHDA 4UJ5A 4UQOA 3J81k 1RYFA 3TQCA 4Q18A 2I4IA 1NBMD 4ZIRB 2XXAA 1XTJA 5EP4A 1XJ0A 1EG7A 1U99A 3N70A 3LVQE 4II7A 1QHHA 4AG6A 4M53A 1OH8A 2FZLA 1IXSB 1XCGB 4PHHA 1KNXA 2F3RA 4PANA 1NMZA 4CRWB 3THWA 3W6PA 1TUEA 1JEDA 2ZRKA 4DHEA 4BFYA 3QKSA 5FR1A 1E79D 4RD0A 1UM8A 2YZ2A 1XWIA 3AF4A 1ODFA 4TMXA 2ZSBA 1E2EA 4N1AA 4Z1MA 5CM8B 3TSZA 5DN6A 1SVMA 5EE5B 1XEXB 3W34A 3D7MA 1NN3A 4MYTA 4RKEA 2H17A 1R4AA 3AP3A 2ZRBA 2PLFA 2D2FA 4N0EA 3N5CA 2IS2A 1ZUHA 4WXPA 4X8MA 4TLDA 2DBYA 2PX0A 1U0LA 4A1FA 1PJRA 1G5TA 1L8QA 3MAAC 4IDNA 4OQLA 5E7JA 1DG3A 4YMUA 1OHHA 4MITA 2ZYUX 3WMFA 4TQAA 1FX0A 4DDVA 3FB4A 3ADDA 3RS7A 1J99A 2CLCX 1KDPA 2E87A 4ZCIA 1NSTA 1E9AA 1NIJA 4XD7D 1BH2A 3LV8A 2QT0A 1FMLA 3TSWA 3CNNA 2AX4A 1Z07A 5L3QA 4O0MA 3IO3A 3OIYA 1XXHE 1E2JA 1GSIA 3PEYA 3FKSA 4WAUA 3AP1A 2AR7A 3FMPB 4R9UC 4G5RA 4B47A 1R8QA 2PT7A 3GLHA 1QVAA 3QXSA 1DAIA 2YOFA 5EJEA 4X8HA 2HF9A 3T1OA 1TQ6A 4ZIRA 1JQLB 4C0KA 4D82A 3VKWA 3L82B 1U0JA 1GKIA 2IYWA 4KYUA 2NG1A 4AKIA 2O8CB 2J0UB 2PL3A 5KHOC 1B0UA 2ONKA 5CK5A 2B7CA 3A1WA 1G7CA 2H1LA 5EZ5A 2YC4C 4DT1B 3PG5A 3B85A 1XPRA 3GJ6A 1JXOA 3VU9B 1K8RA 4M0LA 3FFAA 5DHFA 4TN1A 5FOVA 4MGKR 1TEXA 1CU1A 1N0UA 4EQ6B 4RZ3A 1W5TA 1N6KA 4GI7A 3KQUA 3TUZC 1RFLA 4DLXA 5JRZA 4DXAA 4DZZA 3U5ZB 5BXQC 1OFHA 2IUSA 3R9WA 1UKVY 3QKUA 4KXFB 3QVVA 2GTPA 5CIWA 4TQ9A 2K5UA 5TARA 1NI3A 2ZE6A 1OH5A 2XAUA 2H16A 4LUCA 1KIMA 5C4GB 2XITA 1NBME 4QBFA 3U44A 1G8FA 2FSIA 2QBYB 3MWKA 5BWMA 3BK7A 1XEXA 4NCJA 2IS1A 2G83A 3AF0A 4C9BA 4IEEA 4BE7B 2FFQA 2WPDD 5DN6D 1MABB 2ZUBA 3AVVA 1XEWX 1W5SA 2ZR9A 3EAQA 3M6AA 3WYGA 5CITA 3GFTA 2OSBA 3ONWA 4ESHA 2PEZA 1CR4A 3M4YA 1G21E 3VR4A 4MH0R 1YR6A 4FWIB 2VSXA 3BWDD 5TV2A 4LHYA 4WOPA 1ETUA 3LBNA 1G18A 3I61A 4RCZA 2RGNC 1ZINA 1GG2A 2ZYWX 4DLSA 5A5GA 3CRVA 1J70A 1G8PA 5KSOA 3QPUA 1NLYA 1ZNZA 2AXNA 2DFTA 4CEIB 4CDGA 3I5YA 3TAUA 1N6OA 1KHTA 5FBVB 3BS4A 3GLFA 3IIKA 4DCVA 4U7DA 4BFWA 5FI0B 4Q1AA 3RRMA 1CJKC 1Z0DA 2W58A 2D62A 4PC3A 4MA4A 4TMTA 1H8HA 1GL9B 2G1KA 2EU8A 1XD2A 2FWRA 3C14C 1OXVA 2WIBA 1R8SA 3KB1A 3CZPA 1U8ZA 5CDFE 2A5YB 4Z54A 2QPTA 1S2MA 3KDSE 3KXLA 4KO8A 1QG4A 5KPJA 3TH5A 4CF7A 4TZ6A 3EC1A 3CX8A 5EXTA 2J5XA 1OPXA 2OZEA 3P27A 4WBSA 3IQWA 1KY3A 3ETLA 4JVMA 1H8EA 1M7HA 1QHNA 5DNYB 3KKQA 2ZUDA 2ZI9A 1X8LA 1E9BA 1S3GA 3DM9B 2JJ1A 4HATA 1P4SA 4AI6A 1GITA 1KOFA 2ZSFA 2B8TA 2GF9A 1II8B 4FMDB 2VIIA 1ZRHA 4QNRA 4WXRA 3ZZTA 1RJ9B 4NU0A 4JL6A 4M1SA 4DLVA 3U3JA 3A1UA 2NO7A 3GCGA 4P0TA 1E2HA 2OAQ1 3MD0A 1MV5A 5JECA 5E4FA 4GP7A 3WBKA 2J45A 3BGWA 1T6NA 2UVQA 5FPKA 5JSZB 2ZRAA 1TQ2A 4M1MA 3U2QA 5KU1A 4M1YA 1LF5A 4WVFA 3AVTA 1TMKA 2VP0A 2GILA 5BYKA 5FFMA 2PJZA 3EZ6A 4NONA 2RMKA 5IDVA 4CT5A 4DLWA 3B7GA 3GLFB 2R6CA 4HSEA 1UF9A 3GJ0A 2YNMA 3WNBA 4W5HA 5L3RA 2QY9A 4FWTA 5E7IA 1ZD1A 3RNLA 1KDTA 4HAYA 4XVRA 5J5CA 3HU1A 4LC0A 4LRWA 4PHTA 3LWNA 3QOFA 2F3TA 4KCGA 3W5IA 4DUGA 1DBSA 3LX5A 3K09A 5EXSA 3RDPA 1MKYA 2PX3A 3SBEA 1DS6A 3K9NA 4NHOA 4TT3A 2F9MA 4JLVA 4L16A 1EWQA 1MO5A 3P26A 4Q4JB 2O0KA 3DZ8A 2AFHE 2YINC 4HEJA 4PC7A 4H9GA 4C7OB 1YRBA 1ZJ6A 5EE9A 4ZI2A 3KQNA 2QROA 3RS4A 2KBFA 1E2NA 4LK2A 4A8JC 4WZBE 1Z3IX 2QMUA 2QI9C 4JLPA 1BMFD 1ZIOA 4AKGA 2Q9BA 3HU2A 3U4QB 3ADCA 1Z29A 1DELA 1NBMA 3KFXA 5JJIA 5FPYA 1SVLA 4PR0A 4A8JA 1IY0A 3FHCB 4O2RA 3PITA 4DDTA 1SKYB 4EJSC 3L8YA 1RVDA 1II8A 1UFQA 5J47A 4F4IA 2J9RA 5B30A 1Q12A 5JWRA 4B32A 1OXSC 1S1CA 4TLEA 4V02A 4DIEA 5IRCD 2V9PA 2UZ3A 3RHFA 4EFNA 1QBKC 4Q48A 2GZHA 2ORWA 4D4KA 3LA6A 3QG5A 2J3EA 2XJ9A 3AUYA 3B82A 4JLNA 1KMQA 5FPHA 2ZREA 4F93B 4UNRA 2WAXA 1NMYA 3DM5A 4JVNA 3B6EA 1W4RA 2Z83A 5C4MA 1OKKD 4OK6A 5LDDC 3EASA 3PQCA 1Q1ZA 4AYWA 2P2LA 1VYTA 2KSQA 1OFIA 3QKTA 1EFHA 3SN6A 1AGPA 1XEFA 1OXXK 4GMXA 3AKCA 1A82A 3AQ4A 4D81A 2O8FA 2OBLA 4PO1A 1LNZA 3F0TA 3DKPA 3KQKA 5SZIA 3DPUA 4C2TA 1J8YF 4QHSA 4HDCA 5LBIA 3TJZA 1N5LA 2IYTA 2WWGA 2WJHA 3AKYA 4OQNA 5JI2E 5HTKA 2XOKA 4DDUA 4EPWA 4QRHA 1Z6TA 3F3YA 1XP8A 3QXJA 1SKYE 4MRPA 3T1TA 4PAQA 5LD2C 821PA 2GAOA 4B76A 4BEBA 4QKQA 1V5WA 2WV9A 3T34A 3GLGA 5GJBA 4C0HA 2J0SA 4TL8A 4V0KA 4JSTA 2BDTA 2RGGA 2RCNA 1A4RA 3SYNA 4H1VA 3U4QA 1FTSA 4KV9A 3EZ9A 1CJMA 2WIAA 3FTQA 5B58C 4A8JB 3PIRA 1TQDA 2WMOB 4P32A 4RZUA 3TKLA 2R2AA 1M74A 1SVKA 2C9CA 3NC1C 1OB2A 1C4OA 3GLIE 1G9XA 1VDZA 2P5TB 2HLDD 3LX8A 5FL3A 1ZC3A 4PPNA 5J4HA 2J1LA 3TE6A 1R0ZA 1VCIA 3S1AB 2QP4A 5DIFA 1RRFA 1HUQA 2QE7A 3QEOA 4F7WA 1GILA 1NLFA 3O47A 4TSFD 1KI8A 1E9CA 1IAQA 1R5BA 4D25A 3L8ZA 4Q00A 2ZR7A 2NZJA 3W8RA 1Z0JA 4PO9A 1CS4C 2FPKA 4QM6A 2KWIA 4TYQA 1TQ4A 1FNMA 1MT0A 2JJ8A 4HAVA 5LB2A 4TL9A 3JZAA 4P3YA 3GEEA 3QVUA 4L5BA 1QHIA 1FL9A 2O0HA 2ZQ5A 4POAA 4IOKA 4B3XA 1UBEA 1KI9A 1M8PA 1T9HA 2Z0MA 3I62A 2GEUA 1IY2A 3QUSA 3EIHA 4IHQA 1JNYA 1KSJA 1ZBDA 1M7BA 2AD5A 3U6BA 5FOUA 1ZD9A 1OIXA 1Q1QA 2WICA 2ZJYA 4TQUS 4ZDKA 1EESA 3QE0A 4Q4HA 3LBIA 4TYNA 3MRSA 3VR1A 3O8RA 2V3CC 1XX6A 3BIFA 4YMSA 4B3DA 4B3CA 1SHZA 2LCFA 2ZS7A 4YDSA 5TMPA 1UBCA 1JB1A 2FNAA 3NBXX 4NTZA 4MRNA 3REGA 2QM7A 4HLUA 