5FRDA

Structure of a thermophilic esterase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
256
structure length
256
Chain Sequence
MLERVFIDVDGVKVSLLKGRERKVFYIHSSGSDATQWVNQLTAIGGYAIDLPNHGQSDTVEVNSVDEYAYYASESLKKTVGKAVVVGHSLGGAVAQKLYLRNPEICLALVLVGTGARLRVLPEILEGLKKEPEKAVDLMLSMAFASKGEEYEKKRREFLDRVDVLHLDLSLCDRFDLLEDYRNGKLKIGVPTLVIVGEEDKLTPLKYHEFFHKHIPNSELVVIPGASHMVMLEKHVEFNEALEKFLKKVGVAEVHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYLESTERASE (EST-2)
publication title Structural and Biochemical Characterisation of Archaeoglobus Fulgidus Esterase Reveals a Bound Coa Molecule in the Vicinity of the Active Site.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 107
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5frdA00
3BDVA 1GPKA 4MYSA 1AC5A 2HA4A 1CUHA 4J0CA 4UBIA 1CR6A 1XROA 1GQSA 4MWTA 4IHAA 4N8DA 5ALUA 1KU6A 3QH4A 4BDTA 1QIEA 2GBGA 2JGKA 4BP8A 2QM0A 5AKYA 1CQWA 5E4TA 4AB1A 3PE6A 2Y6VA 5AJHA 3I2KA 3BF7A 2JIDA 5KWIA 1CQZA 1ETHA 2ZJFA 4QA9A 3G9XA 4CCWA 5IVHA 1ORVA 3C45A 4KE8A 3EF3A 2DHDA 1E5TA 3QYJA 3SC2A 3BL8A 1VXRA 3MVEA 2VJDA 1EI9A 1FSSA 2Z8ZA 1CUJA 1YR2A 4KE6A 1ZJ4A 4U2BA 1CUUA 5KREA 2EDAA 4FNGA 3ESAA 4MJ3A 3C6XA 2VATA 5DJ5A 4Y9SA 2C58A 5AOCA 1YB6A 4WJLA 1CVLA 2P8SA 4F60A 2PM8A 2DQZA 2CUTA 4ZXFA 5JAUA 2J3DA 5T4BA 1ZGCA 2QXTA 1UK8A 4KRXA 1CUXA 2PSJA 1EINA 2OG1A 1L7RA 2ES4A 3C6YA 1Q0RA 4J0HA 4J0IA 1K8QA 3CN9A 4W1RA 4BAUA 1LBSA 2X5XA 3C6ZA 1HQDA 3OURA 2PUHA 3M82A 5EIHA 4HXGA 5EIAA 3DD5A 3GA7A 4OUKX 2OQIA 1Y37A 2V97A 1Y7HA 5AKEA 3CN7A 1XRQA 1Q83A 1SC9A 1NX9A 1ZI9A 2HFKA 5IVDA 2OGTA 2QUBA 5DYYA 4AZ0A 1JI3A 1TCBA 3U1TA 5CXUA 2CZQA 4Y2VA 5ALGA 1EHYA 4Q82A 3T52A 5D3ZA 2G5TA 3H2JA 1QTRA 1QZ3A 2RONA 5FDFA 3G0GA 3FWHA 1F6WA 2XMBA 4YK7A 1TRHA 1ZIYA 4G4IA 1T4MA 2XMRA 2OCGA 3IUQA 2PBLA 3B5EA 2QOEA 4NS4A 5HKAA 3K9BA 4DSZA 4JYMA 1WOMA 4TGLA 4LYEA 1H2YA 3GFFA 4X6YA 3F67A 3ZLVA 4AMZA 2OAEA 1LPNA 1JMYA 4UBNA 3CCBA 4X95A 4Y2RA 1XZCA 2GYWA 4FDMA 1FFBA 1W6RA 2XMSA 5T4FA 5HQ3A 1TCCA 1R88A 5FPQA 1CFJA 2QUAA 1R9MA 4UBKA 1YASA 4BTLA 4E15A 1QO9A 1R9NA 1A8SA 2RGUA 1Q0ZA 3AZPA 1DWOA 3HC7A 5FKJA 1JJFA 2WG2A 4K2AA 5CTAA 5AI0A 5ALWA 1YB7A 2C0PA 3GZJA 5AHXA 4UBOA 3E0XA 3ZLTA 3PFBA 3EQ8A 3H2IA 5K3DA 3R3VA 4WY8A 2ZJ7A 3WA7A 2J4CA 2WM2A 5JANA 5AKHA 3Q8WA 1Q84A 4KACA 5AKJA 4DMFA 3D4LA 4QWWA 3C8DA 3QZUA 3R3UA 2HRQA 5CH3A 2CBGA 4NZZA 1OXMA 3BJRA 3KOOA 2D5LA 2WJ4A 4J0GA 1CUBA 1EB8A 1ODCA 2O7RA 3I2HA 2XUAA 1AZWA 1R4ZA 2WHQA 3QITA 4ZV7A 3C6BA 3W05A 5AOAA 5KWJA 3D2CA 4L3WA 1O6FA 3STUA 1BE0A 3BDIA 3A70A 3AIMA 2CJPA 5AK5A 3F9CA 3SK0A 4V2IA 3WWPA 4A23A 2QS9A 4AO7A 1W52X 4QNNA 3X3HA 2WKWA 5CT5A 1P0QA 1W76A 4QDOA 4IH4A 1VE6A 3AJAA 4UPDA 1XZGA 3WWEA 5LZ4A 3D59A 2WILA 2ORYA 3FCYA 4E46A 5C7YA 1EVQA 1XRMA 3WLAA 5A62A 1XLUA 4HRYA 2HU8A 1DX4A 2R8BA 3VJKA 1SFRA 1PFQA 1MNQA 3WQHA 3R40A 4ETWA 4FTWA 3BWXA 4C6HA 1JKMA 3G0DA 1RYYA 5IVIA 1CUWA 1CEXA 3JW8A 2WHPA 1L7AA 5AKLA 5DWDA 4C88A 1C7IA 3G9UA 1YA4A 2QZPA 1UZAA 5C8XA 3TEJA 2BFNA 3GBSA 1CUEA 4L72A 2HHAA 3FYTA 1NU6A 1K5PA 5ESRA 3PFCA 5ALRA 4N5IX 3NUZA 3A2MA 2QVBA 2VA9A 1L7QA 4H18A 3G02A 2JGIA 1CUCA 2W6CX 4G8CA 4QE3A 2XLBA 1B6GA 1QIIA 3C5VA 1MTZA 4BVKA 2H1IA 1XZHA 2JGLA 1GKKA 2ACEA 1XZJA 4M0FA 5AP9A 2V98A 2PU5A 4LXGA 1KU0A 3DLTA 4H35A 3E3AA 3QPCA 2CKMA 4GDMA 4Y2YA 3FYUC 5A2GA 4E11A 1CRLA 5JZ9A 3OPMA 3L1IA 3FNBA 3HI4A 2VQ6A 2WJ3A 2O2IA 3HRHA 5JYCA 4JYPA 3E1GA 3C8HA 1IUPA 3FYUB 5FP0A 3WJ1A 2RIPA 1P0IA 3SX4A 1UK9A 3GROA 1JJBA 3KD2A 2JGFA 5AKGA 5CH5A 4QEKA 5CT6A 1MAHA 1XQXA 2BAGA 4B0PA 4WY5A 1EXWA 4W1SA 4CG3A 1XZAA 1ISPA 4YASA 4PV7A 3RK4A 2DQYA 4BRSA 3O4JA 1UKCA 3F96A 3IUJA 2XUQA 3WL7A 3WZLA 3ZPXA 1ZD5A 3F8SA 1OILA 2PSDA 1GGVA 2Y2UA 1ZICA 4PSCA 3LIPA 1E8MA 5C8VA 3FCXA 4GXNA 3HYSA 3WKCA 2XQKA 3PI6A 1YA8A 1KEZA 1AQLA 1SOMA 1CIJA 2QR5A 1H2ZA 1X70A 4WCVA 3I1IA 3KXPA 1H2WA 2WIDA 4K6HA 4Y2XA 3ZWQA 4N8SA 4AO8A 3H2GA 4BZWA 1THGA 4S0XA 2IIVA 4BE9A 3FLAA 5ALKA 2XMGA 5DYWA 3ANSA 1GT6A 1AX9A 5IVKA 4AXBA 1P0MA 2G63A 1H23A 1G4HA 1R50A 4OSEA 1G5FA 1K6EA 3F98A 4MEBA 2QJWA 2CMFA 2Z3WA 4ZI5A 1JU4A 3IUMA 2WFLB 4OU5A 1DU4A 4TPKA 2VT7A 4C01A 3I6ZA 4FOLA 4RE6A 3WL6A 2CB9A 1U8EA 3H04A 4EBBA 5IH7A 1PJAA 1XKTA 1BCSA 1QFSA 3H1BA 2WIGA 1DWQA 2HADA 1ZD3A 5DLPA 4BC1A 2YYSA 1A7UA 2HA2A 2NW6A 1UK7A 5ALTA 4HTAA 5FPPA 5FUMA 4AZ3A 5LZ8A 2WUGA 3WKAA 1AKNA 3H2KA 1LBTA 5A7HA 4EY8A 3BXPA 4J3JA 2X76A 4L0CA 3L1JA 2XUGA 2WUEA 4CG2A 3O4IA 2DCMA 1BCRA 4MXDA 3ZLUA 1VZ3A 2ZYRA 4B83A 3QVMA 5D7BA 2BCEA 4G9EA 4B6GA 3R3ZA 4BYMA 3FLBA 1CLEA 1HL7A 4EY7A 1HKHA 2DHEA 2PU7A 3D2AA 4C87A 5LLSA 5ALXA 2BJHA 2V9ZA 4B81A 4C89A 3O9VA 3STWA 1JT2A 3O4HA 1U65A 2VTVA 5JD6A 3WI7A 4DGQA 5ALIA 4AQDA 1WPXA 3KWJA 1E8DA 5HF9A 4W9RA 4FLMA 1BEZA 5HF6A 4Q3KA 1XZIA 2FJ0A 4B7ZA 3HACA 1HBJA 4Y2QA 3ED1A 5I7UA 4XJVA 1YSCA 2XUPA 5AOBA 2HA6A 2PKYX 4BP9A 3WKBA 5CXXA 4UFOA 5K3EA 3L1HA 4WDQA 2WTNA 4G5XA 5JAHA 5HCUA 3R3WA 3R0VA 5EHZA 3S2ZA 5C81A 2FJPA 3GUUA 2JEZA 1ACLA 2H9YA 5AK4A 4ARAA 2C5FA 5ALMA 3WYNA 5ALJA 2HRRA 3QPAA 4QDZA 2ZSIA 3K2IA 4BAZA 1E8NA 3WKDA 2QRUA 3H1AA 5J3JA 2ZJ6A 5EIEA 4CI9A 3DYIA 1S8OA 4DNPA 5AK6A 3WK7A 2H7YA 