5HCNA

Gpn-loop gtpase npa3 in complex with gmppcp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
259
structure length
253
Chain Sequence
SLSTIICIGMAGSGKTTFMQRLNSHLRAEKTPPYVINLDPAVLRVPYGANIDIRDSIKYKKVGPNGAIVTSLNLFSTKIDQVIRLVEQKKDKFQNCIIDTPGQIECFVWSASGAIITESFASSFPTVIAYIVDTPRNSSPTTFMSNMLYACSILYKTKLPMIVVFNKTDVCKADFAKEWMTDFESFQAAIKEDQDGYMSSLVNSMSLMLEEFYSQLDVVGVSSFTGDGFDEFMQCVDKKVDEYDQYYKKHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GPN-loop GTPase 1
publication title Structure of GPN-Loop GTPase Npa3 and Implications for RNA Polymerase II Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 95
structure length 253
sequence length 259
ec nomenclature ec 3.6.5.-:
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03029 ATP_bind_1 Conserved hypothetical ATP binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hcnA00
2RB4A 3B1VA 5FTKA 4OHZA 4PPGA 4PC2A 5AK0A 4O2RA 5UKDA 2XB2A 3CNLA 4M1WA 1FL9A 3QEOA 3WNBA 1OXUA 4EAQA 1EFCA 2D2EA 2RGXA 2F3RA 4IKEA 4DLZA 4LHVA 5H70A 1Z6YA 5K8UA 3SJAA 2IW3A 4RCYA 2IF2A 4B48A 1CR4A 2K5UA 1Z28A 2OFXA 2BBOA 2JEOA 3K0EA 2NO7A 4R2HA 1DADA 1CP2A 4PZZA 1E96A 4B73A 5EE0A 3MCAA 2LCFA 2AWNA 5F9FA 2ZROA 4C2TA 4CEIA 2JDID 1AKYA 5EE9A 4A9AA 4ASUA 2GEDA 2WVJA 1U8AA 4F4CA 1OFUX 5DN6D 3GEHA 3KJGA 5FR2A 5FI0B 1ZVQA 3KTAB 2IYSA 4F4IA 2BDTA 1YQTA 1E0AA 4Q9IA 3BK7A 4DJTA 4CYMA 1P4SA 2ZI6A 2GA8A 2VRWA 4LJAA 4OHVA 3U5ZB 4G5GA 1CEEA 5AJWA 4M21A 5AUOB 2QL6A 2HEIA 2QGZA 4MRNA 1KNQA 2ERYA 3K70C 3OFND 3PUWA 1CJVC 2Q9CA 5FOWA 1NG1A 2QA5A 1MO5A 3UMRA 1KMHB 1KSJA 1TMKA 4LYHA 5KPDA 2HF8A 1U0JA 1FPMA 4NYIR 2AXNA 1E4VA 3OIVA 2ODEA 3NDPA 3PCRB 2ZQ5A 3I32A 2EFHB 4KLZA 3CPHA 3TUZC 1QF9A 2FF7A 1XRJA 4Q03A 1ZD8A 2JJ1D 2IXGA 4B2IA 3VHLB 3T1TA 4XSHA 3VR3A 3SFZA 4QKQA 5KSYA 1M8PA 3R8FA 2W0SA 4D0LB 5K8LA 3S1AA 3GCGA 3HR7A 4KV9A 1VMAA 2F9LA 3VFDA 1XMSA 4W9MC 2A5YB 1SULA 2GRJA 4LJYA 3P4YA 1YE8A 2HDNB 2D7DA 3AVQA 1FP6A 1XMJA 4IOLA 2V6IA 2GCOA 1IN8A 2F1IA 4JSTA 1KY2A 2I4IA 3VX4A 1IXSB 2ZM5A 4QJ3A 2SHKA 3QPVA 2O8EB 4JVLA 2ECKA 3TE6A 4HAUA 1IXZA 3TR5A 3RAPR 3TIFA 4XWOA 3RSLA 2ZU0C 1MT0A 1UBEA 3L0OA 1XBTA 5EUQB 4LV8B 4Q1EA 1B23P 1GIAA 4DRZA 1ZM2A 1M1YE 2NIPA 1N6PA 1Z0FA 1NLZA 1J2JA 821PA 3GLHA 1PLJA 1HUQA 2MMCA 2ODBA 2V9PA 2WPDD 3AUYA 3KUCA 5B30A 1VECA 1GITA 1T3LA 2VHTA 4DCVA 3ADBA 1DS6A 1HH4A 3QKSB 2IYQA 4PHFA 2HF9A 5DN6A 2ZVPX 1WE2A 5HR5A 1GNQA 2KBFA 1YZNA 2IC5A 3IEUA 4JMPA 1YU9A 4PQFA 1X8KA 4A2PA 4NYJQ 3KQKA 1TU4A 1WBDA 1XTIA 2WICA 2H1LA 3Q5DA 3LA6A 1GL7A 2EQBA 2JLYA 4AIIA 2R6GA 4JVNA 4XD7A 1RRFA 3VMFA 2ZSAA 3C14C 2IS6A 2F1RA 3B5JA 3A1TA 2IBMA 1Q1EA 4LC0A 2P6NA 2CHQA 4A6PA 1ESMA 4IDPA 1K5DA 1VIAA 1Q44A 4YQFA 2QMHA 4JVMA 4L5BA 4GL2A 4K8OA 4LV5B 1GSIA 2ZRAA 3BB1A 1G5TA 2EYUA 3LBHA 4QJ5A 4TMTA 4LPKA 2JAQA 1FUUA 4P3YA 4PPNA 1Q1ZA 2ZU6A 4ACBA 5EP3A 5A4JA 2CCGA 2VTKA 3VX3A 2GZHA 2ZSDA 1JQJC 1OYYA 3KQUA 1QHHB 4URWR 1NLYA 3AVOA 2VP9A 1SVKA 3IQWA 1NVUQ 4OI2A 4I4LA 3FE2A 3REGA 1WDTA 1MV5A 4B76A 1M6NA 1QHHA 4ZDJA 2VPPA 3TBKA 3B6EA 1IN7A 3CO5A 1GVNB 2P6UA 1JB1A 1G4AE 4V0LA 2BMFA 1G17A 1JR3E 4ZI2A 4TQUS 1QHSA 3DL0A 2NPFA 1SVWA 5EJEA 4G5OA 4A2WA 1C9KA 4TTQA 2NO0A 4DVGA 2G0NA 2QPAA 3IGFA 3QXXA 2A30A 4IDNA 5EXSA 5EZ5A 5EXTA 2QP9X 4CEJA 3CRQA 3HWSA 3NWJA 1Z0JA 4N3NA 1E69A 5J5CA 2GEVA 1W4RA 3GJ5A 2OXCA 1E79A 4MKHA 5FR1A 2C9YA 4HLQB 3B8HA 5TB5A 1EK0A 3IHWA 4BLQA 4ZPXA 4BFSA 4IOKA 2CJWA 3F5FA 4I99A 2ZI7A 1EESA 3EWSA 3JZAA 2VHQA 5JI3E 1FQKA 3SJZA 5KO2A 2QPTA 4U02A 3WYGA 3GLFE 2QE7D 3W8RA 1P73A 4LBYA 1BOFA 4JJZA 2HJVA 5FL7D 1XCMA 3AP1A 4M1OA 1LF0A 3RRMA 2Y8EA 1O3YA 4POAA 1T0HB 3TAUA 2PX3A 4URVR 3GJ7A 2ZS8A 3TQFA 4B33A 3CUEF 3X1ZA 1YZGA 1CR2A 4QXAA 2CHVA 4B3DA 5AJVB 4XD7D 2OEPA 1IJEA 1RJ9B 2QM8A 4KODA 3QKRA 3P4XA 1PJRA 1RPZA 3V00A 1QHNA 1JEDA 5DHFA 3BH7A 1U8YA 3R7WB 2YVUA 1PV4A 4AYWA 3BXZA 5DYIA 3C4JA 3WYAA 4WXRA 4AKGA 4AG5A 1FNMA 1T0JB 4BZXA 4CIDA 1AGPA 1NKTA 1LS6A 1ZM4A 4WZBE 4OQNA 2XSZD 4TSFA 5ANRB 5F2EA 1N6NA 4S2EA 2QNRA 4OK6A 3WMGA 4US1R 1KYIA 3I92A 3I8XA 1T3HA 2WKQA 2GVDC 2VHJA 4LZZA 2RGBA 2F43B 2ZSFA 5JLJA 4PO9A 3RWOA 3KQNA 5GJCA 1W0JD 1HV8A 2ZSBA 1KIMA 3EA5A 4PZLA 5EE1A 1Z6GA 1QZXA 4D81A 2IWRA 2P5TB 2W6IA 1W0KA 3T34A 3KXLA 2D06A 4ZCIA 2A5FA 3QUSA 3SR0A 1P9WA 3QPUA 4R98A 1GFIA 2XZLA 4PAOA 4BGDA 1N2CE 3MAAC 4G5QA 3T06B 3MWYW 1VYVA 3WXMA 2BMEA 2RH5A 4GMXA 4HB3A 5HTKA 3M6AA 2G3YA 5SZJA 3DOFA 1YRAA 2IYTA 1OB2A 2J7PD 1FNNA 5KOYA 2J9RA 2PMKA 2VA8A 4DHEA 2RGCA 2NZ8A 1CJMA 1JALA 1W2GA 1M74A 4RD2A 3ZZ0A 3QEJA 2X77A 4YMUA 5EP4A 5EQTA 2EWVA 4CZ2A 3QIAA 4Q4AA 1OIXA 3I5XA 1IOZA 2NO1A 3C8UA 4OQFA 3FPAA 1AA9A 1HTWA 4M0LA 2WIBA 2A2ZA 3BE4A 5E7JA 3L2OB 3PJRA 4HZUB 1JQLB 2ZE7A 3DZ8A 2QORA 2ZTSA 1DAIA 1GKUB 1NIPA 1XTKA 2NGRA 3LX8A 1KHTA 2OUKA 4YDSA 2A7QA 4DDUA 2A5GA 2PBRA 3RS2A 4CEHB 3RS3A 2BEJA 4ZV4A 2YWHA 2BEKA 3BH0A 4EKDA 4CW7A 2J0UA 1DTSA 1QG2A 2JJ2A 1UBGA 2WHXA 4Z8XA 1TX4B 3ZDQA 3B85A 2EYQA 4FCVA 2ZPTX 1XTJA 4LJ9A 4DCUA 2F55A 3T1VA 521PA 4LC1A 2AFIE 2UZ3A 3NVAA 1VCNA 4B2LA 4LBZA 3C5CA 4PX9A 3GLFA 4RZ3A 3SHWA 2VO1A 5L3RA 4HDCA 3KQHA 5KSPA 3GLHE 1CR0A 2J7KA 1ZCAA 3O8BA 1XJQA 1U94A 1KK3A 2HV8A 3VQTA 