3CM0A 2ZYVX 5BW8A 2PJRA 3E5HA 4XTRA 2V7QA 3QKRB 2KB0A 3OEHA 3A36A 5JEDA 2D3WA 1Z0IA 1TTTA 1XD2B 3GJ8A 4HUTA 4FI3C 2VP2A 3V00A 4FMBB 2O8BA 1DAEA 1E94E 2QGNA 2HLDA 3NVAA 1DAGA 1KSFX 2GEVA 1COWA 2C78A 2IYXA 2JDIA 3AV0B 4M22A 4QG7A 5AJWA 5EE0A 2AWNA 3KQLA 4NCHA 2WKPA 1E1QD 2RGNA 5AUQA 2EYQA 2XOKD 1JQJC 2ZRIA 4GSYA 1XTQA 2G9NA 5CM9C 2QMEA 1S4QA 4Y0AA 1OIVA 2OT3B 1KKMA 2ZSDA 3ZVMA 1CR2A 4ZCMA 2C98A 4PFSA 3AEZA 4M1TA 1R0XA 3REFA 3SDZA 4ACAA 2IYQA 3QIAA 4B3GA 2JASA 2ZRPA 2C03A 4Q1FA 3T5DA 3CO5A 1IN5A 1SXJA 1HQYE 2HEIA 4LYHA 1K6MA 2CVFA 2BMFA 3GLIB 4PQYA 1XZPA 5L8VA 4OI0A 1KI7A 3KXIA 4ZV4A 2ZVQX 3AGPA 2RHMA 1FOEB 1W0KA 2MSEB 1XCMA 1YZNA 2ZJ5A 1YZKA 2QP9X 2GVDC 4OJQA 4OBEA 1W36C 4DSOA 2ZE7A 1HEIA 3ZVNA 1U94A 2OFWA 4LC1A 4D0GA 3QBVA 3BXZA 4MYCA 1YE8A 3OEED 4EPTA 1ZNXA 5C2JB 3RWMB 1MH1A 2CHGA 2IA5A 2WWHA 5L3QB 4NYIR 1E98A 1AGRA 1VIYA 1Z2CA 4Q02A 4ON9A 3K9GA 2GBLC 2YYZA 1HY3A 1Q3HA 1XF9A 4LHVA 421PA 2RGAA 3V4FA 2JJ1D 4DEXA 4R71A 1E0JA 3U44B 4OHWA 3PJRA 1XMVA 1NN1A 3HYTA 4IOMA 3NTUA 3TRFA 1OSNA 4JKIA 1N6IA 2IBMA 5JCZA 4B2PA 1R2QA 1XTIA 2ZJBA 3KKPA 1IQPA 1W0JD 4ASUD 5F3WB 1OH7A 5FUVA 2IHBA 4RD3A 2Q3MA 3NHAA 4XOIA 2XNSA 5TVKA 3U3RA 4Q01A 4KSCA 2BHRA 3NBFA 3NKVA 2RKOA 3AKEA 2GXSA 1EX6A 3SJZA 5GJWC 2MSCB 4NYMR 4F91B 3ZH9B 1PUIA 4ERNA 2REOA 2CE2X 3CF0A 4WZ6A 3DKVA 4RFSB 4RJLA 5C46F 2N1BA 4LSGA 1G8YA 3K9LA 4TLBA 5EXPA 4HUQB 4LDJA 4W7SA 2ZRDA 2C99A 2OM2A 4D4LA 2H18A 2ZIAA 4QBGB 4HLUC 4PAOA 3CONA 4BQSA 3MLEA 4JBYA 4URVR 4XTCS 2ATXA 2ZRGA 5FBQB 1NG1A 1N6HA 2AFIE 3CIOA 3UWKA 2NO1A 2F1JA 2B6HA 1X1SA 3QXXA 3E1SA 1ZUIA 4V0ME 4C0LA 2QG6A 3BOSA 2PLRA 2XEXA 4B2LA 2MMGA 5KTYA 2VA8A 5DGXA 2ZU0C 2J7PD 3RRZA 4DCNA 1QHHB 4A15A 1XTRA 1WF3A 1NRJB 1ZNWA 4YONB 1FQJA 2IWRA 4US2R 1MO3A 2ZRMA 1XJCA 2W6IA 1EFTA 2WJIA 4YMTA 1TAGA 5CLLA 1AQUA 4NL4H 1X6VA 2IXEA 2ODEA 3I4LA 1NIPA 1RZ3A 4ZKEA 2A5GA 2GJSA 2H8KA 4QBHA 3B1VA 2R44A 1YZTA 1RRPA 3M1IA 2ZSAA 1TUIA 1P9WA 2QQEA 4ILEA 2GBLA 2O8FB 4IEIA 4HAZA 4KITB 4HZUA 1M1YE 5DI9A 2PZFA 2FGJA 5FTLA 4PO8A 4TMWA 2QSZA 4BLTA 2QPOA 2FPMA 2W0MA 1R0WA 1FMJA 3FPAA 3RS5A 1P7CA 3QXHA 1IXRC 4MQBA 5AJZA 4A4DA 4CW7A 4BASA 4DB2A 3H84A 1DAFA 1CF4A 3P4YA 2OILA 4NCKA 4LV5B 5CB6A 3ZD6A 2F1HA 3QNUA 4A92A 1LY1A 2A9KA 3I1FA 1KJZA 2QTVB 2REBA 4MYHA 2GNOA 4Q7JB 4M21A 2BV3A 1G6HA 2J41A 3NIBA 4LPKA 3IKJA 1A7JA 5KDLA 2GKSA 2R6FA 1JI0A 4Z8XA 1WQ1R 4Q19A 5KDOA 2KBEA 1QVRA 4MRSA 3PV0A 4KFTA 2FOLA 3VHXA 3TW8B 1JJ7A 2CHVA 2NZ8A 4PC2A 4C4PA 2TMKA 2WMNB 1YU9A 1IN7A 1IONA 4RFSA 2BBOA 4KVAA 5FOXA 3RVBA 2ORIA 3C41J 4RVCA 1II9A 4K8OA 3OFNA 1GDDA 4G3XA 5F98A 2WVJA 2XTMA 4A6PA 2IYRA 4GZLA 3NDBB 1W36D 1PZNA 1UDWA 3L0IB 2W6JD 2G0NA 4TTRA 3TBKA 3ZJYA 2BMEA 3GD7A 1WA5A 2DFLA 2WPDA 4B73A 4JYBA 2H92A 3MG9A 2QTHA 1CKEA 2EFDB 2W0SA 5FL7A 1E2KA 1K5GA 4XSGA 2GJ8A 3CH4B 1NN5A 2OLKA 4A36A 2EQBA 3CRMA 1UKEA 3IBYA 1G3IA 2CL7X 4G01B 3T5GA 3X2SA 3KKMA 4YDHB 3WP0A 3AVQA 4EUNA 1G3UA 1NVVR 1T8UA 3TMKA 2J7PA 2JLSA 2E9SA 1KZ7B 3WP1B 1YR8A 1G64A 2N42A 2ZI3A 3UK6A 1KMHA 2F1RA 2ZTSA 3D31A 4A9AA 2QZ4A 2WWFA 4EJSA 1EX7A 2FU5C 5BN3A 5BYJA 4S35A 4U00A 1J8MF 2ZU6A 5KNDA 1LV7A 3DOFA 3KTAA 5TY0A 4PQFA 4R7ZA 3HWSA 1G7RA 4R2HA 3L43A 1EK0A 2Z6VA 3RS0A 2PH1A 2OFXA 4DCTA 4GNKA 3ICEA 4BPBA 2H5EA 2F9LA 4J0QA 4Q9LA 6Q21A 4AKHA 5ANRB 1E1RD 5EE3A 3V4RA 1E9EA 3PUYA 2BMDA 2WJVA 1OYYA 5AR1A 3FYHA 1F2UA 4K81B 4V03A 1UAAA 3MUFA 3R8FA 3QPVA 1Z0AA 2XGJA 3WYAA 3TAHA 4D80A 5KO2A 4XH9B 1OFTA 1RE0A 3UKDA 1CJUC 5EE1A 4E03A 1FQKA 3V9PA 3O8DA 3EZFA 1E69A 4YC7A 1A2KC 3ZQ6A 1XPOA 2XTNA 3HP1A 2P6RA 2O8EB 3IDQA 1ZM9A 4DWJA 4AK9A 5J4VA 2OO7A 3MJRA 4Q66C 1GFIA 5ELXA 3Q8XB 4CIDA 1ZM4A 5CK4A 5EP3A 4L8GA 4ACBA 3Q9LA 3TLXA 3SE0A 1W1WA 1KSGA 3A6PC 5DI3B 1VG1A 5KSPA 3RS2A 1G5RA 3HR7A 3R7WB 4TL6A 3B9QA 1NG9A 4O3MA 4JL8A 4DBLC 2R65A 5JEEA 1WBDA 2DCUA 3OE7A 2IYVA 3QG1A 4OK3A 5JS8A 2YOHA 3Q85A 1WB9A 3CH5A 3M0EA 5DO9A 4PTLA 3BJIC 2A2ZA 2X2EA 3ZVLA 3UWOA 621PA 1UPTA 4HB2A 1EFRA 1NKSA 3TK1A 1YR7A 2FSGA 5HZHA 4NDZA 2V54A 4IRUB 1NP6A 2Q6TA 3EW9A 1VYUA 2NIPA 1XXHB 3ND9A 4DUGD 3VR6A 3TVTA 4E09A 2QM8A 2QP3A 2B21A 1L4UA 1WMSA 3RC3A 1MO4A 3CRRA 4CEJB 3GEIA 2VPPA 1FUUA 2RGXA 2QTFA 4PHGA 5EXXA 3FMOB 4Q4HB 1BIFA 1E0KA 4B6FA 2WWYA 1Q21A 4OI2A 2B92A 1KK1A 2R9VA 3EA0A 3T61A 2DHRA 4C0BA 3LLUA 4IVQA 4XWKA 4GL2A 1ZD8A 4Q1BA 4XVQA 1B23P 2VP9A 3B1ZA 4OQXA 1YRAA 1W4CA 1W0JA 4NCIA 3OF5A 2V6JA 1TU4A 1P5ZB 1XDBA 2BCJQ 2W2VA 3WMGA 1TF5A 1E9RA 4UXHA 3SS8A 2CHQA 4DCUA 1AKEA 1E9FA 3DOEA 1NLZA 1W0KD 2PMKA 3VQTA 2GZAA 4C3ZA 2O8DA 2QORA 4KLZA 4KVGA 1GVNB 1CRPA 3ADKA 3BFKA 4BZQA 2J0UA 4A2QA 5FUWA 2VBCA 4LX0A 2IF2A 4GOXA 4Q4JA 1CJVC 2VP4A 4Q9IA 3R8CA 3WRYC 2FH5B 2O8EA 3OEEA 3AVPA 4JMPA 2QA5A 4OHXA 4PC6A 2D7CA 1E2QA 4IJMA 1SVSA 4RY2A 5FPTA 1X8KA 3SR0A 3K53A 1U90A 3MWJA 2GCNA 5GVSA 1S3SA 4PSKA 3RRYA 1XD8A 2XZOA 3MJHA 2C04A 3B13B 2Q3FA 4RSGA 2MSDB 3KFVA 2IXFA 2W83A 3AH8A 1Z6XA 4PPFA 3GFPA 4JS0A 1COWD 2XB4A 2HDNB 4HZIA 2B7BA 2RGEA 1XU4A 