2XI4A 3OTQA 3KDAA 1THTA 5LIPA 4W1QA 3YASA 4BRZA 3STTA 4L9AA 3M81A 2K2QB 1CUFA 1QFMA 4DYHA 4MWSA 5ALPA 1JJIA 2IITA 3T4UA 1CUGA 1DT5A 2VT6A 5JAPA 1AMNA 1T2NA 3STXA 2BUCA 3OOSA 3R3YA 2O7VA 3I2JA 1JMKC 4NVRA 4G8DA 3VJMA 4BCDA 1XZBA 4B9AA 4H77A 3B12A 2YH2A 3RM3A 4PNZA 5AI5A 4G4JA 4U2FA 2GYUA 1MX5A 2XMCA 1LZLA 2WFMA 5ALLA 2WIFA 2VAXA 1AGYA 4BCCA 4OPMA 4C4XA 4F21A 1WHSA 2Q0XA 3PICA 4X00A 4DSAA 1GKLA 3IURA 2AJLI 1MJ5A 4W63A 4TVKA 1W75A 4ZGBA 4BATA 2I03A 3UUEA 2VJCA 3ESCA 1B41A 5ALNA 1N5MA 3WK6A 3G0IA 1VXOA 2RAUA 2DR0A 2FX5A 3I2GA 1MO2A 4IH1A 1I6WA 1H22A 3GELA 1JFRA 2PUJA 2WHRA 3FBWA 5LZ9A 5BOVA 4GBGA 5HF5A 4GECA 5ALQA 1VKHA 5CBKA 5CT8A 3DYVA 1LPOA 2GYVA 1QIHA 2OLEA 1VA5A 1ZGBA 3DOHA 1ORWA 3DKKA 4Z49A 3PF9A 4KAFA 5EFZA 4PW0A 5AO9A 1R3DA 2O2HA 4BC0A 1YAJA 2PSEA 4BAGA 1LPAB 4I19A 1GQRA 5T4HA 1F8UA 4Y2UA 2LIPA 4CIBA 3DOIA 2OCIA 4KE7A 2ZVDA 1EDBA 2JGEA 2OGSA 1TIBA 2O2GA 3I28A 4UBLA 5JD4A 2VJBA 5AK3A 4U2CA 1BRTA 3WWDA 3ZI7A 3OM8A 4QZVA 4P93A 1WB5A 1HDEA 1OCEA 3WIOA 3HSSA 2ZYIA 3A6ZA 2ZYHA 3V1LA 2XLCA 3VDXA 3FOBA 3IB3A 1IMJA 5AI8A 2JGMA 4LXHA 4B80A 2JF0A 3W9UA 4Y2JA 2XUJA 3N0TA 2CEKA 2HU5A 5DNWA 3S8YA 1U4NA 4FMPA 4J0JA 4C4ZA 3AILA 4OB6A 4EB0A 3D7RA 5LZ2A 2XMZA 1VE7A 2PL5A 2HDWA 2D0DA 3EIOA 2I3DA 4BZZA 3I1YA 5FLKA 2XQJA 1QOZA 4X85A 3Q0TA 3WK4A 5AM5A 1QIFA 3LIIA 3QPDA 3N2ZB 4H7JA 1BN7A 4LIPD 1IUNA 5DTJA 2G5PA 1D07A 1BEEA 1EVEA 3A2NA 4GWLA 4X90A 3DCNA 1FFAA 4WFJA 5ISMA 5AI9A 1XZLA 2J4FA 4GEGA 5FRDA 2C0QA 2PSFA 5AM0A 2VAVA 3DKRA 5IKXA 3LS2A 3FLEA 1UFOA 4H7FA 5A7GA 4HS9A 4H7EA 4D9JA 4GHWA 2DFPA 1X2EA 2VEOA 5ALHA 4B9EA 1DX6A 2XQGA 4BTVA 1NU8A 4B84A 4W1PA 2GBIA 2HL6A 5EHNA 1WPRA 1XLVA 5DNUA 1UK6A 1HPLA 4BDSA 2X8BA 3DL4A 5HQ3B 5JALA 2DHCA 2BGRA 3UMJA 5YASA 1BS9A 4EY4A 1EK1A 2GBCA 1Z68A 1LPSA 2HA3A 1ODTC 1GPLA 6YASA 1CUAA 4FFVA 4OB8A 2RI6A 4BE4A 2YXPX 5CH8A 2BGNA 5AKKA 5LZ7A 1WM1A 1XFDA 1X2BA 5HKBA 2C5GA 5FXMA 3WYDA 4MQLA 2XUOA 1EDEA 2GBFA 2ONCA 4M0MA 3PUHA 4P9NA 1XRNA 1EB9A 1QJ4A 2WSLA 3O4GA 5BV7A 3AIKA 1XQYA 2ZYSA 2JBWA 3NGMA 5EHQA 3QBJA 3DDUA 1A8UA 4FWBA 4UBMA 3V48A 4J0DA 4DNQA 2JGJA 1CUSA 3I6YA 5F4ZA 3QMMA 3LP5A 4LKOA 4UHEA 1BROA 4KEAA 4QWMA 4GI1A 4QDUA 2Y1KA 4RPCA 1XQVA 4EY5A 3WMRA 2PSHA 1QIMA 4U2DA 5FOQA 7YASA 3TGLA 2HA5A 1XZEA 5BWCA 4Y2PA 3DL7A 2OPHA 3DEAA 4ZREA 1FJ2A 1ZIXA 2B9VA 2AXEA 3VXKA 2C7BA 1YCDA 3DNMA 1LLFA 5K3FB 4UHFA 4CIAA 2WFLA 3WZMA 1LZKA 1E66A 3HXKA 4AN0A 4IO0A 1K4YA 4Q3OA 4H7IA 3MGAA 2XUIA 4X3CA 1ZD4A 2RHWA 2OCKA 2Y6UA 4U2GA 1QLWA 5AH0A 5CT4A 3B3QA 5E2IA 3BE8A 5EHXA 3NOXA 5AM2A 4UBJA 1G42A 2HU7A 1EA5A 4XVCA 4NMWA 2J3QA 5DTIA 4MYDA 1QIJA 4IH9A 5HZGA 1J07A 4I3FA 4G1FA 1J1IA 1IUOA 3O0DA 3D0KA 3HABA 2WU3A 5I9IA 3WIBA 1QE3A 4Q34A 3OC0A 3DQZA 5ALFA 3WK5A 4ZRDA 4BVLA 3G9TA 5AM1A 3IDAA 1A8QA 4KAJA 3W06A 4FKBA 3VKFA 2B61A 3FAKA 4X71A 4AO6A 1ZI6A 3ESBA 5CT9A 3IULA 5E4YA 1MPXA 2HFJA 1XZMA 2HM7A 4FHZA 3TRDA 1VOTA 1EH5A 5LP1A 3FVTA 1SCIA 2QMQA 2XUFA 1XRLA 1YAHA 2PPLA 5ALYA 2QJRA 4DNOA 1YS1X 2WTMA 1H2XA 3RLIA 1MT3A 3VISA 2XQIA 4XX1A 1SCQA 5LZ5A 1O6GA 2JEYA 5SYNA 4HAIA 2AJ8A 5FV4A 1IVYA 1IZ8A 3WKEA 3WL5A 3VVMA 2AJDA 1GXSA 4H7DA 3D3NA 4B85A 1XRPA 3JWEA 4BB0A 5BWBA 1QGED 3MUNA 1UOQA 5HF8A 3G7NA 1LGYA 4FFWA 4KR0A 4QLAA 3RARA 5AI4A 4ITVA 4P08A 3R3XA 4QLOA 3CCCA 2BUBA 4P92A 1WCYA 1DQZA 3STYA 4QDXA 4G8BA 5EI5A 3BIWA 2R11A 1JU3A 1CUZA 4UFNA 2I3ZA 1CUYA 4ZWNA 2PX6A 1A88A 1QIGA 5AI6A 5CMLA 2QXUA 2EEPA 4FLFA 3SWWA 1XKLA 3NWOA 5EGNA 3I2FA 4KAAA 4DMCA 3WK8A 1USWA 4CCYA 3HZOA 1UOOA 3STVA 1MU0A 2YASA 4RE5A 2XB6A 5K3CA 3AZOA 5H3HA 4XWGA 5JZBA 1GPNA 3R41A 5ALVA 3IVMA 2VSQA 3H18A 4BVJA 4CFSA 3WWCA 5JD5A 4LXIA 4EHBA 4N8EA 2OXEA 5DNVA 5CW2A 4HZGA 1TAHA 1ZI8A 3EQ7A 2XUDA 4C4YA 3W9BA 3G0CA 3H17A 4UHHA 4DTCA 1MX1A 2QT9A 4B82A 1ZOIA 3I6MA 4B0OA 3G9ZA 1DINA 1QIKA 1UWCA 5HK9A 1LPBB 5K3FA 1UKBA 1EX9A 5JATA 1XRRA 2XT0A 5E4JA 2XE4A 3K6KA 3G8YA 1CUVA 4JNCA 4A16A 1HLGA 4DNFA 4RGYA 4N5HX 4XIIA 4OYLA 4FLEA 4LYDA 5LKRA 1VZ2A 3E4DA 4JEIA 3LCRA 2WUFA 4BCBA 1YS2X 3I2IA 5ALEA 5T4EA 1LPMA 1ODSA 4MEAA 3V1NA 2BUAA 3P2MA 1MAAA 3QMVA 1XZDA 3DJYA 1J06A 2PVSA 4KE9A 4YX9A 2OCLA 4ZV9A 1C4XA 2VF2A 1UT6A 1VA4A 4MQMA 2HA7A 2WG1A 5KBYA 3CXUA 1DT3A 2EDCA 3QMWA 1FFCA 3C87A 5JZSA 4PO3X 1LPPA 2AJBA 4Y2SA 5LKAA 1IZ7A 3EQ9A 3QM1A 2HA0A 2QKYA 1XQWA 2G4LA 3G0BA 4OCZA 1Y7IA 3O9MA 1FFEA 4CG1A 4UHBA 3FSGA 1MX9A 1UXOA 1VJ5A 4HVTA 2I78A 5K3BA 2B4KA 1VLQA 4HXEB 5JASA 1TCAA 2H7CA 1SCKA 2XQFA 4H7KA 3H2HA 1RWQA 4WDRA 3A2LA 1W4LA 5HK8A 1N8SA 1DWPA 3IBTA 1F0NA 1CPYA 3PUIA 1ZD2P 5SYMA 1R1DA 3EBLA 4J7AA 2OGZA 3ICVA 3BIXA 2ZSHA 1RP1A 5AIBA 5AKIA 5D6OA 4DLNA 4IQ4A 2WLSA 3WK9A 5HFAA 3WL8A 1TQHA 4AMYA 4ROTA 3FYUA 3ESDA 3HJUA 4J0KA 4OU4A 5ALDA 3ILSA 2E3JA 2H7XA 1UOPA 4UHCA 3AINA 3BF8A 4JUIA 4UFPA 1QTIA 3C43A 3FVRA 5JADA 3WWOA 1CUIA 5K5EA 4FBLA 1MNAA 2ECFA 1XLWA 3C70A 2XUHA 1QONA 3DS8A 5ALSA 4Y2TA 3KWFA 2Z8XA 5C8ZA 3UUFA 2XUKA 1C7JA 5ALOA 2OQVA 4WFKA 4EUSA 2RHTA 4K5QA 3C5WP 2WIKA 1QIDA 4OD0A 4DIUA 4Q1VA 1EK2A 4DMHA 4OYYA 3OG9A 4PQEA 1DTEA 4AN1A 2V96A 5AKXA 2B20A 4I4CA 5CRIA 4U2EA 3WJ2A 4RNCA 2WJ6A 5CURA 4X93A 4F0JA 1J2EA 2XDWA 4EA6A 1FFDA 3KSRA 