5TARA 4JT2A 3OAAA 2R2AA 1DOAA 1G3IA 2REXB 4I1VA 3Q85A 1U81A 2D2FA 1G21E 1Q0UA 2JATA 2O8DB 4HUQB 2DB3A 1G3RA 3ASZA 2O0JA 1W49A 3MWJA 2GESA 4W5WA 2PJRA 1CXZA 5HE8A 3AKYA 1OFIA 4LYAA 4QGHA 5FUYA 2ZVQX 2RKOA 4NH0A 4OJQA 5FL3A 3N70A 3EXAA 3AP3A 4PANA 3SC3A 4IDHA 4DXAA 1WA5A 4KO8A 1E3MA 2QGNA 4O0MA 5F98A 1VIYA 3NC0C 4PAMA 2O52A 4CRWB 3P1JA 1S0UA 3QXJA 1G291 2LKCA 2JGNA 2C77A 4ZDWA 2ZJBA 5K8IA 3CKLA 4JSYA 1KDPA 4UNQA 1NL3A 4ABYA 1EFRA 2REBA 5FOUA 1MO6A 5L3SB 1E1QD 1DAGA 1YR7A 4NYMR 1OHHD 4KCGA 3T61A 3LNCA 4TSFD 3THWB 3IEVA 1XD8A 3GLHB 4UNNA 2P6RA 5CIWA 4GP7A 1DG1G 3LRPA 5J40A 1Q22A 4TLCA 4G5SA 3B13B 4CF7A 2QMOA 4DIEA 3BFVA 1A4RA 1Z83A 3KKPA 1RKBA 3I5YA 4AYXA 4GNKA 3JVVA 1ZINA 3EW9A 2CEAA 3U3KA 1OH7A 1MO3A 5FOSA 2HXYA 1IBRA 3J81k 1NIJA 2R9VA 1SXJD 4MGIR 3P32A 2Z43A 4TMWA 3RRZA 2Z6VA 3VU9B 5CYOA 4NE2A 4HEJA 1AN0A 1E2DA 2XAUA 3THOA 1KI9A 2ASEA 2G1KA 3QI2A 4GOJA 3WP1B 2QMEA 1FOEB 1XEXB 5FH9A 3LW7A 1UKZA 3BERA 3D3QA 5B57C 4GMDA 4NPHA 1DAKA 3KXIA 5IT5A 1SVIA 2HT1A 1E9EA 2QRZA 3RANA 3ZVRA 4BEBA 3H4MA 5JRJA 4JBYA 4AYTA 4CT5A 1AKEA 1H8EA 2QPOA 4QBHA 4GZMA 4OK5A 2W2VA 2WMOB 4HYYA 5AWFC 5KDOA 1ZC3A 3MJRA 4JL8A 221PA 1RIFA 3HPQA 1L4YA 2QSZA 1YZKA 4HLCA 2WMNB 2FSGA 4P4SB 4RY2A 4U5XA 4WIAA 4DZZA 3TW4A 2QM7A 2P0EA 1K5GA 4US0R 2WZQA 3RNLA 3PEUA 1X1RA 1Z06A 1ZJ6A 2D7CA 2UVQA 4FCTA 4YDHB 3ZYCA 2F7SA 4TYPA 4A82A 2WTUA 3QQ5A 2AHOA 2WWXA 5JEDA 1MO4A 3SEAA 1UEIA 4JBXA 4URXR 4TMXA 4O25A 2FSHA 4OK3A 1G5RA 3SDZA 1G8HA 4F92B 2B21A 4JLDA 4B3GA 1CJUC 2GBLC 5H68A 2WOOA 1Z3IX 3B1WA 1D9ZA 2CE7A 4H1VA 2GVZC 4C30A 4AD8A 3U3MA 4AC9A 3E70C 4OI4A 3SU8A 4CEIB 4LCBA 1N6HA 2F9MA 1OSNA 2DWQA 1NLFA 5DH9A 5BN3A 2V1XA 1KI8A 2DHRA 1EFHA 1VYTA 3AGQA 2CNWD 2DBYA 4QG7A 1EG7A 1XU4A 1FZQA 2Q3FA 1ZUIA 1P2UA 1XEWX 4FINA 1YRBA 3LLUA 1RYHA 1W44A 1Z6XA 4GFDA 2GZAA 1ZW6A 3QENA 1I4LD 3ZQJA 2Q9AA 4E22A 2WSMA 3RVBA 3FYHA 4JZKA 1G5PA 1NP6A 1X1SA 1KMQA 1E9BA 1JJVA 2ODNA 3CB4A 2Z4RA 4LBVA 4Q02A 3ICQB 4PPFA 4KJZA 2BM0A 2QQEA 1OB5A 4B74A 1NKSA 1NSTA 4LYFA 2IYRA 5KSOA 1VCMA 4AKEA 1OH6A 1QVRA 3BORA 3UG6A 4QGFA 3OFNA 4DLXA 2BV3A 3L0IB 3SYLA 4N0EA 1MRNA 2NZJA 3NH9A 1VG8A 3EIQA 3IO5A 4WBSA 3TW8B 3SHFA 2R6FA 3U3OA 4HATA 3EPHA 1N5JA 1JBKA 4Z1MD 3U7GA 3GLIE 1U0HC 2B8TA 3IPYA 2PZFA 3AP2A 4GSYA 5D3MB 1KK1A 4QM6A 3FKQA 4KBFA 3NTUA 3PV0A 5LBIA 4RD1A 1H8ED 1DG3A 1KK2A 1P5ZB 1UF9A 1NI3A 3A37A 3FB4A 4FIDA 4KAXA 4EFMA 3ZD6A 3K0AB 4ZKEA 2ZJYA 5JECA 2ZRHA 4BLPA 3CWZA 4EPWA 1GM5A 3TSWA 4B3XA 2H16A 4AK9A 5JCZA 4JLNA 1TQ6A 4IOMA 1IM2A 1YR9A 4IDOA 1EX6A 4PZYA 3LVQE 2R65A 1JR6A 3BOSA 4HUTA 1YZTA 4V0ME 4YONB 3RS5A 3X1XA 2C9OA 5C1BA 2VP6A 5DI3A 5P21A 4LPSA 2ZUCA 4Q01A 1Z07A 1YZUA 2QT1A 3VKHA 2G83A 1IN6A 3T5DA 3QSYA 4LY6A 5IK2D 3RS7A 1KI7A 4UNRA 5HPYB 4PC1A 1L2TA 1UDXA 4XVUA 4AI6A 1QHXA 3RRYA 1I4DD 1P9RA 3AGPA 2XOKA 3P26A 2HLDD 3GJ4A 2FPLA 4HAXA 3W90A 2PCLA 4TQ9A 4PHHA 1NVWQ 2FGJA 3UPUA 1XTRA 5GJVC 1E1RA 1R0ZA 1UKEA 1W7AA 3UMFA 1F5NA 3ZS8A 3E1SA 4MDEA 3TQCA 3BS4A 3CZPA 1ELOA 4V02A 1P2SA 1PVOA 2C04A 2WWIA 4QBGB 3QG1A 1OHHA 1SXJC 2JLZA 3I1FA 5FPHA 1SHKA 4PSAA 3BAFA 4M1SA 1Z6TA 3V9PA 2PZGA 2O8FA 1F3OA 4I1UA 1AGRA 1E1RD 3LAWA 721PA 4A8JA 4IW3B 3IBYA 4QL3A 2OAQ1 1N6LA 1SVSA 3AF0A 4RSGA 1Z63A 4IXNA 2BOVA 3SJCA 3E5HA 1IQPA 4KVAA 4XWAA 8OHMA 2YOGA 1NN0A 1S3GA 3CONA 4TMZA 4EPRA 4FMBB 3QY0A 3ICEA 4B6FA 1A2BA 4DCSA 1GNRA 5AJYA 4OHWA 4DB4A 1N6KA 2IYVA 3WMFA 5AUPB 1H8HA 1SVOA 4DLVA 1R4AA 2WV9A 5FBLB 4Q1CA 4EFLA 3A1WA 1HT2E 2QN6A 2E1RA 4ZKDA 4ZI3A 5D3QA 4UNSA 1G8FA 1ZNYA 5DYGA 2GXAA 1OPXA 1XEWY 2YWEA 4G01B 1Q3TA 4LHYA 3EAQA 1Z2AA 3WNCA 1KOFA 2BVNA 4XWKA 3QVUA 2FPMA 2A5JA 3MWLA 5BQ5A 5FTLA 4AKHA 3HPRA 2F6RA 3OIUA 2ZIAA 5G3ZA 3AB3A 2R62A 4F93B 2H92A 2J45A 1SXJA 5EXXA 1P75A 3GFTA 4QBFA 1GRQA 5BN5A 1G8PA 5BYJA 3QKTA 3FHCB 4JLKA 4ZIRA 1Q1BA 1YR6A 5AUQA 3ND8A 1OT3A 4EIWA 2DR3A 1DVRA 1VKJA 2WJIA 2C98A 4WW0A 1HA3A 3KUDA 1HE8B 2PZEA 4L4UA 1VG9B 4FN5A 4JJKA 1DPFA 2ZRCA 4X8LA 4BUJA 1GRRA 1CF4A 1F60A 1T9HA 3DKVA 4URUR 3EZ7A 4B3CA 5G3YA 1CTQA 2E9SA 4MITA 1FTSA 2ZRKA 3UWKA 3GEIA 3RYTC 3QJYA 1LNZA 2QAGA 5KDDA 2ORWA 3QOFA 2ZITA 3TGPA 4E5UA 1KJWA 2FMXA 2WJVA 1Z47A 1LW7A 3AKCA 1XCPA 3B1XA 1NN3A 2P5SA 2N1BA 3BWDD 2WOJA 4R2IA 2PT7A 1QHYA 4MKFA 5J4LA 4BPBA 4LSGA 1G6OA 2GCOB 1BO6A 1Q21A 2EFGA 2ZRBA 4JT4A 5FBRB 2A5DA 4TT3D 3ZH9B 5CDFA 4D25A 2XX3A 3CRRA 1UAAA 5KNBA 1R10A 1D5CA 2OILA 1G9XA 1P7CA 2OCPA 3F0TA 2PT5A 3IILA 3ZLJA 1E98A 2N46A 2GJ9A 5CITA 3K0FB 4NCHA 2BMJA 5HZHA 4HZIA 5M04A 2UKDA 1SHZA 2PEZA 2YC4C 1IXRC 1C4OA 1LTQA 5BN4A 4MDFA 3HDTA 2WWGA 2BC9A 4A0RA 4B44A 5IHPA 3PXGA 2V4ZA 1SKYB 3RABA 1G3QA 4FWTA 5K8TA 1RW4A 3THWA 4Q21A 5AR1A 1TQ2A 2Z4SA 3U4QA 2C8VA 4DKXA 3CW2A 1OW3B 2P67A 4FCWA 4WVFA 3CZQA 3DM5A 5CM8B 1W4CA 1TADA 1WCV1 2JIZD 3K70D 4HB0A 1LVGA 2FNAA 2PH1A 2XTMA 2IEYA 2GAOA 3PUXA 4PAQA 1G1MA 3PEYA 2YINC 2IHBA 4RCZA 3QG5A 2GF9A 1NN1A 2GBLA 3Q7QA 4PO8A 1EFRD 1KGDA 1R7RA 4TMVA 4UJ3A 3CPJB 4WZ6A 2YZ2A 3UG7A 1NY6A 4IDQA 3ZS9A 4U7DA 4P4TA 5IK2A 1ZD9A 4LV6A 2GEUA 4D82A 4E09A 2ZEJA 5EE5B 3FWYA 3THXA 5FPTA 2ATXA 4XTRA 5E4FA 4BRWA 2HXSA 2FV8A 5BWMA 1GNPA 2FN4A 4BFXA 4EDHA 4P4SA 1KO8A 1XPUA 1KO1A 