4KSBA 3R9XA 5EQTA 3ZLJA 4TLAA 3SC3A 4HYYA 3A58B 2CCJA 2WWIA 4G1UC 4U02A 4ARZB 1AA9A 4IXNA 4Q9HA 1LB1B 4LGMA 1GAJA 1GNPA 1FNNA 4US0R 1R6BX 1TNDA 4PHFA 3KJEA 2R62A 1GNQA 3SYKA 5JMTA 4V0MA 4QGGA 3A1SA 1JALA 4KI0A 3ZIAD 1DAMA 1LFDB 2FN4A 5JRJA 3EG5A 4I4LA 5KNCA 4MYUA 4G5QA 2G0TA 2C96A 4LCBA 2JIZD 2OBMA 3K0AB 4NYJQ 3TNFA 3THOA 1AS0A 2QU8A 1RKBA 2D74A 2FF7A 4ZO4A 3VAAA 1XCPA 4RKFA 3TQFA 2Q9CA 1YVDA 4FIDA 4NKRA 4OQFA 3AVYA 3SHFA 2G1JA 2V4ZA 3CPEA 3TW4A 3LNCA 5FUXA 1V43A 1NNEA 4JLJA 2OAP1 8OHMA 1QZXA 3U7GA 4AKEA 3P20A 4G5SA 2YWHA 4R2IA 3IO5A 2OESA 3B60A 5E7MA 2F43A 4NP6A 2N46A 1N5KA 2ZITA 2CBZA 4QJ5A 4B44A 2VHJA 2XNDD 5KYKA 2WSMA 4IVPA 4IKEA 4BWYA 1D9ZA 2RGDA 4PPGA 2HV8A 1H8HD 2EFGA 3WYFA 5SZJA 3SQWA 1T3LA 1AJEA 1MRSA 5BQ5A 5KSYA 3RSLA 4JBWA 4JKYA 4AURA 4TYWA 2ZS9A 3PFIA 4JZKA 1U98A 2C5LA 1LF0A 1FTNA 3KL4A 3W6NA 2OHFA 4LBZA 5J4YA 2QENA 4KYIB 3H2YA 1MO6A 2GXQA 4N3NA 3S1AA 1A1VA 3AVXA 3OHMA 4BEJA 3CF2A 4B75A 4KFSA 4FXPA 4ABYA 4V0LA 4JLBA 2IYUA 3WNCA 4RD4A 4HDOB 5KSZA 3DO6A 4DB4A 3U3OA 1GKYA 3GMTA 3AF3A 1JR6A 1NY6A 1IM2A 1P9RA 3L0SA 1AN0A 2HXYA 1GM5A 1RRCA 4PXAA 4UNQA 1CRQA 1JR3A 1VMAA 2YWEA 1NMXA 2ZJOA 1L2TA 3A4NA 5KUTA 4RCYA 1SXJE 3K0AA 1Z08A 4Q7LA 2VHQA 1KNQA 4BFZA 1XMJA 5FTMA 1FX0B 1KO7A 1WRBA 2H57A 5DLQC 1YR9A 2F7SA 5LPNA 4ZKDA 4KU4A 2WSSA 2XB2A 2F1IA 4PSVA 4GBMA 5JSZA 1KK0A 1KDOA 2AWOA 1GL7A 3SNHA 3DL0A 4EPRA 1Z2AA 5DSZA 1G19A 1SVWA 4EAQA 3B78A 3SBDA 1Q22A 3BD9A 2O5VA 2WZQA 2GK6A 1FUKA 3VR2A 4B74A 4YQFA 1SQ5A 2A30A 4UKDA 3UPUA 3C5CA 3LH5A 3OIVA 1KK2A 2GJKA 5DYGA 2O52A 4D0LB 2P65A 3GP8A 5JLJA 1VKJA 5E95A 2IUUA 3IIJA 2DYKA 3BB4A 3THYA 2O8BB 2DWPA 3L2OB 3OE7D 2ZAOA 5LD2B 1N5IA 3B1WA 4MKFA 4UXJA 1Z22A 4KLNA 4EPYA 1Z8FA 2VLIA 4I81A 2R6DA 2VP6A 1RW4A 4OL0A 4URXR 2NPIA 2FGKA 1ZM7A 5EUQB 3NEYA 2CNWD 4BUJA 1DADA 2QMHA 3CB4A 3I5XA 4MKGA 1G20E 2NTYC 1XEWY 4BFTA 1XD9A 4WW0A 2QUZA 1C1YA 1P60A 3VU9A 4LHWA 1OLOA 4IFBA 4QHTA 3VMFA 1ZIPA 2QQ0A 2QAGB 3IIMA 3VX3A 3THXB 1NVWQ 1SXJB 4FCWA 4HZUB 3MWYW 3LQRA 1VTKA 2GRJA 5SZKB 5JJKA 4V0OA 4I99A 4Z51A 1ZCBA 2BKEA 3CR8A 4OI1A 1KO1A 1IBRA 1F3OA 2BJWA 1JAHA 2DY1A 4LY6A 4BECA 1P2TA 2EWWA 3W3AA 2ZXUA 3FVQA 1D2MA 1E4YA 5A0FA 3UATA 1JECA 4QHYA 3AF1A 1E1QA 1NF3A 1XMIA 1G7TA 2ZRJA 3B8HA 3SI7A 3BFVA 4HAWA 1W2HA 5CJ2A 5A4JA 3Q5EA 2IEYA 4IOLA 2QRZA 2BJVA 3RWOA 2JLXA 1QG2A 2CXXA 4JLKA 3K0EA 5HCNA 2JATA 2NQ2C 4GP6A 4L9SA 1Q44A 1OE0A 3UG7A 1IOZA 4XJXA 5CB8A 4W9MC 3KTAB 1WXQA 2FEOA 3TR0A 3Q72A 1BYIA 1Q57A 4D26A 4BFSA 3CUEF 2ERXA 3E70C 4QXAA 3DMNA 4L15A 1FP7A 1ESMA 3H4MA 3BC1A 3CR7A 1OF1A 3K70D 4OHYA 4XVUA 2WKRA 4B33A 5GVRA 3E2IA 2BKUA 2FV8A 3NEJA 2R6AA 2ZPTX 5D3MA 2F55A 2ZI7A 3A4MA 5CYOA 5B2ZA 2IYLD 4LZZA 5H70A 1HA3A 3EA5A 2FSFA 4P4TA 1ONBA 3TSOA 2GVZC 4OKSA 2AK3A 5FUYA 1G4AE 2GEDA 2OG2A 3QENA 4GPTA 2AXPA 4MUBA 1I2DA 2JGNA 1T0JB 4V0NA 4LI0A 1SVOA 4F4JA 3LW8A 1VG8A 2ZE8A 3I32A 1CP2A 1R0YA 2DPXA 1ZM3A 1E1RA 5DE3A 4C0QC 4DVGA 2WOOA 1E0AA 4C0AC 5JJLA 3F5FA 3VHLB 4JVSB 1W46A 2VHCA 1TL7C 4D2IA 4IXMA 4DIDA 2WOJA 3X1ZA 4EQ6A 3K8YA 1N6NA 5DI3A 1GP2A 4KBFA 5L3SA 1CULC 1G16A 3PCRB 5G53C 1UBFA 4ZPXA 4OYHA 2BEKA 4UXIA 4UNNA 1D2NA 2Q9AA 3D6TB 1E99A 2Z4SA 1KO8A 4CZ2A 2IWHA 2DWOA 2G6BA 1F60A 2GWHA 4PZYA 3SJCA 2C95A 3X1XA 4F92B 1CBUA 2A5JA 1FPMA 2OCYC 1F5NA 1U9IC 2ZRCA 3EXAA 3PR1A 4LBWA 5CYPA 4GOJA 5JI3E 2FPLA 1CJTC 4IDPA 5JFGA 2XTZA 1E2GA 1HV8A 1N2CE 2BEJA 4FMCF 4BZXA 1YZGA 2VSFA 2YV5A 2FSHA 3SU8A 1ZAKA 2JJ2D 4A0RA 2QPAA 1S96A 1F2TA 2UKDA 3G5UA 2OXCA 2RB4A 1W7AA 4K46A 4X8OA 2RGCA 4KAXA 1AQYA 1UEJA 1YQTA 2VSOA 5J40A 1UEIA 3MCAA 1P9NA 2NGRA 2P5SA 2ORVA 3FKSD 2C9OA 3U7HB 3I8XA 1GL6A 4C2UA 1C9KA 1YZQA 1PLKA 3P1JA 4L9WA 1E2PA 4Z1MD 2VO1A 1E2DA 2ANCA 1Z06A 4JT4A 4MRVA 3K0FA 2ZE5A 4LV8B 2XXAB 1E4VA 2IL1A 4URZR 3OESA 2NPFA 1QHYA 4P33A 5H1YA 4AC9A 1Z28A 1S1MA 2BWJA 1X8JA 1UJ2A 3AM1A 4MDFA 4Q1EA 4BFUA 4M9QA 5GJCA 3AB3A 3THWB 1F48A 3QJYA 2F6RA 4RZXA 2GCOB 2C9YA 4A0HA 1N6PA 2UZIR 3OFND 1IHUA 1T3HA 4PPQA 4YMWA 3DEFA 2YWGA 1S0UA 3VR5A 3GLIA 3KKNA 4IW3B 4A82A 3RRNA 3T1QA 1JJVA 2A5DA 5G41A 1VG9B 2OV2A 1JAIA 3KJGA 4JT2A 3VNUA 4DJTA 1R7RA 3BH6A 1P3JA 3EIQA 2YOGA 1XB2A 5L3SB 1EGAA 5JBQA 4NYJR 3MSXA 2QL6A 1TU3A 2NO6A 3A4LA 1JXMA 4Q4AB 2G88A 2OXRA 5G3ZA 4IVRA 4EIWA 4AYXA 4I1UA 1ESNA 3TUIC 4B2IA 1N6RA 4US1R 1KJYA 5HE8A 1OYWA 3B5JA 1KI1A 2O0JA 4QL3A 4ARZA 2BMJA 1OB5A 2ZI6A 3NHBA 4GT1A 4JLOA 4LHZA 4XWAA 3PUWA 1P72A 1R10A 3PEVA 4Q5IA 4URUR 3WY9A 1BOFA 1W48A 3DMDA 4M1OA 1LS1A 3VFDA 3N2IA 2WJJA 3CNOA 3P32A 521PA 3U3MA 2V8OA 4Q1DA 4AIIA 1GWNA 2EFCB 5AUOB 1GZSA 1KO4A 2NOAA 4Q03A 3BB3A 3U7EB 2O8DB 1SVIA 4DSTA 3GLFE 1T3SA 2IX3A 3HDTA 2JDID 2X8AA 4TT3D 5C18A 3JZMA 1N0VC 2VHTA 2HJVA 3VX4A 2D7DA 4QJ4A 3EZ2A 3X1DA 1ZP6A 4QGHA 4QFMA 2GK7A 3B1XA 3KUCA 2QMOA 2CLDX 1E9SA 4HUQA 4LWZA 4LYAA 4PZZA 2ODWA 2XZLA 4C7OA 2J0VA 2AN9A 4PZLA 3LBHA 4DT1A 3FOZA 3BBPA 3ZQJA 1VCOA 3UMRA 1ZUNB 2D4HA 4LPSA 2FFBA 2CCGA 3BRWD 1IN6A 3U7FB 2IHYA 2X1VA 1XBTA 