5HE8A

Bacterial initiation protein
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
163
structure length
163
Chain Sequence
LDVAMAADDICTAITNGEQVKGLYLYGPFGTGKSFILGAIANQLKSKKVRSTIIYLPEFIRTLKGGFKDGSFEKKLHRVREANILMLDDIGAEEVTPWVRDEVIGPLLHYRMVHELPTFFSSNFDYSELEHHLAMTRDGEEKTKAARIIERVKSLSTPYFLSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Helicase loader
publication title Bacterial initiation protein
rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 53
structure length 163
sequence length 163
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2016-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5he8A00
3K70C 2AN9A 4FMCF 3A4NA 3VR5A 3THWA 3A1VA 1WA5A 2IYTA 1Q20A 3EASA 5JHGB 1NI3A 4Q00A 2LWIA 5J4KA 2A78A 2YV5A 4MYHA 1MH1A 4NL4H 3TW8B 1W36D 4C0HA 2IEZA 3QJYA 4DKXA 1HT2E 2EYUA 1KHTA 1Z63A 4D80A 1S2MA 4M21A 4P4SA 4DSOA 1R4AA 1QHXA 3J81k 1M34E 1IN5A 1U99A 2QBYA 1Q12A 2CMKA 2XSZA 2BBWA 4M1WA 1FNMA 2FH5B 3VNUA 2RAPA 1LY1A 1OIWA 2EFDB 1N2CE 3FDIA 1Z0FA 3K0FB 3K09A 5AUNB 3BFVA 3MJRA 4B3FX 1LFDB 2QPTA 1AKEA 1VCNA 1G20E 1W47A 2HCBA 3Q7PA 4LJ6A 4BFWA 1GVNB 2V8OA 1ZUNB 4B75A 5J4YA 2Q9CA 5FOTA 4URWR 1KAOA 2IYVA 5E95A 2V55B 5F98A 4BWYA 2NO1A 1FUUA 2OEPA 5CIQA 1S8FA 3NTUA 4J0QA 4A0RA 3KKNA 1S0UA 4JVNA 1Z0KA 2DFKB 1FL9A 3BOSA 3MLEA 2J7KA 4RD2A 3W3AA 4FINA 4KO8A 1IJFA 4ZO4A 1UPTA 2G83A 4JLKA 4E22A 4Q9LA 3T1OA 1MABA 3I4LA 3I8SA 4BLTA 3IQXA 3B60A 2A5JA 4NYMR 4Z8XA 5KTYA 2F55A 2FGJA 2R6AA 2D2FA 2ZXUA 2VSXA 2WVJA 1U8YA 4US0R 1J8YF 2D4HA 3KB2A 5B57C 4ESHA 1C4OA 1P73A 2H16A 1KI2A 1NL3A 3T1VA 2YOHA 5F9HA 2DWPA 2KB0A 4XVQA 1W4BA 1YZUA 4HLDA 3SJZA 3THWB 1QHYA 4WZBE 3LQRA 4BFSA 3KTAA 4B2LA 5DN6D 3IUYA 5JJLA 3FGNA 1EFUA 5EUQB 2ZRAA 4JSYA 1QBKC 1XF9A 4RFSB 4NCJA 1W46A 1ETUA 2ZJAA 3AH8A 4WOPA 5JZVA 2C98A 4DDTA 3SJCA 3K0EA 4RVCA 1CULC 3EZFA 4TYYA 1N6NA 1DARA 1WB9A 5AJWA 3UKDA 