3FKSD 1BMFD 4KHZA 4P4UA 2BCJQ 3ECCA 4PSVA 1IY1A 4DDTA 2FDCA 421PA 1E2MA 4EPTA 2GXUA 3CBQA 2DFTA 1CR1A 2WBLC 4YMWA 1U98A 3WRYC 3U2QA 2VF8A 1NNEA 1F2TB 2CL7X 5TY0A 1GILA 5KTYA 3LO5A 2BM1A 2G77B 3K0SA 3KB2A 1DO0A 2RGDA 2C99A 1KK0A 2BWJA 2NO9A 3EG5A 3EZFA 3SQWA 4XSGA 2CBZA 3K09A 4EQ6A 5J4HA 4O2LA 2V6JA 3K0CA 2FFAA 2KB0A 2O0HA 3QKRB 4BZPA 2ZJAA 4FW9A 3EPLA 1I4TD 1IY2A 4IXMA 5HCNA 4B34A 2ZJ8A 3C41J 2JJ2D 1LS1A 3GFOA 2YC2C 3IUYA 4BFYA 3GQBA 3GPLA 4NP6A 1YZLA 2OBMA 2VHCA 1JXOA 5EP1A 3U7EB 3IDQA 4UNPA 1P3JA 4NTZA 2EVWX 4WXPA 3K9HA 1E9AA 2GF0A 1OF1A 4MKGA 2O8EA 2C03A 1D2NA 2WPDA 2G88A 3DM9B 5FOVA 2XEXA 4XIGS 4IFEA 2AL7A 1R5BA 1TQDA 4Y0VA 2WSSD 1KDRA 1YHNA 2GILA 2X8AA 2VH5R 1G8YA 3OZXA 3AVYA 1KI1A 2GCPA 3OIWA 1OIVA 3KL4A 2CJWB 4RFSB 3ND9A 4BLOA 3U60B 2GZDA 2ANCA 2G0TA 2DFKB 1KKMA 3KFVA 4Q7JB 4M1TA 2Q6TA 5FBQB 2FPKA 1ZC4A 3U3JA 2OFWA 5DNYB 3EX7C 5G53C 1K6MA 1W4AA 3MJHA 1GL9B 3PIRA 4FI3C 2GJAA 3PITA 1GRNA 4FWIB 5AUNB 4TT3A 1KSFX 4HI0E 1MR3F 5ELXA 1N25A 2CCKA 1E79D 5JZVA 1UFQA 1KO7A 3A1UA 5SZIA 1MKYA 2AN9A 2F1HA 3IHLA 3K0CC 3UWOA 3A36A 4HLDA 2I1VB 3I61A 2ZUBA 4LX0A 3NH6A 3PEWA 2JLXA 1XCGB 2CL0X 4D0GA 5FUXA 3CH4B 2J5XA 1TF5A 3GJ6A 3NEYA 3VKGA 2CK3D 2ZJ5A 2V7QA 3L8ZA 4XVRA 5FPSA 1CJKC 1JECA 4GDFA 1Q12A 2Q21A 1G3MA 3CNOA 3PUVA 2ZI3A 1G20E 3K53A 1CRPA 5DGXA 3D31A 3EARA 1CULC 2KI5A 1XX6A 2A9KA 1UPTA 1X3SA 3EASA 1LY1A 2QBYA 4D4LA 4Z1MA 1XZQA 2CE2X 2IA5A 1IONA 1KMHA 1S2MA 2RHMA 4OL0A 4M9XA 2OAP1 4QHTA 1PLLA 1ZM3A 2FWRA 2J0UB 4M22A 1SQ5A 4MRPA 1RFLA 2R44A 3KTAA 5KDLA 3VR4A 1N5KA 2ZJOA 1YKSA 2IK8A 1BIFA 1U9IA 3AVWA 2OBLA 5J4YA 4DSTA 3ZZUA 4TTRA 4HAYA 1OKKA 4LHXA 3OE7D 1FMLA 1X6VA 4DLTA 4BLRA 1EWQA 5KNDA 2JDIA 4ASUD 4Q9HA 5B64A 5IDVA 3VHXA 1XMVA 3R7WA 1E9CA 3SE0A 4MYTA 3IIMA 3ZIAD 1UDWA 2B7CA 3D6TB 1KKLA 1V43A 2XB4A 3DVLA 3NHAA 4HLUA 1R5NA 4MRSA 1T3SA 4TYWA 3R9IA 3BD9A 1LFDB 3TUJC 4WOPA 4KFSA 3GLFB 3KQLA 1XZPA 3P20A 3MFYA 4BLSA 5KHOC 3AVVA 2WKRA 1VDZA 1E6CA 1W0KD 1HYQA 5BXQC 5L3QA 1WRBA 4BZQA 3EPKA 3VNUA 3EC2A 1G4UR 2FOLA 2XXAB 3TLXA 2QT0A 3K70B 3LWNA 3VKWA 2BBSA 5LB4A 2ZRPA 4NCIA 3T12A 3K9GA 2FEOA 1P62B 4QJ4A 2ZI9A 4LHZA 5FTNA 4A0HA 2AKAB 4DEXA 2IL1A 4G1UC 4LRWA 5JWRA 4AWXA 2FJUA 1CBUA 3KFXA 3UATA 3QKUA 1Z0DA 4F91B 5FUWA 2ZYVX 4P31A 3THYB 1L4UA 1PLKA 3RDPA 4LJ6A 3MUFA 1N6IA 3CF6R 5KU1A 1P2TA 2DFLA 4JL5A 4QOSA 4RD6A 4U00A 1E99A 1QVAA 4YMSA 4C0LA 4IEIA 4PPQA 3I3SR 4BLTA 3KXKA 3SFVA 3CRW1 1JPNA 3HYRA 4CT4B 3U44B 4BWYA 4A2QA 1E0JA 5FL7A 2MSCB 2B92A 1DAHA 4BFUA 1EXMA 3DOEA 4PFSA 3VR5A 3I4LA 3B9QA 3PUYA 3Q5EA 1J7KA 1Y63A 2HT6A 4Q18A 2VQSA 4M4SA 1QDEA 5HE9A 3X1DA 1AQYA 1ZCBA 3OESA 1DO2A 3BJIC 2YWGA 3NEJA 2PMDA 2WWYA 1VYUA 3LBIA 5DO9A 1OLOA 2MSEB 3OEEA 4KXFB 2V1UA 2W6ID 2P65A 3Q9LA 5SZHB 1OV4A 1COWA 2NMVA 1G19A 3ETLA 3QF7A 4KBGA 1TPZA 3VAAA 3THYA 1D2EA 3ADCA 1O87A 1C1YA 3HP1A 4GZLA 3MGCA 1US8B 2ZREA 4S35A 4UJ5A 5JCPA 2REOA 2V54A 5DSZA 4C2UA 3F8TA 2AD5A 2WIAA 3AF3A 4QM7A 2E87A 4P33A 1ZU4A 3DEFA 1S3SA 3WBKA 2W0MA 1ZNXA 2I1QA 2PLRA 4TTPA 3MMPA 3LD9A 5DIFA 1TF7A 3NHBA 3QKSA 1P2VA 4JBWA 4RD0A 2ZRGA 3CF0A 3IIKA 1E0KA 4M1YA 4NL4H 4A0GA 4M53A 2QENA 2GK6A 3PQCA 4MGKR 1E2LA 4C0BA 5HKKD 3MRSA 1E2NA 1W4BA 4LJ4A 3QE0A 1R0XA 3A8TA 2CVHA 5FPYA 2HYDA 1OIWA 4NYIQ 4HDQB 1GUAA 2ZETA 4RZXA 2V55B 1XPOA 2H18A 3FGNA 3H1TA 3K9NA 4DWJA 2PX0A 1DBSA 4IVPA 4L8GA 2C96A 2BJWA 4JKYA 1SVMA 2BBWA 2ZYTX 3T35A 1P61B 2XNDD 3DMDA 3A1VA 1IN4A 3IKJA 1US8A 4QGAA 1W2HA 2KSQA 2VLIA 3FVQA 1HT1E 2G1JA 2RGGA 4HZUA 3WP0A 4B6EA 2AR7A 4PR0A 5GVSA 2ZS9A 2ZRJA 4A15A 4TLBA 4F4JA 2YKGA 1DELA 3ASYA 2RGAA 3N2EA 1GWNA 4QNMA 5JWHA 1UBFA 2ZRLA 2ZS7A 3GJXC 3B2EA 4I1SA 1JAHA 2IYLD 1NMXA 3PEVA 1XD2B 3C7KA 2JASA 4MGYR 4RZ2A 1W36D 3RLFA 1AS3A 5KYKA 1SKQA 1XNJA 3K0AA 4NBSA 3U3RA 2QI9C 1KDTA 4ESHA 3R9WA 4AY2A 1LV7A 1IHUA 1Z29A 1Q1QA 2WJYA 2GXQA 4FMCF 1KSGA 2VF7A 1OYWA 2YOHA 3H86A 1GP2A 5AJZA 3EIHA 1NG9A 4GRAA 3K09C 3FMIA 1G6HA 3RC8A 4UQOA 1W47A 4JS0A 5TV2A 3GLGE 2IXFA 121PA 4LWZA 3CLVA 3TNFA 4YXWA 1EFTA 1G16A 3RWMB 1AK2A 5FBWB 4IVRA 4Q5IA 4C0KA 1N5IA 1JEEA 2ZAOA 5DISB 1XXHA 2OG2A 1ONBA 3R20A 4I1OA 3NXSA 2C78A 1H65A 4V0MA 3LH5A 4LUCA 1CKEA 3AH8A 3ZVMA 2OXRA 4C9BA 1UKYA 4D0NA 3BB3A 5CJ2A 2AD1A 2YJTD 3GD7A 4NYMQ 3TK1A 1D6JA 1ANKA 1TUIA 4GBMA 2PLFA 1A5TA 1OXXK 4NZYA 4JLBA 1M7GA 1P9NA 2ZANA 1M34E 2KWIA 1S1MA 1XB2A 1BH2A 1S9HA 1XF9A 2OE2A 3KJEA 1A1VA 3TJZA 1FX0A 3VTKA 4PC6A 3VR1A 4B71A 2W58A 3FFBA 3L0PA 3CR8A 4KSCA 4GPTA 4XJXA 2ODWA 5CYPA 4DSOA 4CVNA 5LD2C 2OCAA 3SI7A 3CPEA 3ZIAA 3BRWD 1Q57A 2GDJA 3TAHA 4FMDF 2IF0A 2XTZA 3CRVA 4E07A 2ZUDA 2WM9B 4MQBA 4G0NA 2XNDA 1BS1A 1Q20A 1F2TA 2WSSA 4KLNA 3SS8A 1OXTA 3TUIC 1E94E 4C7OA 2IYUA 3HU1A 1LB1B 2PEYA 3VR6A 2VP2A 3UIEA 4LJ5A 3FMOB 5FTJA 4Q1AA 2XITA 1KZGB 2QRNA 1AM4D 2ONKA 1G41A 1S9DA 2VIIA 1G7RA 3W34A 1N0UA 1OXSC 2CL6X 3OIYA 4YXWD 2Q3HA 3CM0A 1E0SA 3LLMA 4QHYA 3TMKA 2OESA 4OYHA 3MG9A 3IBGA 3SYNA 1TEVA 1XEXA 1Z6AA 5J4VA 4V0NA 1PUJA 1JI0A 1WP9A 1FQJA 3GJ0A 3T1OA 1OE0A 2D4HA 5H8WA 3NBZC 2J0SA 1U8ZA 4X8MA 5E3HA 3SOPA 3I72A 5JS8A 2NO6A 3FHOA 4MGZR 4RD4A 1A82A 4ARZA 4B3FX 4KVGA 3A1SA 1RC8A 3AF4A 3O8DA 1FFHA 5CJPA 2CXXA 3CX7A 1G18A 