1XJQA 1Z0KA 4HLCA 2P6UA 3GLGE 1S8FA 2AL7A 5GADl 4HLQB 3ZZUA 4MGIR 4C30A 4NMMA 3U60B 2REXB 3C7KA 4ZCLA 4RD6A 4LV6A 1BO6A 2RH5A 1N0WA 4Q4AA 3X1YA 1JPNA 1VHTA 3PENA 4C0SA 1EFUA 3GEHA 2Q21A 4I1VA 1OW3B 4FMCB 2QBYA 2V7QD 2QEQA 3CNLA 4LJ6A 5D3QA 3K0CA 3RABA 1PV4A 1SKQA 1K5DA 2ODNA 4LOAA 1U0HC 2CEAA 2OEPA 4HB0A 2GXAA 1Z0FA 1J7KA 1T5IA 4NZYA 2HT6A 2CE7A 3MGCA 2PEYA 3QPWA 1YZLA 5FTJA 2R6GA 2FE4A 1X1RA 4X8LA 1GIAA 3B9PA 1X86B 3OZXA 5K8IA 3D3QA 5KPDA 2OLJA 1D8TA 5EP2A 3T06B 4Q1CA 1N25A 1G8GA 4M1KA 3WXMA 2JLYA 1PLLA 2G77B 2QAJA 2VP5A 2VH5R 3QQ5A 2ZJAA 3A1VA 4NCNA 3OAAD 2BC9A 3AGQA 1ZNYA 3EPHA 4YXWD 1D5CA 2X77A 2JEOA 4Q7KA 4JIMA 2ODBA 1UADA 2VHUA 2X19A 2YVUA 1F6BA 3QXCA 4E07A 1E2FA 5DISB 5H68A 3UXMA 3UANA 1AK2A 2HXSA 1KDRA 4PX9A 1D2EA 2XSZD 1P75A 1JPJA 1U9IA 4W5JA 1AM4D 1G4UR 3NH6A 3CX7A 4KHZA 1QHSA 3ZYCA 1E0SA 4KBGA 3MFYA 4OK5A 1JR3D 1E2MA 2FEMA 3IBGA 1KGDA 4L4UA 2PBRA 3PEUA 3QF4A 1M34E 2GXUA 4UNSA 3FWYA 4MDEA 3FHTA 2ZROA 1P6XA 4LJ7A 2DFKB 4A2WA 2I1QA 5TDHA 3OIWA 1JR3E 4WA7A 1NL3A 2ZEJA 4JLDA 3ECCA 4RFVA 2G3YA 1J2JA 2EYUA 1II0A 1T8TA 1W2GA 3A37A 1H65A 1O3YA 3WHLA 1P61B 4XD7A 4NPHA 2BM1A 4TMZA 1Z6YA 1G3RA 4FD2A 1N6LA 2W2TA 4I1SA 3TUJC 5FTKA 4GZMA 5G40A 5KDDA 1VPLA 3BORA 1S9HA 2VYFA 2ZJ2A 4KFUA 2C2HA 2IYSA 1TPZA 2QAGA 2HYDA 1HQCA 4LJ5A 1UDXA 3BERA 4BFVA 4CEHA 1T91A 4EPXA 3GQBA 2FMXA 1OH6A 1WP9A 3LO5A 1TADA 3CW2A 4OHVA 3HPQA 3NH9A 1SZPA 3CZQA 4M8NE 3WMEA 5P21A 4EJSB 5BN4A 2OFOA 1VCNA 3KB2A 4BLSA 2IUTA 5JZVA 1OKKA 1G1MA 2CNWA 1Q0UA 3CF6R 5F2EA 3T15A 1WE2A 3I92A 3KKOA 1XNJA 1E96A 1KO5A 4TZ0A 1KSHA 3IGFA 3SQXA 3RANA 5TXGA 3R9IA 2BIFA 4TTPA 2GETA 5KOYA 1QF9A 4B34A 2E1RA 1G3MA 3GLHB 2XZPA 5J4LA 2CK3D 1KI4A 2C77A 1HT2E 1NVXQ 2L0XA 4Y0VA 1VIAA 1U8YA 2IXGA 3CRW1 4Q9JA 4LJ4A 1MOZA 4OHZA 5JS7A 4HAUA 3AVWA 1MR3F 2VF8A 1P73A 4YLGA 3ZS9A 1PVOA 4A0FA 3VTKA 1KI6B 3IHWA 3LQQA 4JJZA 1W49A 3K0SA 4MKIA 3G0HA 4MRRA 4D4JA 1G8HA 2CDNA 1NJGA 3IPXA 3Q7QA 4NYMQ 3DZDA 5EP1A 1SGWA 3FHOA 1LW7A 1IJEA 3EPJA 3ZDQA 2OBNA 4IOJA 1HH4A 1XFAA 3G82C 3LDAA 1KTVA 4XSHA 3WBJA 1LS6A 2P3SA 2QT1A 3W5JA 1EFRD 4JLMA 1PLJA 3IHLA 1A5TA 5EZ6B 1QHXA 5AJVB 1NN0A 5JCPA 1CTQA 3NXSA 2NO0A 2I3BA 4Q7MB 3EPKA 1Z63A 3ZS8A 2BCGY 5GJVC 2ZYTX 1M2OB 5DH9A 2B8WA 1X3SA 1P62B 4P31A 3IEUA 1KI2A 2XNDA 2KE5A 4QGAA 3K09C 1E2IA 2FX3A 5IK2A 1RYHA 1W44A 3B1YA 4RD1A 3X1WA 3O8BA 2EVWX 1GTVA 2D2EA 4B48A 4RZ2A 3LRPA 4CEJA 3BH7A 1G7SA 3PUZA 5AUNB 3HJNA 1HTWA 4M9ZA 2JLUA 4BLOA 1VHLA 4G5GA 2IW3A 1U81A 2PMDA 3AP2A 4NBSA 3RS3A 1O87A 4OJKA 1XMSA 1BMFA 1J90A 1N3BA 4M9SA 2AHOA 1FZQA 2OE2A 3ASZA 1DARA 2DR3A 4CEHB 4LBVA 1RRGA 2ZRNA 2P67A 121PA 5HPYB 1P2SA 1US8A 5FBWB 2PT5A 4TMKA 2EFHB 2HCBA 1XXHA 2OUKA 2VEDA 1TEVA 2A7QA 3SEAA 2VL7A 2W00A 1ZYUA 1AS3A 2XJ4A 2R8RA 3LY5A 3CBQA 1Z83A 2ZI5A 1SULA 4DLRA 3RC8A 1WCV1 2OCPA 2V55B 3VKGA 1DOAA 3A8TA 1GRNA 5LB4A 3OEHD 2GF0A 3ASYA 4M1WA 1H8ED 2IK8A 3Q3JB 1SXJC 4TYYA 4GMDA 2JA1A 1IY1A 1QRAA 2PCJA 3U3KA 4EPVA 4QNMA 3IQXA 1KJWA 2QGZA 3A1TA 4LJ9A 4LJAA 4CT4B 1L4YA 4PSAA 3QI2A 4F38A 2VRWA 2WJYA 1T4GA 3CKLA 5G3YA 3D8BA 3FFBA 2IF0A 1Y3AA 3B2EA 3LW7A 3SOPA 2CJWA 2WSSD 1YKSA 3TIFA 1ELOA 3AVUA 2FFHA 4I1OA 4IDOA 4JVLA 4EFMA 1I4LD 3C15C 3C5HA 4AY2A 5HKKD 2Y8EA 5BN5A 1CR1A 3FKQA 1ZW6A 5K8LA 4D4MA 3DHWC 4URYR 2ZAMA 3SYLA 4B43A 2ZSEA 4B6EA 4Q9KA 3U61B 3EWSA 5JWHA 4ZDJA 1Q20A 2FG5A 3O8CA 1DEKA 2WBLC 2YJTD 3K0CC 2ZANA 4P4UA 3NBZC 5HCIA 2W2XA 4B3FX 4YMVA 2JAQA 3SHWA 3QY0A 1XTKA 3QF7A 1CLUA 2JLRA 5H8WA 1I2MA 3LVRE 1RJ9A 4G5OA 4DLTA 2V1XA 5IT5A 5FBRB 1ZM2A 4TMVA 1F2TB 2ZUCA 1M6NA 3EARA 3KUDA 4PQRA 4F4CA 1HT1E 2WKQA 3LXXA 5FOWA 2VQSA 5KNBA 3GJ5A 5EUMA 3T1VA 2QNRA 2FFAA 3MMPA 4DLUA 4HI0E 5DHAA 4LBYA 5FOSA 2GCPA 1D9XA 1DO0A 1RIFA 1TX4B 1Z6GA 4XIGS 2P6NA 4FINA 4ZDIA 2H7VA 5FR2A 2GZDA 4DSNA 1I4DD 1UKZA 4BGDA 1T0HB 4B35A 4ZDWA 3GJ3A 4R98A 3K0FB 1GOTA 1KI3A 5AWFC 1MABA 4CYMA 3ZIAA 2DWQA 1OXUA 3KX2A 1IN8A 2JLZA 4DKXA 3EC2A 1BKDR 1FFHA 3L0OA 1P2UA 1NVVQ 4NE2A 1RPZA 2JIZA 1G3QA 5CIQA 1TF7A 3VR3A 1CEEA 1D6JA 3I3SR 3K9HA 4PC1A 3NG1A 4IDQA 1IN4A 4FCTA 2CJWB 4AG5A 4BZPA 2PZEA 4BLRA 2GA8A 3HPRA 1GKUB 5C1BA 2CLSA 1UKYA 2P0EA 4Q4LA 2AK2A 2QN6A 3GJ7A 5FI1B 3QBTA 2PCLA 2F43B 4IDHA 3RSOA 3C4JA 2QSYA 2HCJB 1HURA 3SJBA 5JWOA 2ZI4A 1GNRA 2ZVPX 1GUAA 2EWVA 1AZTA 3R7WA 3QEJA 3OIUA 3W9YA 4QC2A 4U5XA 1R5NA 4EFLA 1FP6A 3UMFA 2HYIC 1Z5ZA 1Q1EA 2KI5A 2IS4A 3L0PA 2ANBA 4NH0A 3IPYA 4B71A 3AVOA 1DTSA 3EWAA 3HYRA 2BBSA 5FH9A 1E2LA 4JL5A 4FW9A 5HKKA 1WDTA 1NY5A 1DAHA 2VTKA 3BE4A 3RLFA 4JSYA 2LKDA 3DVLA 3N2EA 3FMFA 4Q47A 1DPFA 1FW6A 2CK3A 2GHIA 2AD1A 3AKDA 1ANKA 4QM7A 1YZUA 3AF2A 1ZMXA 5FTNA 3PVSA 2XSZA 3JVUA 1SXJD 3UIEA 3W3ZB 2HF8A 2PZGA 4BFXA 4ASUA 1HYQA 2DB3A 3LD9A 1KKLA 3FE2A 4HB3A 4GOKA 4EKDA 4XWOA 5J4KA 4CGZA 1G41A 1E3MA 4UNPA 2VF7A 4BRUA 1TF2A 3BFXA 2X2FA 4S2EA 2IC5A 4DEYA 3IUYA 2D06A 1KI6A 2ONJA 3SFVA 5AJYA 4KFRA 4TTQA 1ZU4A 4HLDA 5K8UA 1LTQA 3CPJB 1P2VA 4DCSA 2JLVA 4G0NA 5FOTA 2WHXA 1XTSA 2IEZA 