1F0PA 2W22A 4X6XA 3V1MA 1CUDA 3AZQA 4E14A 5DYTA 3JYHA 3M83A 2WU4A 2WHPB 1N5RA 1N1MA 2Z5GA 2WIJA 3F97A 4HRXA 4CCYB 3O95A 4K6GA 3H19A 3AIOA 4G4GA 4A5SA 1DQYA 3ANTA 4X7BA 4F5ZA 1WB4A 4X91A 4AX4A 4YPVA 3WA6A 3LLCA 3H0CA 1WB6A 1P0PA 2BKLA 4X94A 3HEAA 4FNMA 1WHTA 4UHDA 4PF1A 2IX9A 1GZ7A 3VVLA 5AIAA 2XMDA 2GZRA 2HIHA 3W2TA 3ZV7A 4Q3LA 5A6VA 5JARA 3MUOA 1M33A 5A71A 4PSDA 3W04A 4QDTA 2ACKA 5ALZA 4PSUA 3FSGD 2GZSA 2QTBA 3VJLA 5JAOA 4X92A 1CV2A 1K63A 1QO7A 2Z3ZA 1BU8A 2AJCA 4J03A 4Y7DA 4HXFB 5A7FA 3V1KA 1LNSA 3D2BA 1G66A 4O08A 2FUKA 2UZ0A 1E3QA 1UKAA 1BN6A 5JIBA 3D5EA 3M3DA 4LHEA 1XZFA 4H7HA 4EZIA 4GW3A 1AUOA 2Y2VA 2C4HA 3AFIA 4OB7A 3IUNA 4JH0A 1XZKA 4ARBA 5LYYA 2OAGA 2WFZA 4DM7A 4GLBA 5D3KA 5K3AA 4X6UA 4KRYA 2WQZA 2WG0A 3TJMA 3PDCA 4X97A 3ICWA 4K6KA 4G9GA 5HFNA 2VJAA 5I8PA 5AM3A 2DSNA 4M0EA 5AM4A 1AURA 4INZA 4KYVA 3PF8A 1ACJA 5AICA 3V9AA 1W1IA 3BJMA 4KJXA 4FBMA 4EY6A 1TK3A 4H0CA 1PV1A 1EDDA 3AUKA 3IIIA 4DMKA 3U0VA 1TKRA 3RKSA 1E89A 1MN6A 2XMQA 4BBZA 4Q05A 4WFIA 2ROQA 1U2EA 4UUQA 1ZJ5A 5AKZA 2WUDA 3HLKA 3IA2A
chains in the Genus database with same CATH superfamily
3NR2A 1GPKA 2O2SA 3F0TA 4HNSA 4C08A 1KAQA 3WZ2A 4UBIA 5GM2A 1RWBA 4PX5A 4FJ2A 1CR6A 1GQSA 1NYTA 4MWTA 4OH1A 4C78A 4I5EA 2PPVA 3I58A 1QKIA 2OHOA 1ZLYA 3AU8A 2H63A 3QH4A 4Z0PA 1QIEA 1UZUA 4XH9B 1VCNA 2GBGA 2JGKA 5L3ZA 4QU8A 1PZFA 4N0EA 4R1SA 3T1HB 1O5OA 2QM0A 2J3KA 2VPTA 5EMKA 2IZOA 3QIVA 3U9LA 4B31A 1NE2A 3N39C 3UJNA 3A36A 4ZO7A 1I4DD 4EWLA 4MS4B 3G7SA 3VO9A 4AKHA 1DMRA 1DWUA 3PC2A 1BVRA 3ZKAA 3RR2A 1FIUA 3ZJUA 1NW6A 4AB1A 3INNA 2D00A 2BE7A 2LGJA 3EZLA 3G59A 3GMDA 4P22A 3W3ZB 3ZGNA 1RI3A 2CLCX 5F2NA 2IH5A 3R8CA 3T95A 2PXAA 5D87A 3BWYA 4F9TA 2QP9X 1ECPA 1GSIA 1I4LD 2E4AA 3BF7A 3WLPA 5DSTA 3OJLA 5KWIA 1INLA 3P4UA 2QRGA 1AZSC 1PT8A 3S6JA 4GYJA 5DYGA 4EYEA 1PFKA 3G9XA 1P77A 5GOTA 5JECA 1J8FA 3OLZA 1YRQA 4Y2HA 2EFDB 2OESA 3OCUA 1F06A 4NZ9A 5CX1B 3N8KA 4KG7A 2V6BA 1B93A 1ZA1A 2OUKA 2BFCA 4K9MA 4KXMA 2ZBPA 3C45A 5GGXA 5KMGA 1SUBA 4FFMA 1TTPB 4S12A 4ARSA 1L0BA 1AKRA 2WVGA 2Z95A 1H0HA 2DHDA 1B2RA 3DXZA 1LEHA 1R0YA 4KQCA 4GI2A 3RHTA 3UBMA 3WGHA 3ML1A 4XASA 3ZDAA 3MRVA 3PHIA 4V24A 4WINA 3TDMA 2BR5A 5JQWA 2R6FA 2PRKA 4IDNA 3GLIB 3K0BA 4TKVB 5F1YA 3GZ4A 1XMIA 5TMEA 1CUJA 1B6RA 1GG9A 1V4BA 2QD2A 4RTRA 2ZIGA 1UBNA 3E2PA 5KNBA 4N6NA 4QDKA 4BQQA 1RXEA 4C2BA 5KREA 2EDAA 3W8FA 1E1QD 2QRJA 1ORRA 4MJ3A 3DNFA 4MR9A 2WWXA 4C3UA 4EPRA 1XD2A 3Q5EA 3UGJA 4Q7LA 4FMDB 3CLTD 2AG0A 3FHCB 2D2XA 4KK4A 4Y9SA 5DJ5A 2YYZA 4PM4A 5BWNA 2VBGA 1H0KA 4R1OA 4WJLA 1YB6A 1LV7A 1Q19A 3TECE 4CDMA 4X7MA 1T2AA 3G8BA 4FPXA 4KQHA 3WY9A 1ZFNA 2PM8A 3OPVA 4RX1A 2D13A 3RV3A 5BNIA 3SBEA 4IIYA 1C2YA 2WV9A 3TM5A 2J3DA 5T4BA 3L6OO 2WM8A 3WGGA 4AD8A 4PLZA 3HLTA 1CHNA 5F5NA 4M21A 4N0QA 1H6AA 1GL9B 1NVBA 1DLJA 3A1CA 2QXTA 4BO4A 2F6RA 4QFCA 4WUTA 1CUXA 1EINA 1PW5A 4HVLA 4UM9B 4Z5XA 2PD4A 5LQKA 1HDOA 5UKDA 1O89A 5FLXA 3CVYA 1QHNA 3L6DA 3FOZA 2C2GA 4R2XA 4UPEA 2A0UA 4EMBA 3D6JA 1TAUA 1GQYA 3HB5X 3QKRB 2TMKA 3QJ5A 3EVZA 4DR5B 3DVRX 2H4YA 3NHBA 1MEEA 4OATA 3EIQA 4QXAA 1Y5NA 5SV2A 1YB4A 1PTJC 2IE0A 4HDKA 4PLVA 4MO9A 1FQWA 2UYHA 4MKFA 4EHNA 3H4MA 3AQ4A 1H2RS 1QG0A 2BI7A 1L1FA 3OM0A 2HHCA 3CE9A 1KEEA 1WKBA 2DP4E 2C9MA 5CDHA 3O4VA 2WWRA 3ORHA 1SXGA 3DD5A 1XU4A 2LV8A 3VPHA 1PHRA 2IKQA 3OLCX 3GOHA 4NJEA 4B4DA 2IPAB 2VJYA 4JD5A 3K73O 4KVFA 5CVCA 5IMSA 3NH6A 4IKOA 2NMVA 2QJTA 2ZZKA 1CRZA 4XJTA 4A03A 5A3JA 3SQNA 3GZNA 4M8NE 4MCJA 4XLLA 1XRQA 4P34A 3T35A 5C5IA 1Y63A 4R3WA 4QYIA 1D2GA 2Y4NA 4ZQFA 3C74A 5JISA 5BYJA 2IYRA 5AHKA 4D42A 2Z2YA 1LVHA 5A4AA 3ZH2A 2FPLA 5K1ZA 1S6YA 2XCUA 4U7FA 4RGBA 3EGEA 2PUTA 1KZ1A 2GTHA 3BG5A 1ULZA 4DV6B 3T1YB 3I4CA 4CIYA 4M54A 1VPTA 2P0AA 2GSDA 2ODPA 2VP6A 1W4AA 4ZI3A 5LQCA 2NP7A 1O8BA 4RPHA 5DYYA 4FW9A 1J9ZA 4BUCA 4LJKA 5J5CA 1TMGE 5AKKA 3ZE2B 4MHSA 3WOVA 1U8UA 3HFSA 3ELBA 3AR5A 3QEBZ 4Y2VA 5ALGA 1Z5ZA 1DL5A 4O2AF 3OZUA 3RIMA 3R7NA 5BR4A 2VF4X 3I8OA 5IKEA 1J8DA 5H5JA 1QTRA 4Q5IA 5LCXA 1IDN1 2YL2A 4OHVA 4PPQA 1QF6A 3CX7A 4FYHA 5FDFA 3EPJA 3QVSA 3NTVA 2BMFA 5EINA 1F6WA 3ANNA 4JSRA 4MWEA 4D82A 1OA1A 1NMSA 2VCEA 3BEDA 2BFOA 4FE7A 4NH4A 1ZIYA 4PVCA 1O97C 2OCGA 3IUQA 1SXJA 2FMIA 2J30A 2N0SA 2PBLA 2YY7A 1GVHA 2RI0A 4YDRA 5H7XA 1H4SA 1UZLA 4R16A 3WOHA 2FUNB 5DX0A 4WH0A 2ICAA 3R5SA 4HATA 4B47A 1B0ZA 2FH5B 3KCNA 1RKXA 2QRKA 1QGDA 1BWQA 5DBGA 4L51A 1H2YA 5BW8A 4R1MA 1RC1A 1EX6A 3F67A 3NYQA 1XAJA 3QKSA 4NYIR 4RIEA 1NMXA 4XVRA 3LDUA 3ZLVA 4FB5A 3IXLA 5E9AA 2K2WA 3CCBA 4BNXA 1JR6A 1GSOA 2HXYA 3NHSA 3VC2A 2JIQA 4BEJA 2J45A 4RMJA 1XZCA 3OOEA 3OH8A 5HTKA 4WK2B 3W5IA 2VPIA 1U7PA 3CIOA 2FETA 1ECLA 2QN2A 2NXEA 2C4KA 5HQ3A 1U0RA 4KVGA 1XDZA 3OQHA 3COWA 1PFYA 1J0BA 1R88A 3UT6A 3UT5A 4M8SA 4C1NA 5HGJA 2GZHA 1J2RA 10MHA 1OMOA 4MW6A 1R9MA 1XZ8A 2BFFA 3R24A 1YONA 2FAXA 2HIAA 2SICE 3CEPB 5HFJA 1RD4A 3L77A 2L17A 2RGYA 4UBKA 4B3HA 1GHTA 1NC3A 2XADA 2OO3A 5IAEA 4D0LB 1A5SB 5DT2A 2Y71A 3TKLA 2RGUA 1Q0ZA 2AC4A 2BSAA 1JZTA 3MMNA 4P3PA 4RDHA 4DDMA 2Q5CA 4FX2A 3A6EA 4PC7A 3EG9A 5DT9A 1MAWA 1TO1E 4X8MA 1EVJA 2C0PA 3L40A 1JILA 3VNAA 4XIYA 4RDXA 1J56A 3IJPA 1ZVVA 2HQ1A 1FPQA 3DJFA 