3K9LA 1II9A 4Q66C 2WJGA 2BMDA 2GXSA 2CLCX 2DFNA 1QHIA 4ON9A 4RKEA 4IOJA 3NBYC 1HQCA 1U9IC 3BH6A 4BECA 4M2LA 1U2RA 2VBCA 4TQAA 2OHFA 5E7IA 3X2SA 3TVTA 4TYNA 4EPXA 5JJIA 3LXXA 4KSBA 4ZCMA 4WZAE 1VCIA 2B6HA 2NQ2C 2IX3A 4NHOA 2UZIR 3RSOA 4CDGA 2J41A 3OEED 4RKFA 4D4KA 1W48A 3VR2A 2QAGC 4MA4A 5SZKB 4EPVA 1QG4A 5DE3A 1NMYA 3M1IA 2C5LA 3CX6A 3NG1A 2Q9BA 3W8NA 1ZBDA 3N2IA 2CLDX 2YOFA 1KI3A 2X19A 3K0FA 4RZUA 4IFBA 3U7FB 4IEEA 3DDCA 2IYWA 1WBBA 2FE4A 1I2DA 1U0LA 2FEMA 2W00A 2JLWA 4QHSA 3SJBA 4BQSA 4URZR 3VNVA 2ORVA 3CH5A 3IO3A 5GADl 2QTVB 4UXHA 3DO6A 3TH5A 4GT1A 2RGEA 1NJFA 4ILEA 4JLAA 4JL6A 4LDJA 3UKDA 2W2TA 4DLWA 2QU8A 2VSOA 4KU4A 4D4MA 2C95A 2IS1A 4HUQA 5L3SA 2IYZA 2BJVA 5C4MA 5C46F 5FPKA 2P2LA 4QGGA 4UKDA 3SYKA 2VP4A 3DZDA 1RE0A 4NYJR 5L8VA 3FOZA 5JJLA 2X1VA 4OBEA 1J90A 1HURA 4TN1A 4DCTA 5C4GB 1CLUA 3NIBA 1KI6B 3KKMA 2GHIA 2VSXA 4QNRA 5DLQC 2VYFA 1YVDA 3X1YA 4YMTA 3PR1A 1YJ5A 4C0JA 3B7GA 3PVSA 4C7OB 2FU5C 3R8CA 1DAEA 1E2EA 4EQ6B 4X8OA 3CX8A 2G9NA 3I8SA 4DSUA 2FFBA 1VHTA 2ZRNA 4OI0A 1E32A 2ZRIA 2ZE6A 4M9SA 3AKEA 3ZJYA 3FHTA 4LBWA 3TVDA 2O8DA 1FP7A 1VCOA 2ZE5A 2ZRDA 1BMFA 1NVVR 4L9WA 5TMPA 4W7SA 2QG6A 4OHYA 1PUIA 2TMKA 4JYBA 1F48A 1ZNZA 3AVUA 1G3UA 5D3MA 4EPYA 3QXHA 4V0KA 1S4QA 3GFPA 2AWOA 2O8BB 2JLRA 3M4YA 2Z5FA 1OXVA 4Q4JB 5DI9A 4C0SA 2IYXA 4Q1BA 2J46A 4L9SA 3OE7A 1OKKD 2H7VA 2MSDB 1ZD1A 1W5TA 1DEKA 3WMEA 4F7WA 1N6RA 5A0FA 2VP0A 1TNDA 4DDWA 3D8BA 3H2YA 2FGKA 4LGMA 1Z08A 1XJ0A 1ZMXA 2CVFA 1JR3D 3W5JA 1G64A 4TL8A 5C2JB 4JLOA 2IT1A 1MOZA 1UJ2A 2OLKA 1XTQA 5DI3B 2HYIC 1D2MA 4Q47A 3QXSA 4ZDIA 4C4PA 1CS4C 2QY9A 5JEEA 1R0WA 4NCNA 2CHGA 4RFVA 2OV2A 3M0EA 4HDOB 5GVRA 1KAGA 3AQ4A 2AK3A 3GLGA 4LI0A 5B2ZA 2EFCB 3HU3A 3LXRA 2ATVA 4GI7A 4JYCA 2CK3A 2IS2A 2IUSA 3WNDA 4YC7A 4B32A 3AVXA 1NBMD 3LX5A 2OBNA 2XNSA 1KI4A 1HE1C 3ZQ6A 1MABB 1ZUHA 4PHGA 4PC7A 3PG5A 4NONA 3GLIB 1UBCA 4J0QA 2QTHA 4IJMA 1NRJB 3EIEA 1GOTA 1BKDR 1E2IA 3QPWA 4PC3A 2J0QA 3KKNA 2ZJZA 2D74A 1IN5A 5JJKA 1T91A 3G82C 3PUZA 2GETA 4Q9LA 5LB2A 1A2KC 3H84A 1NSFA 4TWZA 1B0UA 1JXMA 4JLPA 4B35A 5L3QB 4DT1B 4EJSC 3U61B 3A4NA 2R6DA 2D62A 3QVVA 4Q9KA 1VPLA 2IHYA 4MYUA 1SZPA 1E4YA 2FSIA 2CMKA 4BASA 5IF9A 4Q4LA 3NKVA 2RMKA 2VP5A 3UMSA 2AFHE 3SQXA 1XD2A 4A8JC 2DY1A 5CK5A 3LQQA 1KY3A 1TF2A 3REFA 1G7CA 3AF1A 3W6OA 3OEHD 4GOXA 1QBKC 4JVSB 3BIFA 4FMCB 3V4RA 4MUAA 1X8LA 1T6NA 1E2KA 1E2FA 2GK7A 3IPXA 5JSZB 2KBEA 5FOTA 1II8B 1L7VC 1GKYA 1X8JA 5E95A 4GP6A 2OSBA 1WB9A 1EWRA 1T5IA 2QZ4A 4E03A 2FZ4A 3IIJA 3WHKA 4NCJA 4ZDKA 2BBTA 3W3AA 2IEZA 1XEFA 2H5EA 1CIPA 2WWWA 4JLVA 1K8RA 3QF4A 4D26A 2ZI5A 2NTYC 3QXCA 3W6NA 1DAMA 3NBXX 2PL3A 4W5HA 2NOAA 3QBVA 4MRVA 4DDVA 3RS4A 1KNXA 1WF3A 4ACAA 2BCGY 1JAIA 1NJGA 4AKIA 3KZ1E 3LBNA 3RC3A 3AM1A 1Z5ZA 4TZ6A 4DBLC 4A92A 3CNNA 3KKOA 3OHMA 4HB4A 5CM9C 5CIQA 5JWOA 2YWFA 1Z2CA 2XGJA 3VU9A 2QUZA 3B1YA 1N0WA 2R8RA 1Y3AA 5EE3A 1WQ1R 1UADA 5FBVB 3AF2A 1QHGA 2X2EA 5CDFE 3SBEA 1HY3A 1E9SA 4YLGA 4DEYA 2XZOA 5FUVA 4XH9B 2NG1A 3K8YA 1YR8A 3OAAD 4D2IA 3IQXA 4R7ZA 2FZLA 4M9ZA 2F3TA 1ZM9A 4LJ7A 3WBJA 4QFMA 1T4GA 1H8HD 3GJ8A 3LV8A 3ZD7A 3C16C 1EX7A 2LKDA 4MRRA 5LDDC 2O0KA 2J1LA 1OJLA 1TL7C 2J59A 4XTCS 3RRNA 4XVQA 4P0TA 3A4MA 2ERXA 4HLUC 4NU0A 5CB8A 1W36B 1EGAA 3AV0B 5JFGA 2B8WA 2V8OA 4ERNA 2FX3A 3U4QB 2ZR0A 4B2PA 1E2GA 2JIZA 1NBME 1TUEA 5EXPA 4Z51A 2WAYA 1S96A 3HYTA 5FFMA 5B58C 2I3BA 2VSFA 1Z22A 4L15A 4BFVA 1ZUNB 4Q19A 2GCNA 1MRSA 2H8KA 3EC1A 1FUKA 4PQYA 1U99A 4M1MA 2AKYA 3P27A 4W5JA 3BC1A 3JVUA 1P6XA 2PJZA 2GTPA 4PXAA 3AKDA 1E1QA 3B1ZA 4ARZB 1XP8A 4TMKA 2Z0MA 4R9UC 1A7JA 4FD2A 4Q48A 1M2OB 1R5OA 1S1CA 1ZRHA 3C15C 1D8TA 2IXEA 2ZR7A 4DUGA 1TAGA 4HAZA 1R2QA 4LOAA 4TZ0A 4KYUA 1N3BA 5GJBA 1FW6A 4MUBA 2R6AA 5TXGA 3A4LA 4M1KA 2W6JD 2RAPA 4WAUA 1AQUA 4ESVA 4DC9A 3SNHA 4D4JA 2RGNA 1Z8FA 4LHWA 2QP4A 1HQYE 3EZ6A 4EFNA 3EWAA 4PHTA 4Q1FA 1VHLA 2JLSA 1W1WA 5G40A 2ZI4A 3EA0A 2GKSA 1JPJA 4QRHA 4Y0AA 1N5LA 3CR7A 4KFRA 5EZ6B 3DKPA 4UXIA 4NKRA 3S1AB 4A6XA 4URYR 1J8MF 4EUNA 1AS0A 1T8UA 3L0SA 2IWHA 1T8TA 2BHRA 3AEZA 2JJ1A 3THXB 1G7SA 1KJYA 1R8SA 3W6PA 3AUXA 1AZTA 2HUPA 5E7MA 2YV5A 1NVXQ 2W2XA 3KJHA 4EJSA 2ZXUA 2AXPA 1GG2A 4FXPA 2H17A 4B47A 1T5LA 2KE5A 2ZE8A 2ZR9A 2A78A 2EU8A 3PENA 5JHHB 4Z54A 5HZKA 2NPIA 3ADDA 4Q4HB 1KO5A 2JLVA 2V7QD 1XXHB 2QQ0A 2RCNA 3FFAA 3NC1C 4N1AA 3HR8A 4A4DA 4ZCLA 1SXJB 3RS0A 1RYFA 5EUMA 1SVLA 5FI1B 4NDZA 3WHLA 5HCIA 1AIPA 1IJFA 1KTVA 3MSXA 2ZRMA 4C0AC 1OH8A 1QRAA 3DPUA 1CJTC 1XD9A 1II0A 2W6JA 3B60A 5TVKA 1ZP6A 4AURA 1Z0KA 2ZYUX 1ZIOA 2IS4A 5G41A 1WMSA 3CRMA 4MYCA 3X1WA 1ZNWA 5KUTA 1S8FA 1SKYE 4D80A 2OZEA 4OI1A 1P72A 2WWHA 5C18A 4OKSA 1Z0IA 4R71A 4D6PA 3GJ3A 4TLEA 2QAJA 1KJZA 2PCJA 1IAQA 4JLMA 1NVVQ 2FA9A 1UKVY 2QEQA 4DUGD 3FTQA 4Q7LA 5F9HA 4HAWA 3D7MA 5CK4A 3R9XA 1GKIA 1G8GA 4MYHA 5CB6A 2DWOA 1JNYA 1KO4A 3CWQA 4JIMA 3L8YA 2J3EA 3G5UA 1E9DA 1D9XA 3CIOA 3TR0A 3UANA 4CEHA 1DAFA 1DE0A 2IUTA 4Q00A 1TTTA 1YZQA 2WKPA 3MD0A 2ANBA 5EP2A 2GJKA 3Q72A 5FOXA 3HU2A 3SBDA 5BYKA 4Q7MB 2ZSEA 3I73A 4MH0R 1Z0AA 3C5HA 2XJ9A 4TYYA 3E2IA 2WAXA 1GZSA 5JRZA 3GMTA 2XTNA 1IY0A 1VG0B 5BW8A 1W36C 3AVTA 2O8CB 2VEDA 2A3RA 3ZVNA 4A1FA 4DLRA 1UEJA 2IYYA 3N5CA 