2Q3HA 1YHNA 2QE7D 3CWZA 3NBYC 4O25A 2YWFA 3P4XA 4A0GA 4E22A 3CX6A 3WNDA 1OHHD 4DLYA 4LHXA 3GLGB 2IS6A 1IXZA 1G6OA 4OI4A 1KYIA 1N5JA 1OFUX 4FMDF 4LJYA 4B3BA 3H1TA 3UG6A 4ITRC 4HB4A 3LXRA 5SZHB 2FA9A 2GDJA 2WTUA 2KJQA 2EFEB 1U2RA 4TLCA 1XZQA 2ASEA 3TR5A 4JJKA 2LWIA 1KK3A 2MMCA 4Z8YA 2ATVA 3FMIA 5IK2D 2NMVA 1OV4A 1ZC4A 2GESA 4FN5A 4QOSA 4MGYR 5TB5A 4WZAE 3AUXA 4D0NA 3W90A 3RYTC 2OCBA 3OAAA 4A2PA 1HE8B 2EW1A 4JYCA 3K70B 5DYIA 1OXTA 2AKAB 3HR8A 1NVUQ 2ZM5A 3C16C 4OQMA 3QF4B 1PUJA 4KODA 2WWXA 1VYVA 2BBTA 2IT1A 3ZGXA 3KQHA 4MGZR 5IF9A 2J0QA 4AD8A 3I72A 5CDFA 2AKYA 1ZCAA 1UBGA 4URWR 5K8TA 3PXGA 3BH0A 1W47A 3PUXA 3T12A 5E3HA 1GRRA 2BBWA 2ZRFA 2BVNA 2FJUA 2GCOA 4E5UA 3THXA 5CJPA 4MUAA 4QJ3A 4KJZA 1DE0A 3FDIA 4N0DA 5FBLB 5AJXA 4M4SA 4PAMA 5B57C 2QRNA 1BS1A 1US8B 2CL0X 2LKCA 2JLWA 2CVHA 1EXMA 221PA 4GFDA 1Q3TA 1ZU5A 2SHKA 1G291 2Q0HA 3H86A 5B64A 1WBBA 5AK0A 4P4SA 2A5FA 3PUVA 4QGFA 5FPSA 3VNVA 3I8SA 3H0KA 3LFUA 4TSFA 1A2BA 1VECA 1Z6AA 2C8VA 2DFNA 3LLMA 4BLPA 4O2LA 3NWJA 4EDHA 2CCKA 3FGNA 1AIPA 1OIWA 2OCAA 1JEEA 1VCMA 4BRWA 2ZR0A 3WHKA 4ESVA 1OJLA 4NYIQ 3KZ1E 1L7VC 1YJ5A 3JVVA 1KAGA 4GDFA 3QKRA 4AWXA 1LVGA 1Y63A 3EPLA 4H1UA 4MKHA 5HR5A 3IEVA 1G17A 2HT1A 1QHGA 3ND8A 4JLAA 4HDQB 1OT3A 1VG0B 2Z4RA 3CWQA 1DVRA 3BAFA 5F9HA 1S9DA 4D6PA 1AZSC 2J87A 3ZD7A 5D3MB 1SHKA 3DDCA 3ZVRA 2HJGA 3U6KA 3MWLA 4DDWA 1HE1C 3GFOA 3NC0C 1XRJA 3GJXC 2WAYA 4FCVA 1AS2A 2WWWA 3Q7PA 1RC8A 2GJ9A 4W5WA 3ZZ0A 2J59A 1E9DA 1EWRA 4HAXA 1EFCA 4CEIA 1E79A 5CLQA 3GPLA 1KZGB 4AYTA 1M7GA 2YHSA 1R5OA 2ZRLA 4DC9A 3WRXC 5FL7D 1JBKA 2ZETA 2V1UA 3KJIA 3W6OA 3EX7C 2BOVA 3HU3A 3SZRA 3IILA 2CMKA 1KY2A 3K1JA 3TVDA 3GJ4A 3NDPA 1E6CA 1I4TD 3TGPA 5JHHB 4DSUA 2I1VB 3EIEA 3C8UA 3CRQA 2J7KA 1KMHB 2ZJ8A 4IFEA 1NKTA 4C0JA 721PA 3QKSB 4RD2A 3SFZA 3VKHA 2ECKA 4LYFA 2A78A 2GAAA 2IYYA 3T35A 1XPUA 2Z5FA 2ERYA 5IHPA 1CR0A 3EZ7A
chains in the Genus database with same CATH superfamily
2CL6X 5M04A 3QUTA 1HFKA 4RSRA 2W6JA 5JHGB 2AX3A 2ZBFA 1Q2UA 1UOQA 2H0AA 4A16A 2WFLA 3V5NA 3I34X 4OUDA 4B4OA 4B17A 1T5LA 4MB2A 5TRTA 4CVNA 3VO1A 2C5HA 2IU0A 3I73A 3ZNOA 3O82A 2BD0A 1N2XA 1P91A 2FX5A 3OSUA 4UUPA 3TB6A 4JV5B 2A92A 1DJQA 5T4EA 4M0KA 4N4AA 2J46A 3F6YA 3QJGA 1KEEA 2RAPA 1QE0A 1I32A 3LAWA 3F8TA 3ICQB 4QBIA 2HJHA 3HYSA 1KJ9A 2OQVA 1IJFA 3AEUA 3PEWA 4RHTA 4YMHA 2XGMA 4PLVA 3HGMA 3OZGA 1CXZA 2NO4A 4NLLA 4QAJA 5BOSB 2QD4A 2YASA 3N0VA 1BYUA 1EFKA 2ZBDA 4I1RA 5KIAA 3DE1X 3U09A 4UCXA 4Q21A 3WIBA 1UK9A 4YP1A 2FTKE 3U1BA 2YKGA 2OZLB 1RXIA 1J97A 4QTUB 4N49A 1I2CA 1BXGA 1V3UA 1W4BA 3H1PA 4X66B 4TZTA 4A6XA 4EA7A 1PJZA 2O14A 3JSXA 3CPHA 3KYIB 2X41A 5ITVA 1R0KA 2RGBA 3UMSA 5H4GA 1R8XA 2EJCA 3SJAA 1GFWA 5CCXA 1XTUA 2Q07A 4GDMA 3O1JC 3J81k 2H7YA 3JU3A 2W37A 4BU1A 1JKFA 2I4IA 2HLPA 3MBOA 3N59A 4XB2A 1JWBB 4ZIRB 4ZMBA 2XXAA 2XLBA 4I9UA 2IOYA 1EG7A 1HLDA 4GSKA 4YJ3A 3FAZA 1SKMA 4KOAA 4G41A 3VSEA 1GPH1 1MFZA 2EKLA 1GPKA 2JGDA 3G2QA 1N75A 1N2BA 3EXIB 3T8YA 2NPOA 4Y1GA 1BQEA 1T26A 4MPDA 4O6VA 3TQIA 3U37A 4AG6A 1O8BA 1IXSB 1XCGB 3GLTA 1RXWA 1GDTA 1QFXA 2PE5A 2F00A 1KRXA 3F97A 4S0XA 1GPWB 4D6YA 3W6PA 1OBOA 1TUEA 2HRZA 3DC7A 4J91A 1SD2A 4D96A 5FR1A 2BFBB 1YR2A 3DVAA 4JOSA 4WY5A 1L7OA 5H81A 4RD0A 1XMQB 2YZ2A 2OCGA 4F45A 1PV1A 3PSHA 3ZQUA 3AF4A 4X41A 3STVA 5C8YA 3WNZA 1E2EA 2VAWA 1C7EA 1WV1A 2DKNA 1F17A 1NA5A 3AZQA 3JYNA 1E6LA 1BWSA 1GNSA 4LRYA 4Z1MA 4EY7A 1GR0A 5DN6A 1QPGA 2EDCA 3EVAA 5K3DA 4IIJA 1KJNA 4G56A 2QM3A 2WHYA 3ZBPA 1SBNE 2XUDA 1J21A 1NN3A 2PZJA 3KCQA 3WIDA 3S5UA 3PXUA 3B2QA 5JVDA 1ODLA 2OY0A 2ZRBA 3TGWA 4CXMA 4EB0A 2WAOA 3TB4A 4EA8A 1BN7A 3NTRA 5FEUA 4WXPA 4JCCA 3EBPA 4X8MA 2B1GA 2DBYA 2IPMA 2D8MA 2PX0A 1T8WA 1USWA 3NJ8A 2AHRA 4PFQA 2LXNA 5E7JA 3M8KA 2LIPA 1OHHA 1CT9A 4JJ6A 5CVUA 5EGNA 2VHXA 4DDVA 3ADDA 2VWPA 3RS7A 1A7UA 2CLCX 2E87A 1O6CA 5AFSA 2GBCA 2C9DA 3H5OA 1LWNA 1IK6A 3KJZA 1DEHA 1WZCA 3T1HB 3CNNA 1CUXA 1Z07A 5JZOA 4FHEA 5L3QA 3RAEC 4QO7A 3WSWA 3OOSA 2DQYA 4OM7A 5G2OA 1GLVA 3O3MB 4FYJA 5HJ2A 1E2JA 2HF7A 3FKSA 4WAUA 1TTHA 5TPWA 4E7PA 3L6CA 1KMMA 4RA9B 2YBDA 3HZRA 3DS8A 4E1AA 3ITKA 1ZSNA 1IWBB 1DAIA 1JDPA 5BY2A 3CNQS 2HF9A 3EYWA 3UJ9A 3WC4A 1J1IA 3E2MA 2JVIA 3W7VA 5LUBA 2V0GA 1RM4A 4UCWA 1CY2A 3G2PA 3WNVA 1JQLB 4L57A 5JOQA 1UBHS 5DXFA 3K92A 3TM4A 1R4ZA 3NIWA 3RG8A 3VGJA 2WJ4A 1KFCB 3DT8A 3SEZA 3LMKA 4QDOA 4HWGA 5C1OA 3BKXA 1URPA 4J2TA 5KYYA 3U56A 3AY7A 3ZDRA 3I58A 4Q3NA 5KHOC 1B0UA 4HNVA 5KVSA 5GP1A 2B7CA 4IDDA 1DSSG 3A1WA 4M8LA 4HRYA 4GU5A 2R87A 5EZ5A 2XB6A 5ALXA 4DANA 3FUXA 2QW8A 1U7XA 4ENTA 1V4BA 3PG5A 3F6EX 4B80A 2QTZA 1ZH2A 3UT0A 1XPRA 4PEVA 3FWZA 4M0LA 1BDBA 5CFLA 1MHPA 1NBHA 4CMHA 4FNGA 1IMJA 1KL7A 4U39A 4YJ3B 4D4HA 1KY4A 3Q98A 5BNFA 2C94A 4J7AA 4EQ6B 2N0SA 3DKIA 3KQUA 1GV0A 4JUFA 1TZCA 1RFLA 2IEDA 5JRZA 1DKQA 3D81A 4DXAA 1A69A 4ZAVA 1E63A 2IUSA 1ZGJA 1Z12A 2QRUA 3ELWA 3VA7A 1SCAA 3STYA 1R6UA 3OJWA 4TV8A 3AHEA 1NW7A 4AMYA 1HMYA 2HTEA 4Z4GA 1YAHA 2Q0XA 3ZHUA 3W06A 4LUCA 4N5LA 2K7FA 