4C04A 3KXDA 3TXYA 1Z3IX 3MS7A 5JVDF 5KYWA 5I7OA 1NI3A 2ARKA 3PFBA 5E4FA 3ZE9A 3H2IA 5LQDA 5K3DA 4F6LA 4WY8A 5KYTA 2NWQA 3JVDA 1OAKA 3WA7A 1GFWA 3Q8KA 3F46A 5JYBA 3DBRA 1FUIA 4DMFA 2V0NA 4NAUA 3V7YA 4CMHA 3ACDA 1K6MA 1JEJA 1G7SA 3PHLA 1NBHA 4BOYA 2WYHA 3AF1A 3R8FA 2CNWD 5JCPA 1EFRD 4QWWA 5ER9A 3LCMA 3WDKA 4CKXA 2ETXA 1FX0B 1P9LA 2J41A 4ON9A 5EMNA 5CEEA 4GX0A 1RPNA 2CBGA 5JSZA 3OCJA 1ZVQA 5JQGF 1FW8A 2AD1A 2C7PA 3W7BA 1XNRB 3RGWS 3FYHA 1O08A 3BJRA 2ZULA 3ZWBA 2FLVA 3BK1A 2JAXA 4C2AA 4EJSA 5C1IA 2IGTA 3RJ9A 1LBEA 3T7SA 3L82B 3QVTA 1E5XA 5HOEA 1IWOA 5E95A 4IFIA 3HVKA 4R7TA 1ZBQA 3L6CA 3DFZA 4AKIA 2XUAA 3EPKA 2WHQA 4ZV7A 3OICA 4W8OA 3RJ5A 3C6BA 1BJTA 4UOEA 2P2NA 2K7FA 4DIDA 2XB2A 3N87A 1G6KA 4L3WA 3STUA 3WNBA 1BE0A 2ZIFA 2OBNA 2OHIA 3OI7A 3UJAA 4INAA 3BDIA 3CW9A 3I6BA 3MYRA 2ZIWB 2CJPA 1SKYB 4GZLA 1I1NA 4A9AA 3DWEX 3BC1A 1XXHB 2BTOA 3DTYA 2Y1FA 2Z6UA 3F3SA 4Q9HA 2OHXA 1GRCA 4XSGA 3RIGA 4EYGA 1XC7A 3E9EA 4JAVC 3DMPA 4TQUS 4UM7A 1W52X 2EV9A 3HCRA 4KRGA 3X3HA 3GUVA 4C6SA 3JQAB 5G41A 1U7ZA 1G9SA 1W76A 2OT3B 2C2WA 3KG2A 3VU0A 3HN6A 1UPBA 4IH4A 2LCIA 3OX2A 1VE6A 5ILOA 1W9HA 2JJ2D 1VMKA 3PFGA 3T5MA 5FBRB 3B1KA 3QE3A 1XXHA 5K7SA 3OY2A 3SLRA 4BNWA 3JD1A 4MDFA 1XZGA 3I83A 4MO2A 4NXMB 2EJWA 1JE0A 2IUFA 2L19A 2YICA 3O8OA 1KY5A 5JYDA 3FTQA 2FSGA 2WLTA 4CM6A 4B7XA 4Q9JA 2WHXA 2YYYA 4U63A 4F3CA 1AK2A 1NXTA 3BICA 4HWRA 3W4JA 4OAPA 1U3VA 1XRMA 1CRWG 2H85A 1R10A 3UAYA 5A62A 4PBSA 3BCSA 3M5CA 3AR6A 3DO8A 2XTAA 2HU8A 1DX4A 2RBKA 3HDGA 3HKCB 1SFRA 4AWBA 4D3SA 4IILA 1XOIA 3AEQB 2C88A 3Q85A 4EYKA 1X80A 3A05A 3AVWA 4LOKA 1ZCZA 2IXAA 3OT4A 1IWBB 3R40A 4FN4A 4NABA 4XUCA 3WQHA 1UJ5A 2H29A 2VBCA 3IIJA 3BWXA 5C7IO 4M7PA 1JKMA 4J9UE 2IIQA 1LWNA 1JAZA 5KOHA 2P2GA 3G13A 1CUWA 2VHQA 2F8LA 3JW8A 3LXXA 3BJIC 4LJAA 3WG9A 2XVMA 1SY7A 2W8BA 1TM3E 1L7AA 4A0QA 5AVSA 3PG5A 3ZOKA 3LU1A 4PANA 3V55A 7REQB 1N9ZA 2QMUA 4ZCPA 1IH8A 1W1UA 4KP7A 2XB4A 4JR2A 1UUFA 3DOJA 4RIHA 5D3MB 5IKOA 3RIEA 2Y4OA 1XTBA 1FFXA 1P0FA 2HNBA 2QZPA 1J2TA 2VHEA 3NYWA 4JBIA 1ND6A 4W5WA 1UJCA 3AJ9A 4PZPA 2M6KA 1XHFA 4CQLA 3TEJA 2BFNA 3GBSA 1E3EA 1C8KA 2W6PA 2VDNB 3L0CA 2B4QA 4HCJA 4IBOA 1COWD 1CUEA 3N75A 3ETNA 1F2UB 3VPSA 4FSXA 3D7LA 1T10A 1WO8A 2GRUA 3EQ6A 3FPGA 1Q0QA 3WB2A 4HB2A 1J7KA 2J67A 2D7JA 5I4BA 1FXUA 5ALRA 3E1SA 3NUZA 2QVBA 3D4NA 3QV1A 4H1WA 2VYFA 2FPPB 4H18A 2QSYA 4FMBB 1CY4A 3W6PA 4TROA 1TTHA 4L5CA 4LPSA 4NENB 2W6CX 3F5MA 5AJYA 4D98A 2JJ2A 1TW2A 5BYBA 3ND9A 4QVGA 4DB2A 4BLWA 4K40A 3A2KA 3C5VA 3DAYA 1K27A 1MTZA 1IBSA 4P82A 4PYJA 3ER9A 4CLOB 3VKHA 4D43A 3EXIB 1AN9A 4ZFNA 1EKXA 4ZQCB 1TCVA 3ZBPA 2NZJA 1SUPA 4U00A 4BGIA 5F3WB 2FKNA 2Q0SA 1H3EA 4RVUA 4BBJA 4Z99A 2FG6C 1G4AE 2OXFA 4QO7A 1DHRA 1UQTA 2PWZA 4R7GA 1YE5A 3E27A 3QXJA 1KU0A 2BP7A 1SXJC 1EP1B 3TL3A 4CL8A 2I4TA 1T5SA 1V45E 2G0AA 3FMPB 5B2ZA 4WLUA 4E13A 3SZUA 5FLEX 1E64A 1XGKA 1H9CA 4IJMA 3GGSA 3HWRA 3PJGA 3FYUC 4GDMA 1U28C 4Y2YA 5A2GA 4WIAA 1ISHA 5LB2A 5B3LA 2J6BA 1EG2A 4IUBS 4XQGA 3FNBA 3CQ9A 3HI4A 1JT9A 1P17A 2SBTA 5FOVA 5JS2A 2V3CC 2HW8A 2WTBA 3HRHA 4M8IA 4XEHA 5J1TB 3RREA 3QLTA 5IYZF 2PBRA 1NPYA 3CF2A 3KR2A 4OSPA 3TX6A 6NULA 1UWKA 2AR0A 2Q45A 2QZ4A 2X9NA 4G1EB 3WP1B 1SUIA 5GVSA 1ZJZA 2QRMA 4ZP1A 3IKTA 2C8VA 3B2NA 1YQDA 3NC0C 2ETVA 1T5LA 4ZZ2A 3DDWA 1P45A 3CO5A 2I67A 1US8A 1S0UA 5FP0A 5DI3B 3GCXA 4C03A 3W4KA 3C5EA 2FDCA 1EFRA 1GNQA 3CEJA 3NV7A 3CH7A 2HRZA 3GROA 1S02A 4U6NA 4UUMA 5AKGA 3MF4A 5CH5A 1KBOA 4P4SB 3TSCA 3G5AA 2Z5FA 1NKTA 2FWBA 2J7KA 1ZINA 3QVOA 3HH8A 1R8QA 2PMWB 4NMXB 1ISMA 1EXWA 1WKVA 4L8LA 4EHHA 3VPAA 1LK7A 2X2FA 3MAAC 4IDHA 1U04A 1G5QA 1OKKD 4Z54A 1UINA 3AESB 2AOUB 1D7OA 2Q2VA 4W1SA 4CG3A 2AG5A 4PV7A 2CVQA 1V26A 4HY3A 3K0SA 3PDWA 3ZC3A 1G8JA 2V6GA 2PUWA 1F4PA 2DU8A 2X5KO 2XUQA 3OE7D 4JLPA 4TLBA 1A9OA 4YCDA 3TXXA 3WL7A 1M1NB 4TRMA 3E9DA 1RAIA 1ZD5A 4GKJB 4RBNA 4XM2A 2PSDA 2Y1WA 2A0YA 2Y2UA 1Z2AA 2SCUB 5G0UA 3ZNOA 4MKGA 4X1OA 3PRYA 4DDVA 2JLUA 3ENWA 3FCXA 4BE7B 1T4CA 3KK0A 4GXNA 3ZIDA 4F04A 5C8VA 5JJLA 4YJGB 1AH2A 1CRPA 3LPCA 3LT2A 5CNMA 1KEZA 4L6CA 3VPXA 4P98A 1SOMA 3EEOA 2RHDA 3OIGA 1KMQA 1CIJA 2G5CA 3DF9A 1ESEA 5FQOA 1ZONA 3OMWA 4H7PA 3WC4A 1L4NA 4B3SB 4UUNA 1E3DA 4HGZA 2IUTA 5EMLA 4ASUA 4FT2A 1X92A 3DAFA 3DE6X 1E9VA 1JS1X 2H59A 4EF5A 2J3LA 3BD9A 3ETJA 4IJQA 5JMWA 4UM5A 1V3UA 1LLDA 4IEFB 2IV7A 1N92A 1CZUA 2YVQA 3ZWQA 1H8ED 2WTUA 1KSFX 2DBRA 4N8SA 4DLZA 4HNUA 3ZK9A 3PX7A 2O05A 3EVTA 3OT1B 4LE1A 1T35A 3D8RA 2X1MA 5DHTA 4IIDA 1TF5A 4S0XA 2VF5X 3AI2A 1T15A 4B3FX 1A76A 3FLAA 3UJHA 5ALKA 4DBVO 2JGRA 1JBKA 2XMGA 1AHHA 1GG5A 1OFTA 3W78A 5DYWA 3TQHA 1T6NA 3D3QA 3EH2A 2B2XA 2OFPA 3P4YA 5K45A 5IVKA 3QEKA 5E8RA 3ZBTA 5LPNA 4XQCA 2WU8A 3HDHA 2I1QA 5I4CA 1D3AA 1VGQA 4TQGA 2HEIA 2E0IA 4KMSA 4OSEA 1G5FA 1K6EA 2J9ZB 4KX5A 4CQMB 4HNAA 1ZOOA 1KKMA 2JC3A 2UUOA 3DVQX 2QJWA 1SHUX 2F17A 1LB1B 3MJDA 1QC5A 1Y4AE 5F3DA 4N7MA 5LQUA 5M34A 1XQ6A 3Q5GA 3NH9A 2HUNA 2V7QA 1JLLB 2CBZA 2I4MA 1Y3AA 1BYUA 1XA3A 1ABBA 2NZ8A 1TU4A 4J43A 5L6LB 1ONSA 1P29A 3O83A 4AY4A 5KYYA 3OFND 5DRYA 1JB9A 1P1HA 3IUMA 4FEYA 2FMUA 5DASA 1DU4A 3ME5A 4K86A 2WF9A 1L3CA 1HDRA 3JD4A 4TPKA 3TKAA 5KOJB 2OEPA 