1RJ9A 2WWFA 4Q7KA 2BIFA 3LVRE 2O5VA 4HB2A 5KPJA 2FSFA 1CU1A 4IHQA 3RHFA 6Q21A 3KDSE 1KDOA 2JLUA 3LDAA 4A0FA 2QAGB 2XJ4A 5LPNA 3Q3JB 3Q8XB 2EWWA 2AX4A 2B7BA 1ZU5A 4I81A 3FMPB 2FG5A 1NY5A 4TLAA 2FFQA 1KI2A 4F38A 4OHXA 2YYZA 2DYKA 5KSZA 1ZM7A 4G3XA 2LWIA 4LK2A 1TEXA 4DT1A 1W46A 3F3YA 2IUUA 5TDHA 4K81B 2P3SA 1I2MA 1M7BA 4ZO4A 3SZRA 4OQXA 1F6BA 5CLQA 2FH5B 5J47A 5JHGB 4C0QC 4BFWA 2AK2A 5F3WB 1NBMA 2RHDA 3WY9A 1AZSC 2GAAA 2R6CA 5KNCA 2OM2A 4PTLA 3B9PA 5GJWC 5DHAA 1E9RA 2H57A 4HAVA 4DB2A 2XSZA 3Q7PA 1WXQA 3W5IA 4BFTA 2L0XA 3O8RA 4IRUB 4DLUA 3V4FA 2WJJA 1E2HA 2RGNC 1FMJA 2CLSA 1L8QA 4V03A 1ZAKA 1LF5A 3A58B 4Q1DA 2XZPA 1RZ3A 1TU3A 1JJ7A 2Q0HA 4DIDA 2ONJA 2GNOA 3GEEA 2KJQA 2C2HA 1MABA 3OEHA 1E2JA 1E9FA 4US2R 4O3MA 2OCYC 3ADKA 4XOIA 1R8QA 4TL7A 4WA7A 3GLIA 3KKQA 1JR3A 5JS7A 3BB4A 3U44A 4V0OA 1OFHA 2HCJB 3TRFA 4RVCA 3NDBB 4L16A 1GL6A 4KFTA 4BE7B 4Q4JA 4C3ZA 1XDBA 4B3BA 4P32A 4Q4AB 3I62A 3O47A 2QROA 1PZNA 5A5GA 2J7PA 4ITRC 5JI2E 3UK6A 1ODFA 2HJGA 2JJ8A 2QE7A 3OF5A 4EJSB 2DWPA 4DSNA 5LD2B 4M8NE 1R0YA 3MWKA 4CGZA 4KFUA 1RRGA 2HLDA 3FDIA 4X8HA 4Z8YA 4DLYA 3A6PC 1BYIA 3MLEA 3LQRA 2J87A 2MMGA 1NN5A 4DCNA 4N0DA 1VTKA 2CNWA 2V3CC 1KAOA 3W9YA 3TSOA 3ZZTA 2O8FB 2ZYWX 4AG6A 2F43A 3DHWC 3FKSA 1J8YF 4LYJA 3GLGB 3L82B 1F2UA 2JA1A 3BFKA 3K1JA 4HSEA 3TSZA 3ZGXA 4DLSA 4KITB 1OFTA 1M7HA 2OCBA 1J99A 3U6BA 2OFOA 4LJ8A 2OO7A 1ZYUA 2QMUA 5JSZA 2QTFA 1NF3A 3LW8A 4K46A 1F2UB 1NMZA 3NBFA 4M9QA 1II8A 4KI0A 4MKIA 3PFIA 3T5GA 1J70A 2J0VA 3T15A 2EW1A 1AS2A 1XTSA 3QF4B 4TLDA 3W3ZB 4TL9A 3U7HB 2ZJ2A 2F1JA 4B43A 1E2QA 2VHUA 1XMIA 2WJHA 4JKIA 4Q9JA 1OH5A 3B82A 3BGWA 2CCJA 4BEJA 2QBYB 2JCSA 4CEJB 2HCBA 3HJNA 4YMVA 3O8CA 2BKEA 1ESNA 3KX2A 3LFUA 1XWIA 4B75A 1U90A 2YNMA 1V5WA 5IRCD 3WYFA 1AJEA 1FX0B 3WRXC 3T1QA 1BYUA 1X86B 3GP8A 1XXHE 4NCKA 3LY5A 1XPRA 4OJKA 1VG1A 3EZ2A 2XOKD 5AJXA 1CRQA 4OQLA 4ZIRB 1R6BX 2OLJA 2EFDB 3CF2A 1DARA 2OT3B 3TKLA 4OQMA 1E2PA 2W83A 2X2FA 1COWD 1KZ7B 1SXJE 2N42A 1GAJA 1HEIA 3KB1A 4II7A 4FMDB 2DPXA 3AVPA 2D3WA 3ZVLA 4C0HA 3EPJA 3DMNA 1FTNA 1GDDA 1KSHA 4QC2A 4RJLA 2QSYA 4JLJA 1ZIPA 1P60A 2EFEB 2Q3MA 3JZMA 1GTVA 4GOKA 3H0KA 2GWHA 2DCUA 5JBQA 3EZ9A 5J4KA 3BBPA 2GJ8A 3ONWA 1SGWA 621PA 5HKKA 2QP3A 2VL7A 3UXMA 3FMFA 2Z83A 2ORIA 2C9CA 1W0JA 2YHSA 4PSKA 1G7TA 2BKUA 3QNUA 1Q3HA 3QBTA 1RRPA 4NMMA 1MH1A 2ZAMA 4H1UA 2XXAA 1EFUA 4BFZA 3G0HA 3U6KA 1W5SA 2JLQA 4G5RA 5L3VA 3BFXA 4KYIB 2O8BA 2G6BA 5FTMA 1RRCA 4RD3A 1N0VC 4PO1A 4TL6A 4QBIA 2FFHA 3B78A 1TQ4A 4PQRA 5CLLA 3SN6A 4Q4HA 1N6OA 1KI6A 4TYQA 2CDNA 3L43A 4A8JB 1UM8A 4BRUA 5H1YA 4UXJA 2O8CA 4RFSA 4A36A 4H9GA 2ZRFA 1XJCA 1RVDA 3KJIA 2GJSA 5JMTA 1XFAA 4IVQA 1ETUA
chains in the Genus database with same CATH superfamily
2RB4A 4DUGA 1P44A 4JOCA 1KF0A 1S3FA 3CNLA 5TPZA 3WGKA 4YY3B 1FL9A 3EH2A 3QEOA 3WNBA 1OXUA 1PT5A 4L3WA 4J0DA 3K6KA 4CCWA 5KOHA 5E8RA 5A9TA 2F3RA 4IKEA 3DQPA 2XGSA 1GYRA 1Z6YA 4V2UA 3SJAA 5K8UA 3QVSA 2IW3A 1FRVA 2P0YA 4P1ZA 4P36A 3T9BA 4M7OA 2YQZA 3RFUA 2GBCA 4F5ZA 2OFXA 4R2HA 2OCXA 4KXNA 1E96A 1SA0B 3U9LA 1G4HA 1L5RA 2PJDA 4KUGA 2F9FA 2X5NA 3E53A 4MEAA 1HXHA 1Y1SA 4JY7A 4C2TA 1V8BA 4ASUA 1AKYA 1PG0A 1P6UA 1SCIA 2WVJA 3LKZA 4ZVSA 5IT9A 4Q4DA 3GEHA 1ZH4A 3WR5A 4O5AA 3LCRA 4GBJA 4X1YA 5FR2A 4IYRA 5FI0B 2ADFA 2AGVA 4MUYA 2W70A 3U39A 3QLUA 4BQQA 1CZUA 4DAEA 4LFAB 1P5JA 1CETA 4YA6A 4F8JA 1YQTA 3QLTA 3AY7A 4BV9A 2IIBA 1YDWA 4WADA 1P4SA 4D1YA 3LYAA 3I45A 1RRMA 4Y0NA 3T7CA 3KU1A 1NBEA 4M21A 4UAVA 1RP1A 2QGZA 3SZUA 5FLKA 1NFQA 1YD7A 4AY5A 3ILXA 4WLUA 4MPTA 3LF1A 2FEWB 4LXYA 5FOWA 5AVRA 3K71B 1KRWA 1MO5A 3C7CB 2IP4A 4F85A 1V11B 1NVDA 3UXYA 2HF8A 1U0JA 3GF4A 1F20A 1FPMA 1Y48E 2JNWA 4QOHA 1E4VA 3WKDA 4RK4A 2ODEA 3MOGA 3PCRB 3I32A 1NW4A 4I1RA 2EFHB 2MYNA 2R4QA 3C3WA 2AC2A 2Q3EA 3P96A 4I19A 4KLZA 2A9JA 3CLKA 3WLPA 9MHTA 1H23A 1U65A 1XRJA 3LRXA 4Q03A 4K0RA 3V1YA 1O77A 4XSHA 2WC1A 1EVYA 2EGHA 2JFPA 3TEMA 3LY8A 4QYMA 1IHPA 2Q49A 1UOOA 5EYPB 2WG0A 4YB8A 3A28A 5KSYA 5CA0F 1FFXB 5SY6A 2PO5A 3RWBA 4D02A 1HBJA 4WBNA 3O31A 3GCGA 2LZ0A 1TZ2A 2ON6A 3VFDA 1XAIA 4W9MC 3NLLA 4XDZA 1LX7A 2JHPA 3G2NA 4BB0A 2X9LA 1HMPA 4LJYA 3OZRA 1Z4JA 3AVQA 1FP6A 2QUIA 3DQZA 3ITEA 2J3DA 4RTOA 3JD2A 3HVKA 4PLYA 2GCOA 3JWPA 3BRWA 1KY2A 2I4IA 5ALMA 3VOSA 2C57A 4X1KA 3WA6A 4FZVA 4JVLA 5HW0A 3WAJA 2E4WA 4UTZA 4HV4A 3ENQA 2NUPB 1PX0A 2IXTA 4OLAA 5AW0A 2JI6A 4XWOA 3RYHA 3PNBA 2ZU0C 1MT0A 2J3LA 4PNEA 3G2KA 2V7BA 1UZMA 2LRHA 1GNTA 3HRHA 4JXKA 5EUQB 3VYTB 4LV8B 4Q1EA 1ISJA 1XFDA 3AERA 1Y4DE 4YH1A 4HQLA 1GIAA 2PQMA 3R09A 3H2HA 2CXTA 5AW6A 2B3TA 4YYEA 4FILA 4JI0B 4KHPB 3MOIA 1JDJA 4EUHA 3GA7A 4UREA 1Z0FA 4YV7A 4LZAA 1IMJA 1QJ4A 2ODBA 2PKXA 2RAVA 1QCZA 2WPDD 3AUYA 3EAGA 3GRVA 3OT4A 4KP7A 4MUGA 3GB9A 1GITA 2BHLA 3NETA 4R9RA 5IXYA 3SX4A 1T34A 2P4SA 2X0KA 2VZ8A 2FYTA 1OROA 5C0OE 1BCSB 1VMDA 2QTCA 3MC1A 3W7BA 4BQEA 4J0CA 3A1EA 2D2VA 5I47A 3PP8A 5HR5A 2FWJA 5HOQA 2RB5A 2KBFA 1YZNA 3F3KA 1FMCA 3FLBA 5LLSA 1YU9A 3HCEA 1DUSA 3E0QA 4FSDA 2Y0PA 4IV0A 4A2PA 5KCZA 4EGCB 1E66A 2MINA 3PE6A 2Q3CA 4IQFA 5J9FA 4LCEA 4HGNA 3O7MA 3PQFA 4RIFA 2R6GA 3WI7A 2GWRA 1B1AA 2OHVA 2JH8A 2HHAA 3A1TA 3DVAA 4JJGA 1U9YA 3W2GA 4GVXA 