1NW4A 2HV9A 3IJEB 2QBYB 1G8FA 4XDZA 4MV4A 2VT7A 3MWKA 4MQMA 1XEXA 2GDZA 2JD1A 4JA0A 5DM1A 1J25A 3EFEA 3KLPX 1JIUA 2FFQA 4GQBA 3OT1A 3W7AA 2PG3A 4PXSA 3AVVA 2G71A 3GFTA 2Y2VA 3KB6A 4KXWA 4AS2A 4IJUA 4DV7B 5EMNA 3HJGA 3IC5A 1G21E 2GSDA 2NN3C 1TUGA 4YDQA 1YF3A 4EZBA 1EAYA 4KQWA 2H9YA 3ZHXA 4COKA 5I7HA 2WAAA 3AUFA 1BDHA 1BD3A 3BDVA 3LSTA 4RPGA 3T0GA 1F2DA 3GAAA 1ZINA 1GG2A 3CINA 3QPCA 4KJXA 2ONCA 1G8PA 5KSOA 2WSLA 5CM2Z 3TRJA 4WY2A 5ECDA 1RYDA 3WGJA 4CEIB 4CDGA 5F76A 4LJSA 1WVGA 3OPQA 1T8YA 3GLFA 1I3LA 2X9NA 1RADA 4LE1A 2K2QB 4RA9A 4PM4A 4RS3A 3UOGA 4DCVA 1U31A 4O4JB 5BMVB 4V1CA 4BFWA 5FI0B 5FNZA 4J0EA 1CJKC 3CIFA 1YBFA 3IHKA 2W58A 4PC3A 4ZTUB 3IALA 4O2AB 3A9SA 4XRRA 4MMXB 4CDNA 3WLTA 1QONA 1XD2A 1RZUA 2BKVA 2ODAA 1TDJA 2ZB4A 3EDCA 4Z3KA 2P41A 3DNMA 3AEKA 2QTGA 1R8SA 1EWKA 2B34A 3VOBA 5CDFE 2A5YB 1UBOS 3PEFA 3DR3A 1WHSB 4QPZA 3DCYA 3KDSE 1T8PA 3FOEC 2M1XA 1CUBA 1NI4B 3C6ZA 1M6YA 4TUYA 3EC1A 2JAHA 4UOZA 5HRAA 1SCBA 4BN4A 3MW8A 1KZYC 3HGTA 2N1MA 2QHXA 3BIJA 3DNPA 3A04A 4BX0A 5C53B 3A9RA 1JEOA 1LJLA 1VL6A 2FW0A 2G8LA 1YE5A 2ISQA 3PRHA 3FKJA 4GUAA 3C7DB 4K1LA 5CT5A 2HWYA 4ZMRA 1W25A 3PF8A 4E14A 3UJDA 2AZTA 3M4NA 5KYGA 1BXKA 3S6JA 1JKJB 1X8LA 3CZ4A 1S3GA 5HRUA 3DM9B 1CB7A 1GITA 4DLNA 2B8TA 4WNCA 5E1OA 1O6ZA 2AFHB 2GF9A 4RTKA 1N77A 4QT4A 2NVBA 2ZWOA 4WT7A 2VIIA 1ZRHA 3PQ4A 2O8NA 5AXDA 3BJEA 4RWZA 4ZQBA 4DLVA 3HJTA 1PSDA 3A1UA 5K1ZA 4ARBA 4X3PA 3A6DA 3TAXA 4P0TA 3PJGA 3OP1A 3EZLA 3RD5A 3TRIA 1YFJA 1NDQA 2CXHA 3ID6C 1O03A 1T6NA 2FMFA 3BGWA 3MCVA 2BH2A 5FPKA 3G6KA 1TQ2A 5KU1A 2ZT6A 2FN3A 4OLJA 1POWA 3CG0A 1LF5A 4WVFA 5DHQA 1PHPA 1TMKA 2JHCA 4UU1A 4KR6A 2F90A 1Q92A 2RMKA 2Q2VA 4CT5A 1EDOA 3B7GA 2V59A 3QX8A 4XIYA 1M54A 1JV2B 2IPOA 3A0UA 3TKYA 5AESA 3OFJA 1UF9A 3DO5A 4O2BA 2W2LD 2PKQP 5E7IA 4G4GA 4QUHA 3RNLA 1NUTA 2Z2IA 3RUFA 3QVMA 2VOEA 1LTKA 4LC0A 1J0BA 5GM2A 1CP3A 4RDCA 3EVGA 1SMKA 5KJFA 4C4XA 1NR1A 3DGEC 5HSGA 4QPNA 2HADA 1WUHS 4PBTA 1MTZA 1SOWA 4NHOA 1ZIXA 4L16A 5EJFA 4XCXA 3DV9A 5DBHX 3FDFA 3PWKA 2SKDA 2XI4A 4MQ5A 3EQ8A 2IRWA 4Q4JB 5T4BA 4KB5A 3V8NA 4ARVA 4IDCA 4F3TA 3DZ8A 3GPCA 3HLTA 4QPJC 5K51A 1T1SA 4H9GA 3D43A 5EE9A 2OOKA 4GP9A 1B0PA 4A8JC 4BMPB 4JLPA 3H8WA 4UTXA 4XPIA 1ZIOA 1A2QA 2G80A 5ERYA 1HL7A 1TMGE 5FPYA 1SVLA 3BMQB 5KAPA 1IY0A 3BE5A 1DRVA 3FHCB 3UEOA 5K4HA 3V8VA 3E22A 1U3GA 4W1QA 2BI4A 1VJRA 4OFWA 1UFQA 3L92A 1QWSA 3TMAA 1QYCA 2Q2NA 1VBNA 1Q12A 2D1SA 2CV2A 4K0RA 1OXSC 2CLHB 3ISVA 2YFKA 1RKVA 1VBKA 4I4TB 4Q48A 1WB5A 2WE7A 4JZYA 3AUYA 2XJ9A 3B82A 2WNHA 5FPHA 1KMQA 4CCYB 3DM5A 5KQGA 2Z83A 1H6AA 3BQMB 4X6YA 2OVBA 2AMVA 3E9RA 4YRNA 5C4MA 4FC6A 3AQIA 1WD7A 1K3FA 4X00A 5LDDC 1E18A 4JGIA 4JGGA 3H2ZA 2P2LA 4Y2HA 1U02A 2JRCA 3B6IA 4PF1A 5MF6A 1OFIA 2FP4B 1V7QA 1EFHA 4M37A 3DAOA 2P5UA 2YVKA 3R6LA 2XCQA 3QTTA 2CJFA 1Z35A 4NS1A 1FFAA 1JHUA 1A82A 3AQ4A 1X13A 2XGOA 4K87A 5EPOA 1M66A 3ROFA 1E4OA 5CYFA 4B0OA 1W88B 1E1LA 3ROEA 4AMVA 1J8YF 4QHSA 2I6QA 4HDCA 1N5LA 1AZWA 4ND4A 3OLQA 2VDVE 1GTRA 1J4AA 1F20A 4YWHA 4EB8A 1QTIA 5HTKA 3SF0A 4AJLA 3COVA 5NULA 6YASA 1GU7A 4MEJA 4QRHA 4EPWA 4XX1A 1C7FA 1XP8A 2RONA 1SKYE 2YW9A 3VO9A 2ONZA 5A71A 1M5RA 3U44B 1CY0A 1XSEA 2ZIFA 1P5FA 3HDHA 4QKQA 4R6WA 5BV8A 4A10A 3WOVA 2J0SA 4TL8A 4O2BF 4JBLA 4V0KA 3VV2A 2P62A 3EJ6A 5HNKA 2H4XA 2YJ4A 4G9EA 3SYNA 4FHZA 4OO3A 1OX4A 1CJMA 3K2BA 4YAWA 3SE7A 4R51A 3MN1A 4A8JB 3KIPA 3PIRA 2WMOB 4A2CA 1YRLA 1CRWG 1SVKA 4MW5A 3V3TA 4ZJYA 3GC6A 1BE0A 1G9XA 2WV7A 3LX8A 2HLDD 4YT8A 2HHAA 1B6TA 1Q77A 3ZDXB 2XH8A 4TV8F 1J56A 3TE6A 1UMCA 1DTWB 2I80A 2OV8A 3BWBA 3I5MA 2H3EA 2V7PA 1C0EA 3OIFA 2QE7A 3GRZA 4MR7B 4F7WA 3AF6A 3O47A 3R5JA 3LX6A 3DC2A 4V0RA 5FO0A 3DF9A 3PC7A 4XJVA 4YMIA 5P8WA 4EECA 4Q00A 5HS4A 1ECCA 1IEWA 3RUEA 4PO9A 2CD9A 1CS4C 1HDXA 4RESA 4QM6A 2HJWA 1B16A 3G5LA 3EWNA 4YT5A 1GTL1 3E9QA 2P78A 3QVGB 1OYOA 1P33A 4HAVA 4CKBB 4TL9A 3JZAA 3OPNA 1C3XA 2PK3A 3C3DA 3AY0A 3NBMA 3QVUA 4W99A 3WHPA 4C7KA 5AM3A 3E7DA 2Y1LA 4FZ5A 5FO1A 4LRXA 1WKVA 3SXPA 1R8YA 1AKVA 3FOFC 1U2SA 1FNDA 3OE1A 4ND8A 1JVNA 3BXXA 3TSAA 3HRHA 1E5LA 4HEA1 5D7BA 3OFVA 2GEUA 4EG4A 4IHQA 1R6AA 2AD5A 3KT8A 1M7BA 3U6BA 1ZD9A 2XE4A 3EPRA 2G70A 3LQ4A 3ZV3A 1A7KA 3BL6A 2II6A 2WICA 1I2BA 1EBFA 2J32A 3BHJA 1EE9A 1NSYA 1OAKA 3QE0A 1T0PA 3AFOA 3LBIA 3D6AA 4Q4HA 4F2PA 4TYNA 4ZAWA 3WSTA 1P0CA 4IIBA 3EQ7A 1UZUA 4YMSA 3AFMA 1RI5A 4RKYA 1Y8RA 5E9QA 2C4HA 2LCFA 2ZS7A 2P2YA 2WWRA 3AYZB 3SSAA 4J2OA 1V8FA 4NTZA 2ILTA 4C6SA 4WTOA 4B2YA 5KYNA 1RAFA 4HWPA 2QM7A 1UINA 4K05A 3WWZA 2ZYVX 1IDOA 5BW8A 3RLIA 4F8JA 1Z39A 1BKYA 5JSHA 2J8ZA 2YHAA 3A36A 1U2DC 4OQ4A 5JEDA 2X4DA 1VIDA 1X80A 2EGGA 2J09A 3GJ8A 4PG4A 4E46A 5IXSA 3PQ7A 3DE0X 4DPLA 1E94E 2FEPA 4RA6A 5KWEA 2IYXA 3ANLA 1U1IA 1IEXA 1J2YA 3FGZA 2AWNA 4QDUA 2QK4A 4WLOA 3ZU5A 4XDGA 4O4IF 2RGNA 1DKOA 1Q0PA 2H5IA 3BWCA 1UDBA 1JQJC 3EBLA 4M0EA 2G9NA 2NU6A 3A2LA 1S4QA 1Z5NA 4Y0AA 5DXJA 5FFNA 4CM9D 1JAYA 4QFCA 4ZOLA 5HJEA 3W5DA 2DT8A 3ZWNA 1BS9A 4G8CA 3KWMA 2BLNA 