3FFAA 1AS2A 1GG2A 4JVSB 5IK2A 2ZYUX 5EP1A 1OH6A 1P5ZB 2ODNA 2VIIA 4IFBA 4OI1A 4JLBA 2WOJA 5CM8B 1AQUA 1R5NA 4ZCIA 2ZS9A 4LHZA 4JT4A 1G8GA 2W0MA 3RHFA 2QT1A 3V4RA 5CJ2A 1SKQA 5M04A 1ZCAA 2FPKA 2CJWA 3K9HA 1JAIA 4JBYA 1S9DA 4KI0A 1Z6XA 4LV6A 2ZS8A 1RE0A 5FFMA 3MWJA 3BB1A 4DLWA 1YZLA 1E9BA 1Z47A 3P4XA 4MKFA 1D6JA 4RD6A 1SZPA 2PCLA 3CX6A 3A8TA 1KIMA 3PUWA 4Q21A 1WXQA 3B78A 2JJ2A 5FOXA 5DO9A 4DLYA 2R8RA 2LKDA 1ZIPA 1FP7A 3KX2A 4DDUA 2ODEA 3AKDA 2OHFA 1DEKA 3K0AB 1E0KA 3NG1A 5JLJA 2Z83A 3BAFA 2PZEA 4C0AC 4HDOB 3ZVMA 3NDBB 2ZI9A 4D25A 2C9YA 1JEDA 1G3IA 5KSPA 2XGJA 3WHKA 3VKHA 3PV0A 3MFYA 1XXHB 2PH1A 4QNMA 2MMGA 5JSZA 4JZKA 2KJQA 2ZJ8A 5FI0B 3EWSA 1XTKA 2YWEA 3KZ1E 2Q3MA 3VQTA 1SXJA 2FPLA 1MO4A 3MWLA 3OEHD 1E98A 3QXHA 4JL5A 1P2SA 2O8DA 4JVMA 3B1ZA 1Z8FA 2QAJA 4EJSB 1XP8A 2YZ2A 4ARZB 1UAAA 1XU4A 4NYMQ 1G7RA 5G41A 3HU3A 4U5XA 3FB4A 3LA6A 3KFVA 4MGKR 3GLGE 1W0KD 2BDTA 3ECCA 2Y8EA 1TMKA 5E4FA 5F9FA 3WRYC 3JVVA 5FOSA 1GKUB 1OH8A 2GF9A 4BLRA 2H5EA 2HXYA 2ZYWX 5EP2A 4MUBA 4TT3A 1Q1ZA 4DB2A 3KFXA 5FTMA 3TE6A 2HF9A 4IEIA 4P3YA 4XSGA 2QG6A 3AVPA 3AKYA 4NCHA 1SXJB 4JLNA 3E2IA 5TV2A 2OFXA 1CF4A 1NMZA 2D06A 2WOOA 1KO7A 3OHMA 4HB2A 3SJAA 1GDDA 1J8MF 3BS4A 3PENA 1FW6A 1IM2A 2N46A 4XVRA 421PA 3RRNA 5FTLA 5LPNA 1ESMA 4IDPA 2PMKA 4RZ3A 3G5UA 3SFZA 4AYXA 1N25A 5L3VA 4DSTA 5BYKA 2PEZA 2D7DA 3FMPB 2QE7A 2RH5A 4C2TA 3CPHA 1AS0A 3KXKA 3IIKA 1U98A 3TMKA 4TQUS 1D2NA 2IF0A 3KUCA 1NVVR 1FMJA 4YONB 2BMFA 2VF7A 4NHOA 1AGPA 3R9IA 3I72A 2NPFA 4QBGB 4PPNA 1QVAA 1XEXA 2GILA 1ZP6A 4DLRA 2WIAA 4UNNA 2OV2A 2YOFA 1A5TA 4UNPA 1ZU5A 2QMOA 3QI2A 1QHGA 4D0GA 1JECA 3WYAA 4N3NA 821PA 1XNJA 3QIAA 3EC1A 1CRPA 4M1TA 1XEFA 4ZI2A 4ZKEA 3GLGA 3RSOA 4KFSA 5AUPB 3FHOA 2YJTD 2QA5A 3C41J 1ZU4A 4Q1EA 1QHSA 3PEYA 4D81A 1W2GA 3LQQA 2ANCA 3MJHA 3W6OA 1YQTA 4DLXA 3KJEA 1KO4A 4DJTA 3E5HA 4TN1A 1Y63A 4YLGA 1KTVA 521PA 4S35A 4HAVA 