4EKYA 2CHQA 3DAHA 5F21A 3M5CA 1JKJA 2BGNA 4NV1A 1A0OA 4UU1A 2F62A 3QVTA 3D8SA 3UWPA 4BYGA 2ZBGA 1ULAA 1VMKA 5CAEB 5CEJA 3QOWA 2PSSA 2WK1A 2JC3A 4PZ9A 1G20B 1TI7A 1YBHA 2NSDA 5FNVF 2R1VB 3OMLA 4QJ5A 4QTXA 1JLSA 2QD2A 2Y4NA 4QPNA 3RYIB 5KVSA 1WUTA 3T7EA 3GLRA 3R6WA 3GEDA 3MCVA 3CNBA 2VTKA 2PFKA 2A0UA 2PRZA 4HLNA 4AZWA 2GZHA 3D4PA 5JAQA 2ZSDA 1N33B 5IULC 5A9RA 1QHHB 1LQ2A 1IXYA 1NLYA 2YVAA 3IQWA 1K68A 3VSCA 3B51X 3I64A 2AMJA 1NJ1A 1NVUQ 1SAYA 3JZFA 4S1PA 5I7UA 5KYYB 1XQYA 4PWYA 4MV0A 1MV5A 3SEZA 4R8MA 1K7CA 3FCYA 4NCBA 2VPXA 1TGVA 2VPPA 5NULA 1TE2A 2C7BA 5J59A 3TKYA 1ORRA 3IR5A 3ZY3A 1GVNB 1QIHA 1JB1A 1G4AE 3OJLA 5BNFA 3ZJ5A 1H5QA 3L7MA 4CDMA 3FMGA 1I80A 2AEMA 3ASUA 3LWDA 1IK4A 2PZAA 4F2HA 5LL6P 1C9KA 1XUOA 2ZB8A 3GARA 3I34X 3TLKA 2NO0A 4IWXA 2GM3A 4PGFA 5MF6A 5D2CA 3BK2A 3HBAA 4RM3A 1FQOA 2B99A 3QXXA 2FJ0A 1RAIA 5G0UA 2JI9A 3CRQA 1Z0JA 4Z9BA 1E69A 4OBXA 3BXOA 2GEVA 4Z9YA 5J5CA 2IZ0A 2BFDB 4AX8A 2HD4A 3ZWQA 4YP1A 4BLQA 5TB5A 2O2XA 1THMA 3Q98A 4ZPXA 5CEEA 4KMOA 1EH5A 1KYQA 5KNCH 1RLIA 1T4MA 4IOKA 2QVXX 1GD1O 1Y42X 3SE7A 4B3TB 4X45A 2JFUA 4ER5A 1T9ZA 1XELA 2VHQA 2R1ZA 5CHEA 1FQKA 4MQMA 3VBEA 3ABQB 1G2QA 5KO2A 3A06A 1MG0A 4U02A 5GTDA 1E61A 1Y6QA 3GNLA 1BOFA 3QU9A 4H08A 3Q10A 3AP1A 4MS3B 1R27A 1LF0A 5J63A 1UDAA 1UMCA 3WL4A 4U3JB 1RI1A 5LMZA 2PX3A 5B1EA 3S1SA 2F67A 3OT1A 4G0XA 2GK4A 3TQFA 2NV6A 4B33A 4NV0A 4X95A 3RIGA 3OSZA 1I7SB 3AEKB 1NZDA 1JN0A 2FAXA 1A5BB 4FGLA 3FLAA 1HTBA 1UBUS 4EBBA 1ZD2P 1NHGA 4MZDA 1IJEA 2QM8A 1PJRA 4R31A 3WQHA 3R7WB 1X1BA 3G9ZA 3IOEA 4YRQA 1PV4A 3PFFA 4YWJA 2Q1YA 3BXZA 2IYNA 3C4JA 2Q5FA 3F3SA 4CMIB 1RZRD 1CR6A 4EA7A 1S7CA 2ZWVA 2X4LA 3MXTA 3FHJA 3PCTA 4AG5A 1FNMA 1IATA 2R3SA 4P7KA 4PSDA 1A9PA 4YUZA 4H6VA 1A5SB 2HA7A 2XDYA 4BNFA 3QW4B 1LS6A 1ENYA 1XK6A 2QD4A 4A7PA 2VQDA 4TSFA 1HORA 2YV3A 2PS0A 1W6RA 4W8GA 5KYXB 4IAOA 4L5IA 4PBTA 4N48A 2C9MA 4RPIA 1J97A 1KYIA 4EI9A 3DL7A 2JLBA 2G28A 2HQRA 1GTJ1 3QEMA 3A2NA 2WKQA 3F9RA 3GVHA 2F43B 3OOSA 4EHFA 5BV1A 4BN0A 1Z4LA 4ZRNA 4N5HX 5GJCA 5C35A 3TNJA 2ZSBA 3EA5A 3AIOA 1BEUB 1IL0A 1EPUA 2P5TB 2IWRA 3EMBA 3TIIA 4HH3C 1W0KA 2C2ZA 3T34A 4BMPB 2A5FA 3A7DA 3SR0A 2VJQA 2VJCA 2JZOA 1GFIA 5ARBA 2HHJA 4C1BA 2HJ9A 4O2BB 2WVGA 2BMEA 2V6GA 5FBZA 1QKJA 5HTKA 3ZGYA 1MHPA 1L5GB 5BWLA 1SC3A 2G3YA 3DOFA 2BUCA 3RE1A 1E63A 3D9QX 1QRDA 4FU0A 2CUZA 4F2GA 4HDNA 4MKXA 2VDRB 3TO5A 1AV7A 1KA9H 2FPUA 4FFOA 2PMKA 1QZ3A 3T7TA 1OPRA 4CM9D 4EG1A 4DHEA 2GCGA 1XRPA 4BU1A 2HQ1A 2IV7A 2QUHA 2CLEB 3IVCA 3OCCA 1JALA 3HA5A 4PNPA 4IRXA 4RJJA 5DGIA 4KV7A 3LTNC 2VBGA 1BGVA 1M74A 3QK7A 4MQFA 2R87A 3DEAA 3D8UA 3ZZ0A 2H9IA 1N4AA 2I80A 1LVHA 3H99A 5EQTA 3REOA 4CZ2A 3T5PA 1OIXA 4IWNA 5G0VA 1IOZA 2JBAA 3C3YA 1YI0A 3JZDA 1RSZA 3UCFA 4N6NA 2ZT7A 3AOEA 1E92A 4OQFA 5LBUA 3SF8A 2GEJA 2A2ZA 5E7JA 3ISJA 3L2OB 4H31A 5EZYF 1F4LA 4HZUB 1ABFA 1PCXA 4JQZA 2QORA 4A91A 1GKUB 4ZHQA 4KR2A 4Z53A 3RYCA 1WSDA 1O5TA 5KTKA 3DHVA 3P2JA 2OUKA 3FNRA 4CTJA 2C94A 4P3XA 2NXJA 4ZV4A 5KJ6A 3LWBA 4R1MA 3UJDA 3NCTA 2J0UA 2VBFA 1ZMBA 4HDRB 3BA1A 5EEGA 4Z8XA 3R24A 3VKUA 3G0BA 4FCVA 2NNLD 1C9YA 2FOXA 3DZJA 5B1DA 3DEIA 3RJZA 4BCDA 2Q50A 4BE4A 5ARDA 1XTZA 1SIOA 4LBZA 3Q1LA 4RZ3A 2VO1A 1UWCA 5KB3A 1ENZA 3NDIA 1T43A 4BV3A 1F2VA 3IAXA 1KK3A 1H2XA 5HS6A 2Y1GA 2YQ5A 3PHBE 4P08A 3W5BA 2RH9B 3OAAA 1CEYA 4UTXA 4WQMA 5CTAA 4KOEC 5YASA 3V8QA 3UPTA 2VHWA 3AC0A 2H4XA 2Y9PB 2REXB 2NADA 3GFGA 3Q85A 4G86A 1YH3A 1G21E 4I1VA 3KLBA 5AJTA 2FWAA 1M6VB 2GPNA 4FT2A 4NBNA 1W49A 3MWJA 1A1SA 2L69A 3H5AA 3MSCA 5GWXA 3AKYA 4LYAA 1KYVA 4MTLA 3P2EA 5K8JB 3NIWA 2RD2A 1YL5A 2H2HA 4OM8A 4N7MA 3LIIA 5IC5A 4GQIA 2PU5A 1WA5A 4J29A 4OGGA 3V1UA 1Z0SA 2NAPA 2B5OA 2VZ9A 2O52A 4CRWB 3GOQA 4GEGA 1TMOA 3QXJA 1S0UA 1MT3A 3WZMA 2XT6A 2YZ7A 3OM0A 2ZJBA 3R40A 4GP9A 3VR4D 2CLMB 5F1PA 4QE3A 1T2UA 3Q88A 1EFRA 1RCFA 3UK0A 3RTBA 3BXFA 3QNWA 5L3SB 2VYNA 2J3HA 3LWZA 1BFDA 3GW8A 3RSFA 3ABSB 3A0RB 4NYMR 2WHPA 1OHHD 2WFLB 2Y1XA 1D0SA 3C0KA 5JSQA 4JI7B 3IEVA 1MLDA 1Q14A 4MAMA 1DBPA 1NV9A 1XD8A 4UNNA 3Q9UA 4P7GA 4UQPA 4RH1A 3HUFA 1RMTA 2ECOA 4EITA 2P6RA 1M83A 3GGJA 1K6XA 1S5PA 1W29A 4WK2B 5MFZA 2HSWA 2YXNA 3CXRA 3FSEA 2VDWA 3LRPA 4KO4S 2Z8ZA 4G5SA 4QQRA 4TLCA 5BWBA 3MRXA 5I7HA 2P75A 5K2OA 2GHQA 1J1ZA 4A3SA 4CKWA 1FNDA 1RU3A 1DKQA 3HGQA 4MR9A 3QELA 4YAEA 4ALIA 4QOGA 1DQSA 3KKPA 1OGJA 1RKBA 2P11A 4AYXA 3T5AA 3I5YA 3JVVA 3HY6A 3H2SA 4PIMA 5IX8A 2COKA 3VSDA 1TGYA 1CDDA 3ZGVA 3L6OO 5BV2P 2CEAA 1OH7A 1NKVA 3B2NA 1S6YA 4PBSA 3ORRA 1NIJA 3G0GA 1XXLA 2R9VA 1OT5A 4JOQA 1SXJD 4TZKA 1QE3A 5DTEA 1L5NA 2C2KA 3MWFA 4TMWA 1ORHA 4XPZA 1ZVVA 3VVLA 3CUWA 3MS4A 4W4TA 1AGXA 4GC5A 1AN0A 2XAUA 3P2IA 1FDTA 3THOA 3U3XA 2ASEA 4D8VA 5AM3A 3LUBA 4GOJA 4D46A 1Z2NX 2V5AA 4AZTA 3LW7A 2ES4A 3SXJA 3RVJA 5B57C 3NHSA 2ECPA 1AMOA 1DAKA 1SVIA 1PZGA 2QX9A 7ADHA 5JJCA 4PX5A 2BR4A 3KRTA 5BQFA 2H4ZA 3VYSB 5JNUA 2HJSA 4IJWA 2R1VA 2FZWA 2Q27A 4JLSA 1JHUA 2W2NA 4LXTA 2QWXA 3JARA 4X1IB 4AYTA 1IVYA 4E94A 3T99A 3VR5D 4HYYA 2YWJA 4JUIA 3OQJA 1VP3A 2W37A 4X0EA 4RH3A 5ALZA 5AWFC 5BWOA 5KDOA 1L4YA 2QSZA 4IIJB 1GQSA 3RIXA 4E6EA 2V7PA 4UDNA 2LP4Y 4JBHA 5TEWA 3EYWA 3EVZA 3O1LA 2ZZNA 3R5JA 5IJWA 4BTVA 