3AEZA 3C1OA 2RG1A 1D6SA 1J9EA 1NLUA 3AHFA 4JK3A 3SDZA 4ACAA 4YUYA 5JC8A 1EPUA 3FTFA 4H4EA 4H77A 2C03A 2AF4C 3R6DA 1E6EA 2HEIA 3ESZA 1PX0A 3HM2A 2CVFA 5AMXA 3GLIB 3IBSA 2X0JA 4LYDA 2DJIA 5U4XA 2WU0A 1EJBA 2QR2A 3KXIA 4LTDA 1SQFA 3QMWA 4UCQA 2CLFB 3VMMA 4YJ2B 1WPRA 5EXEA 2MSEB 4Y6GB 4U8HA 4N9QA 2MR5A 4KPEC 1JJFA 2GVDC 1LFAA 1W36C 2ZE7A 4CR7A 4RGYA 1JHMA 1GYQA 4DAOA 4NMHA 4NOMA 2LDBA 4OYRA 5TQ0A 3TFWA 1GEEA 4KZPA 1PN3A 4Z3OA 3EOZA 4EPTA 3RU3A 1MH1A 3EXHA 3WK4A 3FPBA 2CHGA 4QXOA 2BEWA 2IA5A 2J33A 5L3QB 3A06A 1Y1QA 3BIOA 4PYLA 3Q7IA 3GB9A 3OWHA 4DA6A 1Y6QA 3C8MA 3ITNA 3K9GA 3O84A 4JCOA 1LC3A 4LHVA 5BRAA 3C3CA 1ZKDA 1S2DA 2RGAA 2VXYA 5IM4A 3ICPA 2DVMA 1E0JA 4R71A 1L7XA 3RI3A 4YMGA 1NUSA 3QPAA 4I7EA 1IOLA 1UM9B 1P7ZA 3ILYA 5AKGA 1YCHA 1OSNA 4EMSA 2E37A 1N6IA 1C4WA 3B9BA 2FJ0A 4XXHA 5A4DA 3MMSA 3OZ7A 2MYPA 1KEUA 3ON5A 5I01A 3WYCA 5F3WB 1KETA 4JLWA 4RD3A 1ORWA 3ONVA 2Q3MA 1L7QA 2Y66A 1HYEA 3NHAA 2G08A 3R2JA 4XOIA 4DW8A 2FZVA 2OBXA 4M88A 4UTNA 5LU8A 1QNFA 2V9CA 3G85A 3M34A 1EIWA 1UJ4A 2BHRA 3M4XA 1PVVA 3SJZA 4D79A 1DBQA 4ERNA 2FLWA 3PIDA 2Q5EA 1MNQA 2W4QA 3CF0A 3N8NA 3Q41A 4WZ6A 3CH6A 3VR6D 4C88A 4LSGA 2COEA 5BSGA 4I66A 2QJTA 4X97A 3Q5GA 4KWTA 3RC2A 1K7XB 1MN6A 1VE7A 2HXGA 4HUQB 5CUQA 5IEJA 2Q29A 1QH0A 1CHDA 3DD5A 4OXNA 1ADCA 6ABPA 3ZDBA 3V33A 4JI7B 3SEFA 3ZNQA 2OO5C 3O95A 3MLEA 5IMSA 3I2FA 1ZO8A 3FBWA 2QX8A 3TZBA 1RVV1 3AMVA 5T7BA 1ZQ1A 1IPEA 3CIOA 4OU5A 3TR6A 2B6HA 3RAJA 4C0LA 4V0ME 1UKCA 4AO8A 5FFFA 1ULSA 1X7WB 1YKFA 2PLRA 1Y1TA 1KR2A 2A9JA 2NSJA 2SCUA 1NATA 2XEXA 4G97A 1L5OA 2PIAA 4M87A 4X93A 2R7KA 3FRHA 2A4KA 2ROQA 2ZU0C 1O95C 2ZSIA 5L3ZA 3RRZA 4DCNA 2A3NA 4Z0NA 3SZ3A 4JX8A 2MR6A 4A15A 3ILVA 1F7VA 1ZBQA 2VRNA 1JG7A 1NRJB 2YCLA 3BG5A 2IXDA 1FE8A 1Z75A 3MOSA 3WGNA 4BWGA 4D9GA 4US2R 3SAJA 5FQOA 2XUFA 1IUKA 1XJCA 1YDHA 2TMYA 3EGCA 3OPYI 1F8UA 1ZVJA 4O8CA 3G9ZA 4RIHA 1TAGA 5DYWA 2OXFA 2W6PA 3JAWA 1ZD2P 4MWOA 1PZGA 1RZ3A 2JI9A 4ZKEA 4JUBA 1AMUA 3UMYA 3B1VA 2WQZA 4UTPA 1DKPA 1BC5A 1RRPA 2OMKA 4ILEA 1P9WA 1EQUA 4FKMA 5LMNB 2O8FB 3MHTA 4IEIA 5L7YA 4HZUA 5B2EA 1Z56C 3I2YX 5FTLA 1EUZA 4BLTA 2D13A 4ITUA 2IUEA 4KR3A 2QPOA 3HP7A 1JHXA 2C61A 2NYVA 1RHQA 5TPZD 1FMJA 3BBLA 4Z0TA 6GPBA 1EWYA 3QXHA 1IXRC 5AJZA 4DB2A 4R4JA 4KE9A 1DAFA 1XUOA 1XXLA 4LSZA 4N8DA 1CF4A 4NCKA 5CB6A 1W1UA 1XIVA 3KPJA 4BB6A 2V4MA 4MW9A 5EQFA 1LY1A 2I3GA 2SBTA 3DDZX 1N3LA 4Y1EA 2WM2A 3LY8A 1DZ3A 1YJ8A 2UDPA 3CZ5A 4M0PA 4MYHA 1CERA 2RJOA 5KQLA 2J41A 4LWQA 4ZYTA 3FX2A 1A7JA 1Y82A 4P34A 3WGQA 4AN0A 4GPBA 4BBPA 2HWXA 3DEHA 3VZCA 1E77A 3PUJA 1I4OA 2VJQA 4UVDA 4MUFA 4HEA6 1I5EA 4UHDA 3ABZA 1L7NA 2JGAA 4YPVA 4JI2B 4YCBA 4KFTA 2CNDA 4N0QA 5I8ZA 1FJ2A 1VLVA 4WLNA 3TW8B 1YZHA 5ALPA 4PC2A 3R6GA 2PKCA 3M3DA 5LBTA 2C4UA 3KKKA 3SX2A 1P45A 2ZGVA 2KW5A 3N8KA 2UZ0A 5AIBA 2AXEA 3R3XA 3O38A 4Q93A 4RFSA 4PAWA 4KVAA 2XQJA 3ZTYA 3QLTA 2R5NA 2C59A 4NJMA 4RVCA 5IDQA 1NV9A 3QLJA 5FQNA 2OYCA 4A6PA 1XZHA 1GUFA 1G4HA 2IYRA 1X1TA 3GZNA 1TTPB 2QGFA 4GZLA 4X20A 3RIXA 1W36D 3WFIA 1FFCA 1FTYA 1Y3FE 2QI9F 2W6JD 2XMCA 4X71A 4ZVMA 1L5KA 1RHJA 3HO1A 3OQNA 4B73A 1WLSA 4TKVA 1PR9A 4LTMA 4HQRA 2EFDB 2ID4A 4HGNA 4TTJA 5FL7A 4ZI7B 5KNLA 4F5YA 4L0CA 5CH5A 3AF5A 3MERA 2A1TS 3BWVA 3GBSA 4XSGA 3AUSA 3TW0A 4BN5A 4A36A 3QVTA 2CL7X 4KGZA 4X95A 4YDHB 5JZBA 2WYWA 4GI2A 5BQXA 4MQ4A 1NVVR 4NAUA 4R8MA 1NMSA 3A14A 1C3OA 2E6UX 3BMNA 2E9SA 3M6FA 1KZ7B 1EP1B 2O7RA 3UK6A 4CCSA 2XUOA 2BUBA 3Q8MA 3BA6A 4IDBA 2JI8A 3IL2A 1NVFA 1H5QA 5C0OE 1U65A 1DEOA 4BTEA 2FHSA 2VZLA 2O1SA 4YASA 5BYJA 1VHQA 2ZU6A 2IYPA 4FS8A 2J3QA 1E5VA 1CQZA 3FNFA 3KNZA 3KTAA 4MV8A 5FI3A 4PQFA 5A5EA 4GOLD 4R7ZA 1G7RA 1SCJA 3B8EA 1EK0A 1DZIA 1N2SA 2H4ZA 3TLGB 1DL5A 4CF3A 4BFCA 4BBJA 5NLLA 4R2KA 4GNKA 1ENYA 2ZTUA 3GD5A 4BQPA 1GA6A 2EBHX 3D8UA 5HYVA 4Q9LA 6Q21A 3H5AA 1E1RD 4C4YA 2BISA 3V4RA 4RACA 3PUYA 4FFSA 4EATA 1WPGA 1LBSA 1QKKA 3WIOA 4GR9A 3MUFA 3R8FA 2R1ZA 3QPVA 4QOJA 1W85B 1UAAA 1PUXA 1Z0AA 2CFCA 5DYTA 3P97A 1RBQA 3ZHVA 1FBNA 2DP4E 4PYIA 4A73A 3TAHA 2NUTA 4C04A 3VVCA 1XCJA 4D80A 1A8UA 3QELB 4XH9B 2V96A 2H52A 3IMEA 3LHIA 5IH7A 5F78A 3MWFA 4CL3A 1XU9A 2R79A 3O8DA 1OR8A 4XGNA 3GZTB 1T9BA 4F85A 4FFLA 2EJTA 1JU9A 4ZU6X 2HMVA 2YNMC 3TNJA 1XPOA 2Z3VA 4ENWA 2O8EB 1ZM9A 3FY4A 4C3VA 1X7GA 2FWPA 3EDQA 1JHDA 3GFRA 4E1BA 5K0ZA 3CCCA 5DW3A 1KBZA 5IN5A 1JN0A 4FYKA 4HK4A 3KO8A 3SP1A 2PGXA 1GZDA 4L8GA 4J29A 4F06A 3I01M 2PWBA 1TM4E 4GQIA 3A6PC 4LOIA 4BP8A 1FDRA 5F77A 2O54A 1Z4JA 4YRSA 1G5RA 1HK7A 1ZQ9A 4YECA 4X62B 4DR3B 3R7WB 2I3DA 3L8EA 3OECA 2GM5A 2QSUA 1I6KA 1R6VA 3DLIA 4NJMB 4TWAA 1NG9A 4Y1FA 5JEEA 3ZCTA 1WBDA 2H1WA 3OE7A 3ZE7A 1AUOA 4OK3A 3DTVA 4IV8A 3Q85A 3A6FA 1GGJA 4GMGA 4P80A 1WB9A 5KQRA 2D6FA 3JWJA 3FPEA 2J6HA 3DE4X 4OMCA 2EZTA 1M72A 2VNHA 1WKCA 3FBGA 5TQ2B 3EQ9A 3JASB 4PTLA 1W2WB 3PQ8A 2A2ZA 4W9NC 4ZU3A 4E7OA 3UWOA 2X1LA 4MPPA 5JCXA 3EIUA 3S8MA 3ESAA 3O8NA 3IT3A 4HB2A 4JUDX 1NW8A 1NKSA 2PGNA 4U3JA 3ND5A 4BV2A 3CF4G 5BWNA 2WUGA 3L4SO 