3QPBA 4ZYWA 2ZRMA 1RAAA 3TUIC 1MZPA 2EZ9A 3WVNA 4FZ5A 1XLTC 3EDRA 2YJGA 3IAM6 3PD1A 3EC1A 2C2HA 1VKNA 1Y4UA 1KVTA 1GTVA 2I3BA 2LPMA 3DV9A 2RH5A 1U8EA 4KWEA 4M0CA 4O2BB 3WRXC 1GUAA 5JDCC 4EBBA 3A37A 1TPZA 2O7NA 1SVLA 3FMVA 5BVGB 1FU4A 2V7BA 5IH7A 3P4XA 1T2UA 2FV8A 3L0SA 4ZCIA 2WINI 2QT1A 1GYQA 3KELA 1X42A 2AKAB 3L0IB 5DLPA 4BC1A 3IGFA 1D6JA 2R66A 2HA2A 2NW6A 1QO0D 4GFDA 4B7CA 4TYWA 3MIIA 3ZHXA 2IFTA 2Q5FA 4YO7A 3R6TA 4L4RA 3FPLA 1Q1NA 1LF5A 1LI5A 1B42A 4IIVA 5MFPA 1MAVA 3MNFA 3REQB 1WZCA 4B5LA 3IALA 1NFQA 4FBGA 5FPPA 4W9NA 1FEZA 2DT8A 5D2CA 1X39A 2QYHA 9GPBA 1E61A 3LX6A 3REOA 4B71A 4I55A 4MIOA 3SYRA 5J2TB 4QJ3A 4HEA1 4QT4A 4E4TA 1KH1A 2HSWA 1NVUQ 3KAPA 5A04A 2VKQA 4D8WA 3KYIB 1PL8A 1FYXA 3R4CA 1EWVA 2INGX 2YQZA 4S1OA 4OHZA 4F4FA 3DBOB 1P80A 1M6VB 3HJFA 3BXPA 4KOEC 3AM5A 4TYMA 3CH5A 3MWKA 1EXMA 3JZMA 1JFTA 3A1VA 4AJ1A 1T4CB 4TKLA 3AOEC 2PZMA 5DK6A 2P4UA 3L1JA 3W5AA 4KJZA 2WUEA 1Q20A 3C3BA 2IJGX 3FNIA 3H75A 3KLBA 3O4IA 3ZHUA 1QAOA 3LVFO 1XA0A 3ADCA 2AOTB 2J08A 3EZ6A 3RYCB 1JP7A 1IBMB 4WXYB 1JV2B 3K05A 1CZNA 2B5OA 4ER3A 1L5HB 2B21A 1I94B 2GJAA 3QVMA 2YMPA 4G9EA 3PQCA 1DADA 3JZAA 3R3ZA 2BE9A 4L74A 4P2BA 4N4AA 4AUMA 1D8TA 4HQFA 4GI7A 2NPIA 2O2XA 2DHEA 2YN4A 3SBDA 2AYYA 3D2AA 3WYGA 4Z9FA 4ZVPA 2GPBA 4R9RA 1U5AA 2PKCA 2UV8A 4A8JC 2VTDA 2BJHA 5ALXA 1CG6A 3R7BA 1DAKA 4LOHA 1GY8A 1YDMA 2FRXA 3MIZA 4LSZA 1JT2A 3PUZA 1TQDA 2WBLC 2QIPA 4HNRA 5BSMA 2VSNA 2HMWA 2OOKA 2P69A 2ZAGA 2IHVA 3AKCA 3F8TA 3H9JA 3LC1O 4BFLA 4JC4A 3GGPA 1OZGA 4MV5A 1IC6A 4NBNA 5ALIA 5BN1A 4M9QA 4TT8A 4PYMA 5CA0F 1WF3A 1CE8A 3DW1X 3TW4A 1W5TA 1SCBA 2ZTMA 5TS2A 3SS7X 3ZZ1A 1ZCFA 4W9RA 4EARA 2ZDGA 1U0HC 4AJNA 1OIVA 4ZGWA 1T8RA 1Z28A 3CGWA 1ZR2A 1GL3A 1QNFA 2FJ0A 4QHYA 3V4VB 1G20B 2VYNA 3H2ZA 3LD9A 5DDIP 3ZWKA 4RSMA 2CDNA 4PG6A 2CXPA 4H3KB 1KYIA 5J58A 1LU9A 2OLKA 4CDGA 2X0RA 3RUIA 5BMVA 1NN3A 2VSXA 2JI8A 1YOVA 3VRHA 1D2RA 3EF1A 4MKHA 2HQRA 4UNRA 4V38A 3AVUA 3CUTA 1G3IA 2CXXA 3QVGA 2PKYX 5KYXA 4B3GA 4DHWA 3GVCA 1VJCA 5CXXA 4YT4A 2WPDA 4F4UA 2C5SA 3F2VA 5CA0A 1Z4JA 5K3EA 1S9HA 1II8B 2A1UB 3QLJA 3U48A 2EFYA 4LZAA 1D5WA 3EXFA 5AW9A 5JAHA 3R3WA 1IY1A 4LZZA 1IU9A 2O1EA 4MUAA 3EPPA 4N39A 2D5CA 2EAUA 5GWXA 1FVHA 4AKEA 4G5GA 4RJIA 3FBTA 4RH3A 4GP9A 3UATA 4B6FA 1QZXA 2P77A 3PJRA 3GUUA 3IESA 1CY2A 5G1NA 3B1JA 5HDQA 3FOWA 4HQRA 4JDPA 1PLKA 1ACLA 3IP9A 4R54A 2F1HA 1E2DA 4LC1A 3GZNB 2H9YA 2Y0DA 5EA2A 2Q5OA 1GPDG 4EK9A 2QV7A 3SQXA 3ISVA 1PTKA 3I34X 2C5FA 2P1RA 5ALJA 3WYNA 5IDXA 4OLBA 2BFWA 1LNQA 3GQBB 4K0KB 2H18A 2ZSIA 2C42A 3A32A 3K2IA 3P0JA 4Q3DA 2V7QD 1DOAA 1ISJA 1KIFA 2XVAA 2LCQA 1JVBA 1P1KA 1KI1A 1YBVA 3EGCA 4PIVA 2QZ9A 3WKDA 1AZLA 4BKMA 5CA1F 5L9AA 1T4GA 2MMCA 3MAJA 3UAZA 2M6SA 4C7BA 1FRFS 1Z34A 3FZQA 4PONA 4R9UC 4CLDA 3BH0A 4I6GA 1P3JA 4LHZA 1WDWB 4HAUA 4FYIA 5DZSA 4IXNA 4IOJA 2FEAA 3FCEA 4M1QA 1VKZA 221PA 3DEKA 3I04M 5ERYA 2QNIA 1GNTA 2UXBB 2QQ0A 3WK7A 3VTFA 3VC7A 3ROXA 2XI4A 3OJWA 3KDAA 4ACAA 4ENUA 1MVOA 1ZYUA 4G0QA 4MQEB 2NU8B 1B3RA 5E6RB 2ZOSA 4TYPA 2XSZA 4IX1A 5FFMA 2COEA 1VMDA 3TIXB 3STTA 4L9AA 1PDVA 2F62A 1U2DA 1CUFA 4WE3A 3GK3A 4K26A 4DYHA 4MWSA 1JEOA 4CKEB 2A9PA 4R83A 5ALPA 4M9XA 821PA 1ZH4A 2FSPA 2GVDC 1Y3BE 4GDFA 2C1XA 3T4UA 3VPBA 5EE3A 5C8YF 4NMHA 5KKCA 3OP1A 5G4LA 1SGWA 3JQBA 5AVKA 1EXVA 2HPAA 2VT6A 4EHAA 2MYUA 3MUEA 4DLTA 4L2IB 5HA5A 3DWGA 2PTGA 1OKKA 1OXTA 2P3SA 2JFUA 2DFNA 3VI3B 1Z36A 3GRAA 3P5BA 4RMIA 2SCUA 2DY0A 1T2NA 2PIDA 3W3AD 1SOWA 4HMQA 1WX1A 4PLTA 1UBMS 1OY1A 3STXA 3VSEA 4JLAA 2BUCA 3R9KA 2P8JA 2O3UA 1N75A 3AHJA 1QV6A 4LXXA 3DKVA 3I2JA 5DBHX 2ALJA 5AVQA 1Y9JA 2AMFA 1WXIA 2PCLA 2IYWA 4F91B 2RH8A 3QBDA 3UC9A 3V6MA 5F1OA 4WXHA 2PTHA 2DFLA 3KKEA 4G8DA 3VO8A 1CWUA 1P3Y1 1YA6A 2VTEA 2X9LA 4IS2A 4XRRA 3X1MA 3WWZA 4NBSA 1L8AA 1TU3A 4A8JA 2CXTA 3KCQA 1NF2A 3VR3A 1Z4KA 1BNCA 1B8PA 2QG9A 1KR2A 3GLFB 4CIDA 1ZVMA 1DBQA 1GU7A 4CQNA 4MR9B 4TMYA 1BWRA 1OVMA 2QN3A 3IKJA 1V1JA 4H59A 3WGLA 4BVHA 1Z2PX 3C8MA 4RMNA 1XT6A 4PZ0A 3EFOA 4U2FA 2JFPA 2BHRA 3GEMA 2I8AA 4ZEVA 1MX5A 4M3NA 1EGQA 4TZ6A 1I3MA 3IDFA 1UAGA 4JC0A 1QCDA 3OPNA 3PR2B 3CBGA 3ZU4A 1XVAA 4NIMA 1FNBA 1JHQA 2Q3DA 3V1UA 4M0KA 2G71A 1II8A 2WIFA 2X23A 2QG4A 4TS9A 4G0XA 1CIPA 3B36A 3PQ2A 4MGZR 3JCZA 2QMYA 5JSYA 3EBPA 2PD6A 5C5CA 1RQLA 5DOVA 5LQMA 3ZE6A 2F1OA 3G5UA 4WN9A 2Q0XA 1ZWKA 1JF8A 2BBWA 2IPLA 4NEQA 1QMGA 2BIFA 1ISFA 1YVRA 2R62A 4X00A 4ZTBA 1GKLA 1ZM2A 2O2ZA 3T1NA 2ZBUA 3M6WA 5JBNA 4UTRA 4NP6A 3DZDA 2AJLI 3Q5DA 3A04A 2ZG6A 4TVKA 3ZW8A 2KJQA 3OEHD 2I03A 1MBZA 1G2QA 5BNFA 4DCPA 3MJFA 3LW8A 4UZFA 1HTTA 4BWFB 4D1YA 4EEXA 5FAKA 2P9JA 5BSFA 1XDUA 1ZL0A 3GVIA 1AUQA 1L5KA 2P3QA 1TADA 1X1DA 5ALNA 3ZU5A 4YCCA 4KHPB 2VDWB 1N5MA 1LK5A 5GOZA 5T5QA 5HQTA 5LQSA 2JFFA 2HDHA 1KH3A 3WK6A 2LNDA 1YUBA 3NUGA 2MWMA 2AV6A 2XKAA 3L7CA 4KFSA 4PLHA 4V0MA 5MHTA 5KSWB 1S89A 1HL3A 4FINA 3TFQA 1MO2A 1DKQA 3UJ3X 1BZYA 2P5UA 2V7EA 3HVHA 4QOIA 5DM70 4OHKA 1L4HA 5ARCA 4IDQA 3Q10A 3IOYA 1HFJA 1JFRA 1Q7GA 4FC7A 4DWVA 1ZUD1 1Q0TA 5LZ9A 3L79A 4GBGA 4IGAA 2O8CA 4AY5A 2OR3A 1QBKC 1QYRA 5FWYA 3U4MA 3FKSD 5CBKA 1ZXXA 2GYVA 2OLEA 2B6NA 1IQPA 3KL4A 3K9CA 3TIGA 3T3GA 2O8BB 1RRKA 1E6EA 