4AMUA 1K5GA 3DLAA 1T4DA 4BS9A 1X1RA 2CXPA 1EM8B 2D3TA 3P2KA 4M0FA 2UVQA 1Q2XA 2DT8A 3ZH2A 4TYPA 3ZYCA 4D92A 5JEDA 2AHOA 2EP8A 3J81A 5E6RA 1DQRA 3PC3A 2FSHA 3C2QA 4IMPA 4XQ9A 5BQXA 3QA3E 2B21A 4K5QA 4JLDA 2A0KA 4XE5A 1FLVA 2GBLC 5H68A 3WIOA 3D0QA 4V38A 2H6EA 1F2DA 4Q9NA 3ZWWA 3DR5A 4UAUA 3B1WA 1GPJA 2VF5X 2C2YA 2CE7A 2GVZC 4H1VA 1AXRA 4L08A 4RETA 4C30A 3ZBTA 2H1CA 4AD8A 2V3VA 3I39X 3OHPA 1C3VA 1N6HA 3HY4A 3HCDA 1Z5OA 1H6BA 1LWNA 2PX2A 2XPCA 4NVRA 4WZBB 3SQNA 3VPXA 4RTLA 2ZVJA 1EFHA 1N2SA 2QVBA 5K09A 5KYNA 1R0LA 1EK2A 1ODLA 1XU4A 4XXHA 4BQNA 4CV0A 2FPPB 1VI5A 4NX2A 1KBQA 1DIBA 1CEQA 1XI2A 1YRBA 3DE2X 2PGNA 2ZYAA 4L73A 4AZ3A 2W2MA 1Z6XA 4V3CA 2JIMA 4CMCA 2O5RA 2BFAA 5IJ0B 3SZMA 2GLUA 3HH8A 3GR6A 1U7TA 1THTA 4NBTA 2CUTA 3KYIB 1TKAA 3FYHA 5TF0A 1IBCA 3IPCA 1K2VN 2G67A 4JZKA 5M3BA 4AZVA 3V1NA 4X1KB 1X1SA 3CB4A 3EQ6A 1N2HA 1UM9A 2Z4RA 2V9CA 4D9HA 4UW9A 1XWWA 2BM0A 1OX4B 4K05A 2ZXFA 3MWGA 1NKSA 4WD3A 2QVCA 3TZKA 1LUAA 4QQFA 4MGEA 4AKEA 5B7GA 4EP1A 3BORA 4F7DA 2CJYA 1C0IA 4NZ9A 2BV3A 4DLXA 1YVEI 3L0IB 4URFA 1H94A 3NOXA 2ENWA 1BVHA 2OD7A 4J6EA 5LWQA 2UAGA 3IAAA 1FP4A 4EB0A 1RHQA 1JH9A 3K32A 3ZU3A 1V8PA 2VS1A 3W5SA 3JRNA 2EF0A 2GNAA 3EIQA 4XLZA 3PXUA 4ZAFA 3B6MA 4WBSA 5CXQA 4ECEA 1UPBA 4HATA 4M0PA 5E2AA 4F96A 1N5JA 3AG5A 1PTJA 4B7ZA 3EGEA 3OSUA 5KTTA 4WN3A 2XF8A 2B8TA 3H9EO 4F97A 2PZFA 1I3OA 1MO2A 3L92A 3ESQA 3AW8A 3FA2A 4I5DA 4RDXA 1RAHA 3NTUA 3T3PB 4IEFB 5LBIA 4RTJA 1LQUA 4BO0A 1RYEA 3A9SA 5CB4F 3NDJA 1JTVA 1GGKA 1KK2A 3G89A 4FIDA 3ZD6A 1IEQA 3FB4A 6AT1A 3GGGA 5ALOA 2PUEA 2REQB 3K0AB 4N82A 3G5TA 4PW0A 1OZAA 2QY6A 2D5BA 1IYZA 2DJIA 3M6WA 4BLPA 1FEZA 5JECA 2N9UA 3FPKA 1HTTA 1A5AB 4WN9A 3RIEA 2OO5A 1U7OA 3JZIA 3FSRA 3MAJA 5KKAA 2QZZA 1KEKA 3D3WA 5KC8A 2BEWA 3TL2A 4GYKA 1F4PA 2H29A 5AP9A 5I9TA 2XF2A 1SY7A 4NWIA 1NUHA 4WWHA 1GL3A 1QB8A 4HUTA 3FYCA 3ESRA 3RODA 3X1XA 5C1BA 3H83A 3HYLA 5DI3A 2C97A 2J9XB 3A4TA 5AVUA 5JH7F 1JS1X 4NOLA 1AUXA 4Z3OA 1F9EA 2Q0QA 3KT6A 3RS7A 3AR5A 4UNRA 3I42A 3BVPA 4PC1A 3JQGA 3RUHA 5HPYB 1YB1A 1SXPA 3U31A 2RK6A 4DZTA 3V46A 4EKGA 1PV2A 1I4DD 1P9RA 3PGMA 1TK3A 3PFHA 3GJ4A 1XZIA 1QFSA 2D1FA 2NSYA 2PCLA 3FPFA 4GW3A 1PEKE 3PUKA 4S0XA 3CRNA 3F47A 4TQ9A 2YMLA 3UPUA 5HG0A 3CO0S 3M81A 3ND7A 4YT5A 3T4EA 3DCNA 3T38A 1H42A 3NM4A 4Y6RA 2B0CA 3ZS8A 4V2IA 2RJ3A 3BS4A 5DWDA 3OWXA 1QV7A 3R0VA 2V0GA 3WLIA 4I9FA 2W4MA 3M3PA 1PVOA 1I94B 4JDPA 4BNIA 1ZO8A 2IKQA 5EMNA 2R60A 4Q39A 1XZDA 5B1HA 3TB6A 3UBTA 3G2IA 1GGVA 1ECPA 4I1IA 4MI1A 5TPWA 3U0BA 3BAFA 4M1SA 3VPHA 3KZXA 3V9PA 3FUVA 3OFJA 4M0UA 3BL5A 5BYAA 1AGRA 3UOGA 2GCEA 3A6JA 4HDMA 3IUSA 3HKCA 4IW3B 1S02A 4TRRA 3IBYA 2BHTA 5CGQB 2OAQ1 4R54A 2FRDA 5KVAA 5EWMA 3E5MA 4GG1A 2EFJA 3AU9A 4HWKA 2BOVA 4Z86A 2ZGVA 4DIFA 3ZK9A 5AHOA 1BW9B 4A6EA 4C7VA 1KWKA 1IQPA 4KVAA 4FDLA 2YOGA 1NN0A 5JNWA 2P4HX 3ETHA 5LXTA 5EJGA 3VDXA 1T4BA 1N7IA 4OHWA 4DB4A 3LGAA 2PX4A 1RM0A 1Y3CE 2QTRA 5AUPB 1IZZA 2WA2A 4H7KA 1P2GA 3GLTA 5JCJD 3QYAA 5CA1B 3WWCA 3KNZA 4DIKA 2XIQA 1BRTA 1Q0ZA 4B3HA 1ESZA 1TCAA 2E1RA 4QWWA 4BFLA 4OY3A 4ZKDA 1AE1A 1QYRA 2BGMA 4IIEA 1NTRA 1R9MA 2W2KA 4H7DA 2XQGA 5HJEA 2OY0A 1R6TA 3WNCA 2HW8A 1JEQA 1W5BA 3L46A 4EARA 2J8ZA 3TQQA 4FR2A 4E11A 5FHQA 1RJFA 4ZVTA 3MWLA 5D3ZA 5HFNA 5TQ0B 2F6RA 1HKUA 3OIUA 2ZIAA 1ZH2A 1Q7TA 1Z39A 4LWPA 3AB3A 5DYNA 4UC0A 4X5OA 4V0RA 4RLHA 2ZOSA 1XPJA 1DIAA 2FK8A 3EVFA 4EZIA 4F93B 3RJ5A 3EZXA 4L8WB 1GRQA 4NCAA 1G8PA 3E2PA 2E5WA 2DKFA 2IHUA 5EIHA 4D44A 2P5YA 3U09A 2NYRA 1NVKA 4KX3A 4ZIRA 4JENA 3SS7X 4U6QA 2WAAA 4CODB 1U3GA 4YUXA 1JHMA 1RYZA 2ADOA 3O2SB 1NASA 2JCGA 2ZKIA 4QUIA 1DKPA 4DADA 3RU9A 2D7JA 3KUDA 1SQFA 2C5EA 1GZDA 1IPHA 1HE8B 2XMCA 3EJ6A 4H2DA 3VRHA 4JJKA 2ZRCA 2GSDA 3ZDDA 2A9FA 3KXDA 1F60A 1O97C 1VI2A 4NBVA 1CF4A 2A5LA 2JARA 4NF2A 1NUQA 1YK1A 1NX9A 4B45A 4CE6A 5CDSA 1MGOA 5JAZA 1CUSA 1CV2A 1ZEMA 2ZRKA 3C1OA 3IQDB 1U28A 1F06A 4IIJA 4OP2A 3DFKA 3DZCA 5F4ZA 5FA6A 2D0PB 4GF5A 3UWKA 4DQ0A 5IEJA 2Z57A 3N75A 2AX3A 4BVJA 4HADA 3I9NA 1H69A 5C31A 4GSKA 2NSLA 4KXMA 2C61A 2Q7DA 3AKCA 4PYMA 2RGYA 3B1XA 1NN3A 2P5SA 4QUBA 5KTSA 5HKBA 1KQOA 4MKFA 5DIZA 3BZWA 1PR4A 1OTHA 1OTYA 1U1FA 4P2BA 2IV2X 4JV5B 4LSGA 4JR0A 3TMYA 3JAKA 5KJ1A 2ZRBA 4CCYB 4XWWA 4JT4A 1X13A 4ND6A 2A5DA 4TT3D 3ZH9B 1N77A 5CDFA 3O0TA 2XX3A 2V6FA 3L77A 3DBLB 3KYCB 3MW8A 8ATCA 1T2CA 4KDCA 3TOZA 1I7QB 1TM7E 2OCPA 2WIKA 3DZIA 1KYZA 2PAAA 1BD3A 2ZJ0A 4EATA 3V55A 2GJ9A 4H7HA 3R3WA 2BMJA 4HZIA 3WIVA 1BD4A 3NVDA 3AB8A 5E8JA 4YP9A 1LTQA 1UPUA 3M3DA 3W05A 4LQCA 5EUBA 3R9XB 1WABA 4YO7A 5IW8A 5TGZA 2VJAA 2WG2A 3K2QA 2E6UX 1LRLA 1EUCB 2V4ZA 1ZICA 3RABA 2XYRA 1OZHA 1V35A 3RV3A 1TK2A 2YTZA 3Q12A 3EYAA 1D03A 1KYWA 1ONOA 4XZ3A 4YASA 5CA1A 3THWA 2Z4SA 2IX9A 3MRTA 1C9JA 2HNKA 5DULA 3JQBC 1GXSA 4MVJF 3SVLA 4ZT2A 2PNJA 4DKXA 3WLJA 4ERXA 5ICSA 2KW5A 2Q99A 3ANSA 2DFDA 4FCWA 1N5RA 1E3DA 3TQOA 4EJ0A 3DM5A 1KPGA 1TADA 1WCV1 2JIZD 3F7TA 3QE2A 3CY6A 4HB0A 5TT1A 2K7FA 2FNAA 4MR9B 2H9YA 2XTMA 3M3HA 4OGLA 2GAOA 3OKAA 3WICA 4HOYA 3NAQA 4RCZA 1DFHA 1UMDB 4FFBA 3B3JA 3TLYA 1PJ4A 4TMVA 3ZK8A 4WZ6A 3JQRA 4AX4A 4Z0NA 2F59A 1F6WA 1CRZA 1NY6A 2VDMB 4D41A 4GPIB 2Q5LA 3OKFA 5IK2A 5JYEA 3IJPA 2OVFA 