4GPD1 1M1NB 1JIJA 1JZSA 1YR7A 2WJWA 2FSGA 4K8RB 4PYNA 4NDZA 4OB7A 1B6GA 1SVNA 2V54A 2XVAA 1NP6A 2J5RA 2A0WA 4KWCA 3IDAA 3U9TA 2NIPA 3ND9A 4DUGD 3NYWA 4NZ9A 3VR6A 3TVTA 1TEHA 2QM8A 3N2NA 2VHZA 3ABOB 4QLAA 2F8MA 2M98A 4FHGA 3T7EA 4EHFA 3DZIA 5BQPA 2O05A 2VPPA 5HFJA 1MVNA 2QTFA 1V41E 2RGXA 3R3YA 4P38A 2X2OA 3O21A 1T9GS 1PWZA 6PFKA 4YLEA 1Q21A 3NIFB 2DHRA 1N9GA 3BJZA 3CN7A 4C0BA 4XWKA 4GL2A 4L7VA 4QDTA 1OGIA 3B1ZA 3E5MA 3IJRA 4OQXA 4Y2UA 1O0SA 1W0JA 1MB3A 2ZBUA 2V6JA 3KZCA 1XV5A 1X7YB 1VI2A 1XTTA 4R1QA 4B1FA 1M2GA 2CLOB 4ZVVA 5LQSA 3KZOA 4GBJA 1QM5A 2WP8J 2RKWA 3DMPA 5AKLA 5AKYA 2Q5FA 3ML1A 4FGUA 3KOMA 4KQ1A 4K6KA 5HIJA 5BRNA 1QGUB 1ZI9A 2V5VA 3RVQA 2PMKA 3PKIA 4FD3A 3VQTA 4C3ZA 2D5CA 4NNJA 1XZEA 4L4XA 4OUKX 2RBKA 2WPNA 1P8JA 2CFOA 5E6UB 4BZQA 1X7XA 2J0UA 4A2QA 4QQRA 2IF2A 3D3NA 4G86A 1CJVC 1KDVA 4F3CA 2O8EA 2Z4TA 2I8AA 1GPMA 2YXNA 3G0DA 2FF5A 3RVDA 1LI7A 4JMPA 2ORYA 2RI6A 2BH9A 2QA5A 1Y9EA 1ZJJA 3ZJ4A 2X2PA 1SVSA 2PXHA 1N7HA 4ZQCB 3SR0A 3N8GA 1HEYA 3AU8A 3P0JA 5DDIP 3RPEA 2H06A 4NOJA 4YPFA 1ADJA 3L7CA 4I5DA 4MXDA 3AR6A 1U2ZA 5FAKA 4RU1A 5FX2A 1UR5A 1CZNA 3GARA 3MJHA 3RBVA 3KALA 3WRWA 4J43A 2Q1UA 3QLEA 5K45A 2JF0A 1DQRA 4TKUB 3Q6MA 2XT0A 2WSIA 2NP6A 5BR4A 1COWD 2Z6AA 5AKHA 3PNBA 3FUTA 3MYRA 2CLKB 3LT1A 2RGEA 2I65A 3T95A 1XU4A 4LXHA 5GGXA 3R9XA 2XTJA 3UO8B 2CF6A 2FFJA 3M2TA 2DLCX 3NASA 2V03A 3PI7A 1Z38A 4U02A 1AA9A 1C80A 2Q6KA 2DBRA 3K8QA 4IXNA 3ZCXA 1LB1B 1B7GO 4DM4A 3H2KA 2AE1A 5F2OA 5KYUA 5M34A 1I7QB 1TNDA 2VNKA 4KO1S 1BCRB 3I04M 1XOIA 3KJEA 3LKVA 7REQB 3SYKA 3T7SA 1Q50A 4OQEA 4ZJPA 3KDAA 1WNTA 2DWCA 4KI0A 2VDPB 1DAMA 3WB9A 2QYOA 1WB4A 3VDXA 2J0EA 2CDCA 5JNSA 4G5QA 4WUTA 3LF1A 3E0XA 2FETA 4MV7A 4QBTA 3BZBA 3L07A 1VSTA 2C96A 1JJAA 3K0AB 4UFOA 1NOJA 3TNFA 3DFZA 3ZHBA 4AP5A 2D74A 1XZCA 2PJUA 4EGAA 1ZR4A 2FN9A 1N2GA 5E2BA 4GBGA 2Q9CA 2XUQA 3HJRA 4FKBA 3TQFA 1DJNA 4NKRA 1UJBA 3QEAZ 4F56A 2Z8XA 1FRVA 1HTBA 2V4ZA 2RD2A 5K3FA 1QRTA 1JDTA 1X1CA 1TVMA 2PMCA 2Y1OA 5FUXA 2HHHB 4M46A 3ZWBA 3UMCA 4PCVA 5ELMA 3N75A 5DTEA 3T9DA 8OHMA 1QZXA 1XDSA 4CTKA 4AKEA 2DQ4A 1JS1X 1LUAA 4ROTA 1RLJA 3WVNA 3EZYA 4R2IA 4FFPA 4KR0A 4PN3A 4JOQA 3V2GA 1X9HA 4CF4A 3B60A 1RQ7A 1PS9A 2VOJA 1BCSA 4O4HB 2N46A 1TA4A 4QJ5A 4JP3A 3S2SA 3O4JA 1QZ3A 2XNDD 5KYKA 3QUBA 3MAJA 2OLEA 2XMRA 5TSDA 1DQYA 2HLHA 1H8HD 2EFGA 3DEAA 1L5HB 2XHZA 4R3UC 3WYFA 2FPGB 3SQWA 1JPVA 3ZJ5A 3DVSX 4TS1A 1GG5A 4AURA 4TYWA 2P3LA 4JZKA 1RJWA 4RQUA 1U98A 1RBZA 3KL4A 2OHFA 4LBZA 3C24A 5EKTA 1Y6ZA 3C70A 3M4ZA 2H7XA 4KYIB 5G1PA 2GXQA 5I9MA 4BVHA 4DEVA 4FJ2A 1A9OA 1M2VA 2BFEB 4QXMA 2J9XB 3TI9A 4BNVA 1WZUA 2Z56A 2ZCUA 2XNCA 4GLLA 4YJGA 5LLSA 3ST7A 3AX6A 2IYUA 1SH7A 2CWWA 3E7PA 4BE9A 2LNDA 2PO5A 1E6WA 2ZUEA 3LCUA 1GKYA 1L7RA 2WFMA 3AF3A 1JIQA 3ND7A 4QGBA 5AKEA 1ICIA 1ZMBA 1PYGA 3EEOA 1P9RA 3KRTA 4TKZA 4JOBA 4HG2A 2IHVA 3AL3A 2FWAA 4H18A 4PXAA 1H3EA 4G0MA 2AG1A 1CRQA 3LT0A 4U2KA 3KD3A 4ZYXA 1FBTA 3L7OA 1ZPDA 2Y0EA 3KYCB 1Z08A 3DTNA 1TCAA 4QBKA 5MN5A 9GPBA 1KNQA 1XMJA 4D6XA 3IJPA 1WRBA 3VDNB 1YR9A 2Q41A 1AUXA 4ZKDA 4KU4A 3U1VA 1IFXA 2QNIA 3SLKA 1ZOOA 4EGJA 2PD4A 3UCFA 4PSVA 4LS3A 1TEZA 4N40A 3DL0A 4EPRA 5LKRA 1SA0A 1Q11A 2HM7A 2MWMA 3SM9A 3HI6A 1ZGGA 1Z2AA 2Q27A 3PGKA 4ZYYA 2H1OA 4D0SA 2I6GA 5BSEA 1G19A 4RDXA 5LIPA 2A5LA 4DLKA 1T2VA 3BHIA 1Q22A 1RQLA 4FZVA 4DXDA 4YQFA 2X4GA 2IZ1A 2YICA 1SQ5A 3SZMA 4EL0A 2A30A 4QPDA 4RY8A 4O2BB 4IYJA 2ZOSA 3DHNA 3DWGA 1PGQA 4TS9A 1Y3DE 3WNQA 1JBEA 4CGYA 4QXPA 4N76A 1OWNA 4TM7A 1JDUA 3IS3A 2HK8A 1FFBA 4BRSA 2DYKA 1T9ZA 1NZFA 4PLZA 4AQDA 3D4LA 1BEUB 3V80A 1UT8A 3RQSA 3DE7X 3OE7D 3PFCA 4HTFA 3EXEA 3AJ9A 4MKFA 1Z22A 4UXJA 3WADA 3KKEA 2VLIA 5TS3A 1R6XA 3I05A 3LRTA 4F04A 5HM6A 3VO2A 5JR3A 4UHKA 2FGKA 5GZ1A 1K68A 3PGVA 3IP6A 2CY0A 2CFIA 3I5UA 4Z9AA 4ZJZA 4PRYA 2JGDB 2CNWD 3FNQA 1ZCJA 5IJZA 3CVYA 2QMHA 2WTAA 3INNA 1Z34A 2PNJA 4MKGA 3U0BA 1EGMB 3RFCA 1G20E 3QA3E 1ESZA 1P60A 4OHFA 2NYAA 4P92A 5JADA 3ANYB 4IFBA 2IV2X 4KMMA 3VMFA 1ZIPA 2G07A 2QQ0A 3NI2A 1JI3A 2QAGB 4RLHA 2I9KA 2RGWA 5CXSA 1NVWQ 4W9NA 1MG5A 1PQUA 4YYEA 1AOXA 1P44A 2YR0A 5HBGA 3U26A 4PICA 5F1YA 4A91A 4D3FA 5SZKB 4C7JA 4Z51A 4UBIA 1ZCBA 2BKEA 1Z2PX 3CR8A 3MTDA 4IPTA 4ZQHA 4CQJA 1M6WA 2QKYA 1P2TA 3IVMA 3N74A 3W3AA 2O06A 1ZVKA 4KO2S 4NABA 4GMFA 2GYYA 1JECA 1MU0A 1VP3A 1X94A 2NV2B 3DYIA 4MKZA 3L6UA 4N8SA 3TJMA 2OHGA 4BLVA 4C4AA 3AI2A 3CE6A 4JXJA 5BOVA 1UP7A 3BFVA 1DDIA 3JPYA 5A4JA 5BR1A 1J2RA 2IEYA 3EEQA 1DX4A 2BJVA 3LNTA 4IVNA 1Z82A 3H05A 4LC9A 5TJ9A 2X9GA 4AZ3B 3HUEA 3KTOA 3JWEA 4OU4A 1FSZA 1VE1A 3ZXIA 1JEQA 2DLNA 4XJXA 2WW8A 1TD9A 1R9MA 2FEOA 1YOVB 1CQXA 1BXZA 4MCIA 1R0CA 2GBFA 1BYIA 3ICOA 3RU2A 5H7XA 4Z6KA 4URFA 3CUEF 1J6UA 4HVTA 3TZKA 3OQMA 5DVZA 2OKGA 5DW0A 5DWQA 3OA2A 3BC1A 1OF1A 5HIKA 4OHYA 5DTQA 5GVRA 5I9LA 4A27A 3NEJA 1M0SA 2PX4A 3PUIA 2ZPTX 4FLEA 4LXYA 2OV1A 3GWGA 4NI5A 4NMLA 4O4IA 2IYLD 3FCEA 4YEDA 2P5YA 4LZZA 5H70A 1U3UA 2YCBA 5C7OO 3EA5A 3L7DA 1JDBB 2RH8A 3VPCA 3DPIA 1BAPA