5CLLA 1IZZA 3DOHA 1XU7A 1X77A 4C4SA 4C6RA 5DOZA 4FNAA 3N1UA 2QE7D 3VAAA 1T26A 4JYBA 4WL0A 4KAFA 5JSQA 1Z62A 5EFZA 4MUBA 4PW0A 5AT1A 2VXYA 1RRVA 2HWXA 2QTLA 3ZZNA 2Y1GA 1DRKA 3VKUA 3VPCA 3ECAA 4JI4B 3H9CA 4G97A 4D44A 4O02B 3B7WA 4BC0A 3DDZX 4ND3A 2Z09A 3E18A 1VJTA 1KAOA 4OQLA 3DCYA 4BAGA 2H6EA 3BWEA 5EMMA 3VV2A 5JDIA 3VOTA 3L84A 3AVTA 3C1TA 4WT7A 1NAHA 2EHDA 3LQFA 3TLCA 1JQJC 1I32A 4MLZA 1GQRA 4M1SA 1DTSA 3DBHA 3G1WA 3T61A 5KTSA 1ILEA 4YC7A 1UJ2A 2R48A 2ZETA 3DEIA 4X1YA 3PQ3A 3QJYA 1JG3A 3JYNA 2Q9CA 4KSBA 4RFLA 2H4HA 4C7XA 4D4LA 4Z7JA 1B00A 1J2YA 5AXAA 1NDQA 3TCNA 5BSVA 3VR0A 1KWGA 1E79D 1P4RA 4J0QA 4Q1DA 2N47A 4U2CA 4Y0AA 3JVVA 5EWMB 2KW5A 2GLXA 2ZFUA 3ZI7A 3AVXA 4BN4A 4CCAA 4FOSA 1FYVA 3VR6H 2ZEJA 3UWKA 3HADA 3NVDA 4QJ5A 1DRVA 5ENVA 2ZYIA 3UK2A 5CXQA 1AXEA 2BLLA 3LM8A 1CW2B 2ZYHA 3ENKA 3ISJA 4AP9A 1GPYA 2R79A 4OQXA 4P4NA 1TYDE 2ZR7A 3MS4A 3VHLB 1G21A 5DHAA 5JNLA 4Z1MD 4D0SA 3K70B 2OG2A 2O5VA 2JGMA 4QUJA 3NOQA 4IDPA 5AI8A 3FRJA 4LXHA 2JF0A 4R51A 4LOJA 1KIAA 3OTOB 2VC2B 1TJ5A 4BUZA 2FPGA 2VIIA 5IUNC 3N0TA 3PDIB 3R74A 1OBFO 1U4NA 2MOKA 5DKFA 2J07A 3PL5A 1WW8A 2V7TA 2FVXA 1YBHA 4KWHA 2IIPA 5EWLB 1SVKA 1BXRB 1PWYE 2J0UA 4Q1AA 4TRJA 4ZJZA 3D7RA 1V8BA 5G3ZA 5LQRA 2GJSA 2B4TO 2FOXA 2QRLA 4FZ3A 4Q4DA 4OIFA 3K9FC 5T3YA 2CWDA 2I99A 4BB6A 3OD5A 3C6KA 3E9YA 1WV1A 5LZ2A 3FHJA 3LCVB 1M6EX 4F8EA 1G60A 2KPOA 4DLLA 3MXTA 1ZK4A 5KYNA 1NR5A 2FRDA 3O8QB 3T5BA 4E5KA 3FFXA 3HCEA 1SQGA 3V7FA 3DPIA 2K87A 4H1TA 3R09A 5GIPE 1XYVA 2D0DA 2ANCA 3EIOA 3FTNA 2I3DA 3VR3D 1U90A 3T34A 2Q8QA 3U3XA 4LEIA 3RFTA 5DNYB 1U28A 2QPOA 1DOZA 2E89A 5AHWA 2HK6A 3EXFB 4PYIA 1C7QA 1CQJB 3Q0TA 4MKIA 3BE6A 4RQUA 2JFHA 2XSZD 3V3TA 4AZWA 4NDAA 2J48A 1UMCA 5L6MB 1B8VA 1QIFA 3C39A 4A15A 3UK0A 2GM3A 3MTJA 1DDGA 4LJYA 1OX6A 2O5RA 2NUAB 4AF7A 3SGLA 4AN4A 4OQPA 4EHLA 1M1ZA 1MFZA 4NI5A 4DDTA 3SYTA 1USKA 2CCGA 6Q21A 4V02A 1BN7A 1SXIA 1VG1A 1VM6A 2R6HA 2R6CA 1T2FA 1Y1RA 3N2LA 4N1AA 4TMXA 4YQEA 5J40A 1Q77A 2GEJA 3L6UA 5DTJA 4ZKDA 4LF7B 2RBGA 2WKPA 3CVOA 3IUSA 4O4HF 4CV0A 1MOSA 4DV1B 5L95A 1QLJA 1VYTA 4BWVA 3A2NA 5LA6B 2C9BA 3T5AA 2BHLA 1PK8A 1W19A 3B13B 1GN8A 4NCKA 5E0KB 4JI8B 3DCNA 3DW3X 4B7UA 2UZ4A 1FFAA 1DEXA 1UMDA 3KQQA 3EVCA 1VSQA 3LC2O 1CTQA 1PCXA 1XVIA 1Z7YA 2V6FA 3KWMA 4JJ7A 2HNKA 4PAWA 6PFKA 2WU0A 4RPIA 4DSOA 1NFFA 3TDNA 4GEGA 1YL5A 3IP1A 1XZQA 2CXNA 1RADA 1T1IA 2PLNA 1E9DA 1RTTA 3BD7A 3E7XA 3IE2A 4OXKA 3DLPX 2F1KA 3I30X 1ZG3A 1WJGA 3DKRA 2PL9A 3GLTA 3P26A 3RU3A 3ICPA 3L6RA 1X1TA 2O07A 4YMLA 2X0IA 3H5TA 3IP5A 2ZIAA 4U7DA 4HH4A 4K0RA 2CNBA 5GMOA 3SBOA 3VZQA 1NI5A 1UFOA 3L7NA 4MYTA 2L82A 2VDPB 4HS9A 1HMYA 4TTVA 4YAEA 2GARA 4H7EA 2FSHA 3IVRA 4B87A 2PH5A 4GHWA 2DFPA 2D6FA 3QE9Y 1QMPA 3KIPA 3H2SA 1JHXA 1NBEA 4BMZA 5BRNA 1Z8NA 4MVYA 1HOTA 1QDLB 1IBRA 3NDJA 4FYYA 2JVKA 5A4IS 4ZAGA 5E8JA 4O3FA 5EHNA 4IXTA 1Y6GA 5EQJB 4M37A 4MUXA 1HPLA 3QP9A 3SR3A 3DL4A 3K8YA 3TOSA 1N0UA 5DPMA 5HQ3B 3P96A 1M66A 2YBEA 3GEGA 2DHCA 4OMFG 1UM9B 4J4BA 2RGXA 1AD2A 5YASA 3LHSA 2ZB4A 4KTVE 4UU7A 3JAMA 3PXCX 1NYLA 1UBRS 5KTTA 1EK1A 5D5QA 1SUDA 4YBRA 4E09A 4JBLA 1EXDA 1H6DA 3ON5A 1T9BA 4N6OA 2XTNA 3HDVA 4QOFA 1JPJA 4BECA 1UZNA 1V48A 2JFGA 2ZIVB 3TCKA 1G8HA 4YRTA 3OCVA 1WE2A 4KB5A 1YR3A 1ZGJA 2HMYB 2YXPX 2GWHA 4XUGB 2GM9A 5DBIA 2BGNA 1UP7A 2QTFA 1PGNA 1WCXA 2HDNB 4F3NA 5COBA 5KTNA 3TLBA 2ZUVA 1G8PA 4OP3A 1XFDA 5FR1A 1BXRA 4WMLA 2BEVA 3BXXA 3QSGA 5COAA 1WZIA 2BMAA 4BO6A 2C5GA 3QX3A 4ZCMA 4B73A 1FF9A 4UNNA 4A91A 3WYDA 1BAPA 1LNZA 2FP4B 3A3YA 4UEOA 3ZUPA 1V5FA 3E03A 4MCHA 4QRIA 1Y9EA 1EDEA 4KKXB 2GBFA 2ONCA 3FTDA 4MX8A 4Q9LA 3FRHA 5T67A 5HJ5A 1YFKA 2HT1A 4AJLA 1QRSA 2GPWA 1NJ6A 2YRXA 3O8QA 3RFCA 2OA0A 2WSLA 4HWGA 2PAAA 4RLFA 3QE0A 3RVDA 1R8YA 2MCFA 2O19A 5BV7A 1YQGA 1JI0A 5FBWB 2JRCA 2WM3A 4F3RA 1EK5A 3VDQA 3M2PA 4EB3A 1F4LA 1ULAA 1RRFA 2B8TA 2ZYSA 2DWQA 3B53X 3QBJA 3T1TA 3ANLA 3K16A 4G81A 4DNQA 2YQ5A 2OCBA 5EJAA 4K6CA 3HGTA 4PRYA 1N3BA 1TDJA 1YUNA 2WFAA 5DU2A 3C8UA 1W94A 2M9MA 1R6VA 4GNKA 4X3OA 1P1FA 2H3EA 4NCJA 1PS9A 3GJ6A 4UHEA 3DM9B 4W5TA 2Q0QA 3NVMB 3QU4A 2ECPA 4WNAA 1YR9A 4O5OA 4QDUA 2A7QA 1XQVA 1NMZA 2CDAA 3W1EA 1S5PA 1HT3A 3BGDA 3M7IA 1MH1A 1RXCA 1MR3F 2PSHA 2XF2A 4MSUA 1QH8B 4K9LA 2GRAA 5EQTA 3LBIA 1OPRA 2ZCUA 3UFXB 4R05A 3C1AA 3P8ZA 1FSGA 1B6TA 3AONB 2JZCA 3D5TA 3KFLA 4JQOA 4NCHA 4ZMRA 1EP9A 5CB0A 5BWCA 2WE8A 2OO5A 2Q4BA 1BDHA 3A4LA 2J5KA 2Q6VA 5AJUA 3L9XA 4RXUA 4PHTA 1XCPA 2B9VA 3VXKA 1J5XA 2O20A 4MPPA 5GONA 3RPEA 1YCDA 2A5FA 1T8WA 3O8OB 2IOFA 5K3FB 2VNIA 4WV3A 3BXZA 4NE9A 2GILA 4Q15A 3HVUA 4CIAA 1ZHOA 4KXVA 2C5LA 3CUEF 3PEWA 4W6QA 2G8LA 3HWSA 2X5OA 5FNVF 4AW9A 1LLUA 4PNPA 4LV6A 4Q3OA 5BT9A 2WDZA 4JL5A 2D0IA 4RV4A 1YUMA 2IQIA 1BGVA 5D6NA 3DZBA 1XMOB 3LECA 5J4LA 1VECA 3F3KA 3DZFA 2O3QA 3CT6A 3Q7RA 1QLWA 1N0WA 1Z13A 3VR5H 4RPLA 1I6KA 5CFZA 1M8GA 4F7DA 4MB2A 2ZSEA 5BQFA 1RTKA 5B64A 2WKSA 5FPKA 3LY8A 1PG0A 3RAGA 4A0SA 4AL4A 3UB4A 5AM2A 4MWOA 1G42A 1A5AB 2C59A 2FNAA 4ZV4A 5B3JC 2QTTA 1J0DA 2Y99A 1DJQA 3NO4A 2ZTUA 5MDHA 3RH0A 1H5NA 4GX5A 4JMLA 5K9ZA 1OBCA 1YWGO 1ZRSA 1VHWA 1C1XB 1C8BA 1JQ5A 2QLMA 1JPVA 3GB9A 4RPJA 1WD5A 2ZP1A 3A9CA 3HEBA 