1MT0A 2JJ2D 4OQNA 2VHTA 2ORVA 3EA5A 3F5FA 5GJBA 4DWJA 4HLQB 3CWQA 1GRQA 3DM9B 3Q3JB 2FNAA 1QZXA 1NKTA 1DTSA 3Q85A 4FMCB 4YDSA 1VG0B 2HXSA 2Z5FA 3B1YA 2V3CC 2B6HA 2JJ1D 4NYIQ 3MAAC 1COWD 4KFRA 3ZGXA 1FMLA 3ZVRA 5AUOB 3ZDQA 4QM6A 3GLFE 1HUQA 5EZ6B 1XDBA 3V9PA 3THYB 2VP9A 2JLWA 3QXSA 1FOEB 2ZRDA 3WMFA 5BN3A 3TBKA 4MRNA 3M4YA 4Z8YA 1G17A 4LJ7A 4NZYA 5KOYA 2O8CA 4DLUA 4OQXA 1BOFA 3CBQA 1M2OB 1TADA 4TMWA 3NBYC 2AK3A 1E9DA 1JR6A 2OZEA 3B7GA 4XD7D 3REFA 3C7KA 4KVGA 3GCGA 5IRCD 3KQUA 1UBCA 2OCBA 5CB6A 5HPYB 1KMQA 4NPHA 3W5IA 2GTPA 2GESA 4D26A 1AGRA 2AXPA 2KSQA 2ZVPX 3RRMA 3T1TA 1XZQA 2J41A 3VU9A 1YR6A 5C1BA 1HQYE 4CEHB 1OB5A 3QG5A 2WWHA 5BWMA 3WMGA 3VR4A 4C0BA 2MMCA 5FTNA 2UZ3A 4IJMA 1UADA 4HDQB 4TLBA 3NEYA 1G8FA 1GRNA 2PT7A 3LXRA 3FTQA 2QL6A 4A82A 2QTVB 2R62A 3B5JA 1R7RA 2O0JA 4IOMA 4A2QA 1PVOA 1EXMA 3QE0A 2WZQA 2GCPA 1SVSA 4YQFA 4XOIA 4C7OB 1KDOA 2IYRA 5FPTA 3RC8A 1U94A 2ERXA 4TL8A 3HR7A 5L3RA 1FQKA 4RD4A 3U3OA 1II0A 3I73A 1Z07A 2V6IA 3V4FA 2MSEB 3DL0A 4LYJA 2RGNA 5BN5A 2WAXA 4NONA 4XWKA 1DAFA 2OUKA 3TJZA 4A4DA 3R9WA 3W8RA 4V0KA 1QDEA 4QXAA 3MRSA 2CK3A 1YZTA 3NHBA 4DT1B 4LJ8A 1VDZA 4Q7JB 3H1TA 1IJEA 1Y3AA 1YU9A 2FZLA 3VKGA 3C5HA 4LUCA 3EX7C 1KI4A 1DOAA 1OIVA 5JWRA 3GLGB 3ZVNA 4EQ6B 2ORWA 1XJ0A 4OI4A 4BECA 1C1YA 2FV8A 4EPRA 2DCUA 3CNNA 4KITB 1ZM7A 1VYTA 4Q66C 2VSFA 4S2EA 3CM0A 4NDZA 1JB1A 2P5SA 3SDZA 1O3YA 2KWIA 2YWGA 3VX4A 5K8IA 4O3MA 4DSUA 1T9HA 5CLLA 4GP7A 3AVTA 2J1LA 4CF7A 5KPDA 3G0HA 2W6IA 3B9QA 4DVGA 1J7KA 4BLOA 1GTVA 3OE7D 1FP6A 4W5JA 5J5CA 4P32A 4HUQA 2ZUBA 2J3EA 4GBMA 2WJVA 1D2MA 2UVQA 4GDFA 1KI3A 3A1UA 4BLPA 3MG9A 3MUFA 4CIDA 1A2KC 1NLFA 4IXMA 5G3YA 2C9OA 2GJKA 3FMFA 4BEJA 1HV8A 1Z2CA 1DBSA 2X2FA 2ZITA 4JLAA 4G01B 1KI8A 1VCOA 2QQEA 2WV9A 2HT1A 1Q1BA 3ND8A 5JSZB 3FFBA 1ZBDA 1AA9A 2I3BA 4O2RA 5KSOA 4AG5A 4DCUA 3RS5A 2WM9B 3SBEA 4WAUA 4L8GA 2OLJA 1OKKD 3TUZC 