2GEUA 5ERXA 2XUQA 3ZWNA 1XCBA 3THXA 3A6DA 1LSUA 1WZEA 2HWKA 2HXSA 4G8BA 1T9GR 2OYRA 4YV0A 2GM9A 3P9KA 3AEUB 3ZW7A 2PV0A 4HMOA 4WDQA 3CH7A 1SK9A 1XPUA 2GYUA 3W9UA 1KO1A 4WCFA 3FKSD 4UM7A 1CT9A 4J07A 3VNRA 2BCJQ 2B9EA 3OPMA 4WECA 4H4DA 4G0WA 1IY1A 4OYLA 4AIRA 1DI0A 2QOEA 1OBFO 3PWZA 5HIJA 2JGIA 4Z2YA 3B48A 2GXUA 2IU4A 3I5UA 1FA9A 5A3SA 5T6BA 5CDTA 2AOUA 2YY7A 3WXBA 4TLLB 2O7RA 3W7AA 1VLMA 1KEPA 3N0TA 1I36A 4EUSA 4KMMA 2CL7X 3Q7SA 3LO5A 2BM1A 1UM9B 3GPDG 3HB1A 4OEHA 3K0SA 1JHYA 2HR1A 5JYDA 1KK0A 3SQWA 3M83A 5J3JA 1QC5A 2CBZA 3D2CA 1REQB 3FZEA 3G0OA 2AFHB 4XUCA 2HJHA 1IXKA 3OPYA 2V6JA 5ICEA 3A3PA 3FUCA 2PYIA 3MTJA 4U2BA 1Y9ZA 2E4UA 2JFWA 2KB0A 2O0HA 3DEKA 1GYPA 3DCYA 2QXYA 4BZPA 2ZJAA 3OECA 4YAWA 4Q9DA 1KZ6A 4WASA 1D4AA 4IXMA 2J48A 2ZJ8A 4JC8A 4TS4A 4EEZA 1LS1A 1AKNA 3IUYA 3FTEA 1TLLA 1WMEA 2AI1A 3FYUC 4IPTA 1USGA 3RVDA 3O1JC 4Y8VA 4DR5B 3BGOS 1QMGA 2IGTA 4UNPA 5EKXA 4EW1A 4YRBA 5FD8A 2OPHA 5T57A 4WXPA 1DPGA 1N3LA 1K3UB 1Q0RA 4E31A 3KYDB 5C5DA 1ESEA 2R68A 3AL3A 1CB0A 2GO7A 2J9FA 4MV1A 4ZRDA 1EAYA 1NUUA 5DXFA 5TGDA 1KH1A 2DJ5A 2NXNA 4J91A 3MLBA 4GMKA 5K3CA 3RJTA 1NLUA 2AL7A 3OICA 3TQRA 4CR6A 4WXYB 2GILA 2O7SA 2X8AA 4ZO6A 3ZI7A 3KD3A 4RHTA 2GCPA 3OIWA 3RKUA 3DOJA 2CJWB 4RFSB 5CT5A 1ZH6A 4YRIA 1NOJA 5BSUA 2PUGA 2J9YB 1JHQA 4KXYA 1A5ZA 3CWCA 2DFKB 4Q7JB 1YHZA 2EKZA 3IQHX 2PT9A 3KCNA 3KLPX 4DNQA 1ZC4A 3KR2A 3U3JA 5FV4A 3LUPA 4CI0B 3DGFC 1W4AA 4P54A 1GL9B 3I04A 1MNAA 5JANA 2EGGA 2F64A 3S2GA 2F90A 2G8LA 3KQOA 4FBMA 4G1MB 2NVOA 4HI0E 1RTKA 3U44A 2D54A 1MR3F 1F0YA 4HNHA 2HO4A 3LL4A 2Z9BA 3DOUA 2Z2XA 2UYOA 3FZYA 5IDWA 2AN1A 2Q6VA 4L72A 4I4CA 2F1HA 4BX3A 3IHLA 1LKZA 3C3EA 2OYCA 2I33A 3A36A 2FMHA 2I1VB 1NMEA 1OZ0A 4GX5A 4XR9A 4RULA 2BGKA 5IKMA 1UMDA 3PEWA 1K7EB 2CL0X 2PKQO 1CG6A 2BY4A 3Q4GA 2JLAA 3STVA 4BJ5A 1J0CA 1DCTA 2ZJ5A 2W2LA 2GEBA 2O4UX 3NHLA 4IJ5A 4Q93A 1MXHA 4MAFA 1JHPA 2XIJA 2DHEA 3N0RA 1CJKC 5CD1A 1B8OA 1VLHA 2NP7A 3S29A 3UH0A 1ZW1A 4F9FA 1XRRA 4DQXA 1G3MA 2ZI3A 2X6RA 3K53A 3OLQA 5DGXA 3VU3A 4RVHA 3WO0A 1TZMA 1P0QA 3EARA 4EA9A 5IASA 2WIJA 1RQLA 4CR7A 2H4HA 4BMDA 1E64A 2QBYA 2FW8A 4IGKA 4D4LA 1Q17A 1T25A 4JJEA 1HKHA 3BJRA 3PNKA 3MT8A 1KMHA 4MW6A 4ONEA 4WKGA 1L7PA 2NU7B 1M0TA 3HUEA 3IA2A 3HBLA 1J22A 1SJ9A 4QHTA 1ZM3A 2J09A 4E32A 2C00A 2NUAB 4F45A 4BBAA 3N2NA 4JMLA 1I2ZA 3PZBA 4N47A 4M22A 1SRRA 4MRPA 5D8DA 4DJEC 3T9FA 1N1EA 3PX2A 1DAOA 1D8AA 1YQEA 1QTQA 3ROKA 3VH1A 5JSFA 1APBA 5CYGA 3HM9A 1SCUB 3OZWA 1P7PA 4X9XA 2OBBA 1EVZA 3MN1A 4QDKA 2RJNA 2OBLA 5I9BA 1V3QE 4DSTA 5J4YA 2CYCA 1X7ZA 1NZJA 1X6VA 2NSJA 3I3OA 3OE7D 4DLTA 4HRYA 4TWJA 4F1WA 1FYDA 1NVEA 2R7AA 4QREA 3DTYA 3O74A 4Y3UA 5B64A 5L7TA 3RUCA 1L7BA 2DOKA 1XMVA 4HX5A 3C7TA 4KZPA 4ATNA 2G8NA 3QY9A 1HQKA 3T4UA 1BSVA 1QF7A 3VBCA 1ZQ9A 1YL6A 3Q8MA 1KORA 4AJ2A 1P18A 2X7HA 4QUDA 4RUKA 4Z6KA 3H6HA 3NHAA 4GPEA 4MRSA 1HFWA 1CLEA 4EELA 2XVAA 2P6PA 1PL8A 3MUOA 1FDIA 2R8XA 5FB3A 4CQMD 1QLJA 5A6VA 2GF2A 3NCHA 3BD9A 3LXUX 1OR8A 3D6UA 3FAKA 1WVIA 4JC4A 4YCJA 5DP2A 3GLFB 3A9RA 1OLXB 3OEYA 4PY2A 5KNDH 1HRKA 3OLZA 3MFYA 4WOBA 1ATIA 2R4TA 3WWOA 5KHOC 3AWDA 2H2IA 3SMVA 1OI2A 3CEPB 1LQTA 1CW2B 1XF1A 3EXHC 3KHUA 3C6QA 4OCZA 4UM8B 2FN8A 3VDNB 4EENA 1G4UR 2J0EA 4HH0A 3O8OA 1FS4A 5LYJA 2G82A 4TV9B 3WLLA 3E61A 3FW1A 3LWNA 4LE2A 4N8EA 4P86A 3T12A 3VOBA 1CQJB 4NCIA 4QUGA 2DLDA 3UICA 3WKAA 1EDBA 1SB8A 5GPBA 4GWLA 2ZIUB 3HCAA 3HQ4O 4QJ4A 5FTNA 4Z3DA 1ARZA 4BX9A 2P9CA 1RWWA 5CURA 3IR6A 3UATA 1CBUA 3W8FA 1I3NA 3QKUA 1Z0DA 2MYTA 3NTXA 4CIBA 1JKIA 3FPGA 3L4JA 1TT5A 2FY8A 5BQOA 3QPBA 2NTEA 3WWZA 4MV4A 1RDFA 4N5LA 2Q7OE 1KP2A 2R7LA 3MUFA 3PLRA 2KYRA 2DFLA 4QOSA 4RD6A 3KQWA 4YUVA 1QVAA 5ULLA 3DBIA 4PPQA 4XFJA 5G4KA 4BLTA 1JPNA 5J2TA 4CT4B 3PGXA 5KQLA 2ZKLA 3DCJA 3PKJA 5LLDA 1E0JA 1AOXA 2B92A 4RMIA 1DAHA 1F8XA 4BFUA 3OPQA 1EXMA 4JOSA 4WBNF 4PFSA 4CXMA 2J3QA 2LIPA 3QUCA 3B9QA 3VJRA 4CT0A 3ZHZA 2AUMA 2VG8A 5K0JA 3WLEA 3U17A 4N7RA 1UWVA 3V6MA 2H1SA 3N07A 1J2TA 5AM4A 1QDEA 5JSHA 2WVAA 3X1DA 2CFTA 5BV7A 1AQYA 1L7MA 1W88A 1ZCBA 3F71A 1NXQA 4MJLA 2YWGA 5H81A 1IUOA 1JQBA 4JU9A 3K15A 1ORVA 4F4HA 5B4UA 2WWYA 5K51A 3JPWA 2PUBA 2CYAA 2XUJA 4FX2A 1Q0PA 2JCXA 1DHRA 2P65A 4ZA2A 3RYFA 5SZHB 3LLSA 5MGNA 4RJTA 1OV4A 1KRHA 1WXEA 3EF3A 4INJA 1G19A 2BFBA 2C5AA 3ETLA 3NHKA 1P0MA 2WHQA 1V39A 2Z3VA 3NFRA 4KBGA 5E9WA 3V32A 3THYA 2QYTA 1ZGZA 1C1YA 2Y1EA 3HP1A 3MTEA 4TVOA 4DV4B 1B4DA 2QLFA 1NRXA 3ELBA 1U2TA 4XYEA 6PFKA 3OPYI 4JCOA 4S35A 2FPGA 5FO0A 4I1PA 5DJ5A 1W85A 1ADGA 1ZGCA 3AUAA 4JJ6A 3SGLA 4GPZA 5DSZA 1XVUA 5IT4A 3AI7A 4U6NA 2AD5A 4NAHA 2R86A 1EJBA 1XEAA 1KIFA 5LQNA 4XQEA 3B20A 1ZU4A 1S3SA 1Z2PX 2ONCA 3N8IA 5IG2A 2Y27A 1ZNXA 2I1QA 2PUHA 3I6IA 1U1EA 3LD9A 4TV9F 3QKSA 4RD0A 4U7JA 5JQWA 3CEMA 2Z98A 3IIKA 4GBED 1PDVA 1E0KA 5AQEA 5IBQA 4X7MA 4ABTA 4NL4H 4ZT5A 1TM3E 2A0XA 3C6MA 4J3NA 5KMGA 5LCXA 3V3TA 2XCRB 1XJ5A 4MGKR 1D6MA 1NFRA 1V5FA 3MRSA 4LJ4A 1DOZA 2VYND 5FPYA 1Z4KA 2CVHA 2HYDA 3HBNA 5PNTA 3TS1A 2C1XA 1WKCA 1KP3A 1VQ1A 4U7WA 2H18A 4J0FA 3UH1A 4YRZA 4BYMA 5DNDA 4DQLA 1XPOA 1DBSA 1V5EA 2Z1MA 2C96A 1QKIA 2DQSA 2VWPA 3OZGA 4K9DA 2BBWA 2HTEA 2ZYTX 4PGGA 2Z8XA 2OM6A 2Y92A 3A1VA 1IN4A