4KR9A 1Y6RA 4I2NA 4C05A 3U4IA 4O4JF 4H0NA 1W34A 3ZQ6A 1QIJA 4IJ6A 3LDFA 1EEHA 1EFLA 3U3OA 2V54A 1J1IA 1SPXA 1YRYE 4PO8A 2RHHA 3O0DA 2P67A 4WGFA 4XEUA 1VSTA 2GR9A 3CJQA 4OMDA 3VR4A 4TL6A 4KIGA 4YCNA 4KXFB 1X15A 1D2MA 2AC7A 3WIBA 1IPEA 5KHLB 1XF1A 4QNRA 3DEHA 2HWKA 2REBA 4BBAA 1BOOA 1PD1A 5JCOC 4ZC1A 2VK2A 3DQZA 3TAXA 3TPZA 2EFJA 3ZDBA 5K6RA 1P60A 3JYLA 3IDAA 5AM1A 6AT1A 4IICA 2YXDA 4RZXA 3ROGA 1R6UA 2GNAA 2V58A 4Y2GA 5KYKA 4RM2A 4KAJA 1JALA 4N7JA 2ZRKA 3EGOA 3FETA 1KQNA 5AHRA 4ND2A 2ZB2A 1ULTA 2O0MA 1JJVA 4MLPA 4FKBA 2VOEA 3QVXA 2HSDA 4QL3A 1ZU4A 3SLGA 1SQ5A 4CEIA 4Q19A 4DANA 1W4ZA 3W5VA 2LZ0A 5HRUA 3VKFA 3F6YA 3CMCO 5CGQB 1QPBA 1LJ8A 4HGQA 4X71A 1ZI6A 4AO6A 4DR4B 2VNSA 4KQGA 1JHOA 721PA 1XMVA 3KYJB 5IFLA 1B4DA 2HFJA 3CEMA 2FW7A 2XD4A 1CK4A 3MPOA 3WV5A 1ZGAA 3G8CA 4TWIA 1Y9ZA 1FDSA 1NL3A 3S1AA 1X94A 4X5OA 3HNRA 1OVGA 4D9HA 1VOTA 2A3RA 2OLJA 3O4RA 1Y1LA 4IDDA 5LP1A 4G23A 1WPGA 2OXTA 1P5RA 3UT5B 2I6TA 5DTIA 1KSGA 4FFRA 4IMIB 1UBKS 4F2WA 3G79A 2ZAOA 2H2WA 3KLNA 4JQYA 4MJ7A 4EIWA 4WKOA 3W5UA 4CJXA 2MHCA 5K4GA 2ZJ3A 1OXXK 2WT9A 4H3VA 5JWRA 4LJ4A 2PBZA 1C2TA 1JDUA 2PPLA 2YWDA 4I8IA 1CB0A 1U6KA 5ALYA 1U1GA 1UC5B 3OD1A 4TLAA 3WXMA 4S04A 4ZODA 3PC7A 4AKTA 3KVVA 2PLWA 3LX4A 1JIVA 4GLFA 3T8YA 1IY0A 2H5LA 3FPHA 3ONDA 4RLQA 3WHLA 4C5AA 2IKSA 4MRMA 3U62A 3FDJA 1N9GA 2XQIA 1NBMA 1C7ZA 2QXYA 3M6MD 1KP2A 4XX1A 1XK6A 4Y1GA 2F3RA 1NUHA 1UBEA 4KQIA 3ZIUA 4RZSA 3ZJVA 3V00A 4EVIA 4FUTA 2R751 2QAGA 3SJBA 1MB2A 3QPUA 1GDDA 3FGOA 3Q1LA 4G9BA 4MAMA 4OP2A 4WXMA 3LZCA 4D0NA 1MJGA 1E69A 2VYVA 3NHAA 2C4WA 4JJKA 4KH1A 1KDYA 3DLHA 1Z8FA 1IZ8A 3HKDB 2VJOA 3M9XA 1P1BA 3UHFA 3OX3A 2I1LA 4R2JA 3TX2A 2XCLA 2X42A 2E1RA 2VBFA 3WL5A 1FCJA 3IUBA 3X43A 4GZ6A 3IR5A 3O8BA 5SICE 1JQLB 5T6MA 4I4TB 4L5YA 1UMDB 5CLGA 1T8UA 5TMDA 4DUYB 4Y1EA 2QHXA 2DUUA 4TVSA 2GFIA 2DM6A 1RYDA 1ZSNA 3IBSA 4OBXA 4AJEA 2ZTSA 1NI4B 4R1NA 1T9GR 5HRAA 3EWSA 2EJCA 3UAOA 3SC2B 1TF2A 2AZMA 4IIUA 1M8KA 2AI3A 5BWBA 5L45A 3SF8B 1E6WA 4ZU1X 2HSGA 4OQQA 5FOUA 3UHJA 3H8VA 5HF8A 4CYMA 5J43A 2VHJA 2X9QA 1WKCA 4FN5A 3SEAA 5C5EA 4LMPA 5CBPA 5HRCA 2WYIA 3V2GA 3QFHA 3MT0A 1ODJA 2VP5A 1KYZA 3LPMA 4MV0A 4QG7A 4WA7A 3SYKA 1F6BA 3L7LA 1RMQA 5I5EA 1L5NA 5HKKA 2GN0A 1UH5A 1P9NA 3EGVA 4GZMA 4PO1A 1A4RA 4ITVA 3JRNA 5BSHA 1WCWA 1TLTA 1UANA 2C98A 2CNWA 3CIFA 3GNTA 4GLOA 3AKYA 4GOND 2CBXA 5EEHA 2FK7A 5C52B 1L5HA 2BUBA 5T7BA 3W2IA 3U4GA 3UCFA 2GHTA 4M1OA 4GPAA 1RPTA 3IQFA 3ZDQA 3H16A 1S8FA 2W2TA 1NN5A 1UBLS 4P92A 2Q3EA 3U49A 3TTXA 2CDRA 3DZIA 3Q72A 1P2BA 3QPWA 4NDZA 3GFBA 4P36A 3AM3A 5KJEA 1XTVA 1E2HA 1URPA 3ADOA 1PRYA 3GGGA 4YAOA 3TZKA 3PR3A 4G8BA 3W1VA 5KJ1A 3EUEA 3GNQA 4GSKA 5TB5A 1KZ7B 2VYND 3ABOB 4X24A 4D6PA 2FPSA 4UFNA 5LJLA 1NDHA 2WTAA 1RI5A 1IONA 1X8JA 3MJRA 1V96A 3OPYB 1IYZA 4N49A 5EHIA 3T5TA 5ITSA 4MV3A 4GLJA 2O5EA 3D0OA 1FMJA 3HXPA 1NMYA 1SU7A 3NHRA 3PEFA 1A88A 3RS5A 1QIGA 2FGJA 4NZPA 2Q6TA 5HKOA 4G24A 5AI6A 1KI4A 1Q6YA 1TFUA 1SVMA 2ORIA 3EVFA 1N0IA 1LLQA 1XE3A 5EUBA 3LVBA 2QJFA 1TLLA 3LC0A 4BNKA 1X1RA 2GEKA 1LF0A 3CTPA 3GNLA 4FLFA 4YJ2F 4C7JA 2J46A 1Z0UA 4I66A 5CNKA 1IVNA 2CZCA 2H5IA 2FZLA 1JA9A 3ND5A 3OCZA 4P5EA 1K68A 3DG9A 1MB4A 3H4IA 3I2FA 3OOWA 4HQ0A 2F48A 4OI2A 3WBFA 5JH7F 4B48A 4DMCA 3TTSA 4UD6A 3P9CA 2BMDA 4MV9A 4UE6A 2FSIA 3NEJA 1KKLA 3HZOA 4JBXA 5EJIA 1HFWA 1PJSA 3KEOA 5LIRA 3A6FA 3Q12A 1MU0A 5I7SA 1N2OA 4NPCA 2YASA 4RC9A 1YJCA 1WLSA 1RQRA 1ZHFA 3H7AA 3HRIA 4YP1A 2IZ6A 3R3SA 1WVIA 1YQUA 4XWGA 5JZBA 2WMOB 1YF3A 1GPNA 3R41A 4A8JB 1W2WB 3IA7A 4E5DA 5JRZA 5LDDC 5L53A 1QX3A 3IVMA 4IFTA 5FI3A 3H18A 1GARA 4CFSA 3V7WA 2C7QA 3D6VA 5JD5A 2JGNA 4L9RA 4UD2A 4QD3A 4TWJA 2GCOB 2ZRQA 3AUUA 2VPPA 1E6MA 3MINA 4LXIA 4NEHB 2DUMA 4TV9A 2B5VA 2QSUA 4EHBA 2YDXA 3RROA 2QTNA 4BLUA 3B52X 4N8EA 5EJEA 2OXEA 5CW2A 5AVXA 2PKQP 4DYVA 4E30A 1VLMA 2WJYA 3C7KA 5K8IA 2V5AA 1TAHA 1U8FO 1ZI8A 2FFBA 2XUDA 3FUCA 4QJBA 5GM1A 4RADA 2Z4RA 3W9BA 1QRRA 2X7XA 2PQ6A 4OBBA 2CYBA 2B4RO 2CSUA 1MX1A 4PSKA 1YHZA 5AUOB 1GZ3A 1W44A 4BBPA 1GZ4A 4CMJA 4PBTA 1D6SA 2YC2C 3I6MA 4A2PA 1E6KA 4B0OA 4DBLE 2O6LA 5CVTA 1XNQB 3QF4A 4HGYA 5AVVA 3KLOA 2ECOA 1GIAA 3MD0A 1KTIA 4MS1B 1JR3D 2E55A 3A1NA 1C0EA 1X7ZB 3RTBA 2NXNA 5HK9A 4X8HA 3NDBB 1ITZA 1VB3A 16PKA 4QYWA 4PFKA 4EJ2A 5HYVA 2D7CA 4LWOA 2YVKA 3FUXA 3HHEA 5JATA 3FIUA 4V0ME 4JXXA 3OETA 5F7XA 3CRQA 1L7MA 2B82A 4JI7B 4MUIA 2BHNA 2GTIA 4HDCA 3ZOZA 4KNVA 5FWNA 4D45A 1AA6A 2DF8A 2VRCD 4Z3KA 4UNQA 4RENA 5A5FA 1G8MA 1Z25A 3AF2A 5D1NA 5FBLB 4D9MA 4JLSA 4DNFA 5KQLA 3DBLA 3L2OB 1XVTA 1NBAA 3TSAA 4N5HX 5DHPA 3CSDA 5BQOA 4D92A 1EFVB 3GFTA 4DJFC 2WK1A 1F3LA 1QCYA 1Z33A 3M1AA 5AD1A 2XKJE 4LOIA 4GMXA 4MP3A 4JIMA 3A3OA 1S3IA 4QJ4A 5A7GA 4KBGA 4RLHA 2BBTA 1I2DA 3KPUA 4J75A 4ND6A 3RODA 5LKRA 4Q1BA 1RPZA 1CKEA 1R8SA 2WF8A 3DMGA 8ABPA 1W96A 3DMRA 2PXHA 3CZ4A 3WO1A 2IZ5A 2DETA 2Q1TA 4GVPA 1SOUA 3QHQA 4F12A 1P75A 3D6MA 4DF3A 1GAXA 1A1SA 1TGYA 2V4MA 2QLNA 1X0VA 1ODSA 2NPOA 1J99A 2M1XA 4P3OA 3RYHA 1CCWA 3UK6A 1DEHA 1L1RA 3IUEA 4PU0A 3R7DA 4BP3A 4QTXA 3QOYA 4LJLA 1RYHA 2PKWA 2RGAA 3K6SA 1UFQA 5G40A 3U7FB 3ZVLA 1PWHA 1GITA 2IUEA 2NTEA 4ZV9A 1FUEA 3DVLA 4FS3A 3AF0A 5IDYA 2J8ZA 1RJDA 4NZNA 4ND4A 4DARA 5FH9A 3JALA 5CFNA 1T3HA 5A4FS 3ZTYA 4JUCA 1ADFA 3D9QX 4KGDA 2EDCA 2AVNA 4MUKA 2NSJA 4LCJA 1AOXA 4UAJA 2FXIA 3QMWA 4C3OB 2ZIUB 1S3GA 2CYAA 4QYSA 1KO8A 3KKQA 1F1JA 4LV5B 4C0SA 1KMHA 5JZSA 3BRQA 4PO3X 3AM4A 4CQMD 4EEZA 1RZVA 4I3GA 2RGBA 4XIJA 3OIVA 4URXR 1TYAE 1JDTA 1NF8A 1B76A 2J9GA 3SVZA 1I9GA 1M3SA 1OLUB 3KV1A 3GYGA 2CWWA 3MRSA 1QR2A 4J16C 4JEHA 3T5GA 4YHHB 4O2BF 4PZ9A 1MB0A 1XQWA 3QSYA 4U6SA 4L85A 4DUZB 1QCCA 4YRDA 2UZ3A 3KYCA 4TN5A 1UADA 3D8BA 3JTEA 3NHWA 4E6EA 3BTOA 3FAZA 1VHJA 1GV1A 1TVEA 2XVZA 3RIXA 3K1YA 2FPPA 4YACA 1COZA 5FFNA 1MX9A 1MKYA 1DKPA 1EBUA 1IHXA 1XHEA 1CB7A 1L3BA 2E4YA 1KMNA 5H02A 5FWXB 4WJKB 2FE1A 2B4KA 3GCGA 5TPZD 2PGDA 2XNHA 4G1BA 2MT9A 1TQ8A 3DMTA 4U7TB 4R3NA 4YMWA 5FHQA 5CD1A 3TGWA 5BUQA 4LHYA 1U3WA 2ZSBA 3H2HA 1E7MA 2Y05A 2ZBGA 1RWQA 3W6UA 5CHYA 4EGJA 1YDFA 3A2LA 4YJ3B 4BASA 4FWIB 4E7PA 1N8SA 1DWPA 3TI7A 3ETLA 5EIBD 4DDKA 5JC1A 4BQFA 2IF0A 1FLVA 3J7TA 3BQNB 4RQBA 5GAJA 1F0NA 3O3OB 4HVAA 4PVDA 3EMKA 2CYCA 1MO5A 3DQQA 3HSYA 4D4MA 1Q7BA 4I9HA 3PUIA 3DV0B 1ZD2P 4UTXA 1K8XB 1A97A 3KVNA 1R1DA 3H6GA 4J7AA 2AMJA 3QIAA 1TUIA 4M7OA 2AFIE 2VZ8A 3E8MA 3ZGXA 5A2QA 2GAIA 5K2OA 3PITA 1XX6A 4R5HA 3NMUF 1EE9A 3ICVA 1G8FA 2WAOA 1K9SA 2ZJ1A 3BIXA 1I3KA 3D4OA 3G85A 4FKMA 2GUGA 4BKUA 5DW3A 1II9A 1RBMA 2RFLA 1KO7A 2Z2IA 5MGBA 1T25A 4DLNA 1KXJA 2QTAA 5G0SA 3HCFA 1XBTA 3QX8A 4UC0A 3WK9A 5BURA 4EM6A 1CEEA 5FJJA 4P4TA 2I1WA 1TQHA 3GFSA 1ULSA 4WLVA 4S1WA 3GL9A 5IBQA 4X66B 2CHVA 2C3UA 2WMDA 3F6PA 5CNIA 4JJIA 3FYUA 1WCV1 4KQFA 4MP8A 1CQJA 4ZVMA 1ABEA 1JEQA 2YVAA 5CXSA 2PCJA 1EUCA 1P72A 4LBVA 3ZXXA 3RS9A 3ZVMA 1H66A 1SCNE 3W3AA 5HKLA 5KHOC 2JIZD 3DQPA 4UHCA 1FPMA 1IY8A 3DFUA 3EAFA 1QTIA 4M76B 5CW1A 1NQWA 2JHCA 2PK3A 4R41A 3C4JA 3ID6C 2UUAB 2A9FA 3K1AB 4ER5A 2BH2A 2YR0A 1CUIA 3IILA 2EP5A 5K5EA 3O92A 3OE4A 4PFJA 3FSEA 5E2BA 5TQ2A 1MNAA 1FDIA 2VXBA 3C70A 4NHEA 2IH2A 3K0EA 3E48A 1U0FA 2OZKA 4G5FA 1LQUA 3UB3A 4B3XA 1YIDA 1RQ7A 5FULA 4TTQA 1MXFA 3H97A 3WGJA 1C0KA 1DGQA 1GUYA 4Y2TA 3KWFA 3UUFA 4CMCA 5H82A 3I9V6 3L93A 2OQVA 4WFKA 1NURA 1UPFA 1Y8ZA 2FEWB 4ZYZA 2V03A 2WIKA 5H3LA 4ZVSA 4LVNA 1HURA 4UDYX 1DVRA 1DC8A 1RZ3A 2O2YA 4FNOA 5E6UB 4WKCA 1Y81A 3FCSB 3AMVA 4JP8A 1I1OA 3A6DA 3TIIA 1S4QA 3AEYA 2OV6A 1KEUA 1DTEA 3NWBA 4AN1A 1XWIA 4CPDA 1KRHA 2EFCB 2JAHA 3LBAA 4PSAA 1PLLA 5CRIA 1O3YA 1NP7A 2XGGA 4MIYA 5KNCD 1HZZC 1OFVA 4U5XA 1M0SA 1TEXA 3PWKA 5LFAA 1J2EA 2XBMA 1UJ4A 2J9FA 4WK0B 2G76A 4EA6A 4RVSA 5M3BA 1GT91 2BFEB 4D2IA 5JXIA 4RULA 1CF9A 1F0PA 1JA0A 2BN4A 2W22A 5EJGA 3V1MA 3LI2A 4MWZA 5BN4B 5TE9A 4DM4A 4E14A 5TMBA 2FKAA 3KE8A 3M83A 2VJNA 1KSHA 2F8MA 2V3VA 3O2SB 3OJ0A 4IFBA 1N5RA 4R8KA 1HE1C 1AQUA 1IN4A 1FSFA 2DECA 4Z0HO 4DREA 4HLUA 1N1MA 1TZBA 3JQCA 2Z5GA 4P4UA 3LCUA 1VL8A 3CUYA 4ZDIA 1RE0A 3EODA 4PEVA 5IF3A 1ZQ1A 1T5TA 2WSBA 3F97A 3PQEA 4QUIA 5FLYA 1E1QA 3D7KA 3A1TA 1FNCA 2C2KA 5HMLA 4LN1A 4MR8B 4BB9A 2PUDA 2NT4A 3FVWA 4G4GA 4QM7A 2AEEA 1YTUA 1SQFA 5JCXA 2BGWA 1E5VA 1UMKA 2BISA 2DFDA 3H8SA 3ANTA 4UTZA 4AIIA 5IJ9B 3C3KA 4CL3A 3NEAA 1XN1A 1E9AA 1V47A 4LQ4A 2EIHA 4E5VA 2H4XA 4B3MB 4X91A 1DAIA 1DQNA 2FHSA 1DJLA 1E4EB 3D2LA 4MARA 4WOBA 3SXUA 2IV2X 2EL7A 3L7YA 3RU7A 4YRCA 3ZJTA 1HTBA 3L7MA 4NESA 2SKEA 3QU5A 4ENWA 3K70C 5KOJA 1V5GA 4CMIB 4DPLA 1P7YA 3OZFA 4HN9A 1B23P 3HKDA 5IJ9A 1OFUA 4IQFA 1WB9A 4L08A 1DP4A 5F3RA 1CS0B 2JIMA 3I9LA 3WNVA 5FOXA 3ZY2A 2KLBA 1V5WA 1WHTA 1XVLA 1LS6A 2KYRA 1VPLA 2OHHA 2QW1A 2VWGA 3AR2A 1KYWA 3DT8A 4IQ0A 4RYDA 3ZQ4A 5KTMA 4HQOA 3EMVA 1E18A 4MS3B 3VZRA 4FGKA 1YI8A 4AJHA 1A0OA 5LOVF 4OOFA 1YRHA 4XLTA 3VVLA 4O4HB 2XMDA 4RSRA 2AF4C 2BCGY 4BLVA 1RLTA 1NIPA 1TA0A 5DGTA 5TDHA 4N47A 4C21A 4OFBA 1E4OA 3ZV7A 4NE2A 5F7ZA 1J8VA 3G2QA 3OEWA 4XAQA 1UF9A 4EGSA 1NW5A 3RLFA 4PSDA 1G20E 1KFEB 2EZ4A 5IAJA 2OSBA 1XCGB 2CLKB 2D2FA 1PWEA 4M9ZA 4EJSC 1RCFA 4QDTA 1V16A 1CU1A 4OUDA 3PA6A 3HJBA 5BYKA 1NFRA 2DLDA 2WZBA 3TLMA 1TTTA 1Q15A 3MQ2A 1GDTA 1KYQA 2GZSA 4U1RA 1QBGA 5GADl 3FNEA 4W7HA 2LIVA 4EVRA 4RF4A 2ZRPA 2ZVJA 4U5QA 3THOA 4F6RB 3M34A 1FB5A 2PR2A 2VQ3A 1XEXB 3FYCA 2FEKA 4J03A 3DTVB 2FWNA 2AQKA 3HWX1 3MJCA 2YS6A 2FWPA 1K2WA 1I10A 2GK7A 1UJNA 2PRYA 4RH1A 4MKZA 2WP8J 1G3RA 4B44A 2H3HA 1G66A 3E58A 4QUBA 2DY1A 3CZRA 3MTDA 1E3QA 2LUOA 3PUYA 1DIRA 1CERA 3RDPA 2XXJA 1A69A 1WXQA 2PT7A 5BV1A 1L7VC 4H7HA 3LL7A 5KAMA 1SBQA 2CJXA 2RAPA 1YFZA 2BEKA 4DDUA 3LKDA 2JDIA 1FUKA 3LY5A 3FTEA 2PVPA 3VKVA 4OB7A 1Z75A 1U0SY 1Y5MA 3TL2A 4JP2A 3GF4A 1XZKA 5E1BA 4KLZA 3B85A 4G0ZA 4ZAXA 3ZY5A 4ARBA 4MUFA 1XTUA 1AHPA 1F48A 4JJFA 2PGJA 1SRQA 3T3HA 4OL0A 1YKFA 2RMKA 1PJ3A 2ZBEA 1PJ2A 4OM8A 5D3KA 5EERA 1D2HA 4DLKA 2BM8A 1V1RB 3QELA 1YMUA 2H17A 4JIGA 5ANRB 1T3LA 2JZOA 3BJZA 1JFSA 3VSCA 3DE7X 3HA7A 4OY3A 3K0CA 3NHZA 2WG0A 3QTLA 4LZPA 1ESDA 3VR6A 1Y3IA 1O96B 4D3XA 2XODA 5G1OA 5BN4A 2NP6A 1C1YA 2B3TA 2CLMB 4X97A 3FXAA 5TGTA 2H48A 2QIOA 2YZGA 4D8XA 5LMZA 3ICWA 3CHYA 4L02A 1DE0A 1K98A 1NP6A 2IEZA 2DPGA 4LDRA 3NDRA 2HCJB 1O94C 5EJ8A 5TMPA 2OO7A 4G9GA 3D1JA 3DKIA 4O4LB 1KERA 2GZDA 4MMYB 4ZU6X 3A4MA 3MCVA 4HADA 3B6KA 1SPBS 3MWGA 3KOYA 4JX8A 2AUNA 1VIAA 4I14A 4CLRA 5JRJA