4JLVA 1IY2A 1ZW6A 3AB3A 3IKJA 3SOPA 4ACAA 4CZ2A 3CRMA 4YDHB 4LSGA 1G1MA 2BM0A 2ONKA 4DCTA 1TQ4A 3RSLA 1XPRA 3AVXA 2WJGA 3EIHA 1HE8B 1CJMA 2NIPA 3EZ7A 4M9QA 4DSNA 2ZRBA 4MGZR 3BJIC 1CLUA 4CDGA 2ZAOA 5JBQA 4LJYA 3DVLA 4KSCA 3RABA 3SQXA 1KDRA 4A8JB 1VKJA 3LLUA 1CP2A 4DHEA 2ZQ5A 3CF6R 5EE3A 1WBBA 1W4AA 2CVFA 3L2OB 1ESNA 1NSFA 4PAOA 2AX4A 2J9RA 1Q57A 3PQCA 4TL6A 1U90A 4I1VA 4G5QA 3AUXA 1VHLA 3SN6A 2BMJA 3PVSA 5J4VA 3B1VA 2VBCA 1XX6A 3GLHA 2QPOA 4HAYA 2P6UA 1G291 2H57A 3CONA 1RPZA 2RMKA 2XXAB 1YE8A 1MO6A 1X8LA 2VP0A 3V00A 4HUQB 5HE8A 1CJUC 4AD8A 2B92A 1G3MA 4HUTA 3CF2A 3T1QA 3R7WB 4ZI3A 3NVAA 3NEJA 4QG7A 1XTIA 2JDIA 4XVUA 2CE7A 4DUGD 4MH0R 2O8BA 1ZUIA 4BZQA 2RHDA 1A4RA 3KKQA 4TMTA 4EJSC 3HR8A 1G7CA 3QXCA 2PCJA 1U0LA 2ZJYA 2RGDA 3THXB 1Z0DA 2F1JA 3I61A 2C8VA 1TX4B 1KK1A 3NDPA 4PFSA 4AKHA 2OM2A 2X2EA 1QHHA 1NY6A 1PLKA 4II7A 3AVQA 2GCOB 2ZSBA 1DAEA 1N6HA 4HYYA 2BKEA 2G3YA 1ELOA 1ZINA 1YZGA 2R6FA 5FBWB 4EPWA 4PAQA 2BJVA 4XTCS 4RKEA 4R71A 4ZDKA 4JBXA 5TXGA 4DEXA 2QM8A 4G0NA 3IPYA 1G9XA 4M1KA 1GM5A 2JLQA 4LJ5A 4ARZA 4GL2A 1QG4A 2WICA 4NTZA 1YKSA 1OXUA 2ZSDA 1N5KA 3NKVA 3T5DA 2OE2A 4LBWA 1F48A 4W5HA 1ZM3A 4JLPA 2NO0A 1YZQA 1E79A 2AD1A 1OV4A 2ZYVX 4MKGA 2VH5R 2OAP1 4C2UA 3EIQA 2YNMA 4ABYA 3WP1B 1R2QA 1XTQA 1VHTA 4HAWA 1XMVA 2X77A 4V0OA 5L3SA 1T6NA 3X1WA 3CO5A 3GLIE 1GNPA 3GEIA 2V4ZA 4JYCA 3TVDA 3QEOA 3DKPA 3AF4A 1ZNWA 2HUPA 2ZETA 4MGYR 1IY0A 1VPLA 5FBRB 4PPFA 1KJWA 2W00A 2ZR9A 3BH6A 2P6RA 4PC6A 1T5LA 4MYTA 3H4MA 3KKMA 2CL6X 1T5IA 3RVBA 3ADCA 2F7SA 1JXMA 5JCPA 4EAQA 4FXPA 1G18A 3DZ8A 3SC3A 1N5IA 1IN8A 1CR0A 2HF8A 1IQPA 2VQSA 1R5OA 4NCKA 5J47A 1UKEA 4Q9JA 1U8ZA 4B76A 3KDSE 1XEXB 3FPAA 5J4HA 1E9EA 4U7DA 1D2EA 4B43A 4ITRC 2ZTSA 3MCAA 1JALA 5L3QB 4ASUD 1XCGB 2J87A 3EZ2A 4NCNA 4ZIRA 4KJZA 3E70C 2QSZA 3D6TB 3F3YA 5KDDA 1SQ5A 1GAJA 4B3XA 2A7QA 4B6FA 1YZKA 1SULA 1DG1G 3Q5EA 3KL4A 3SE0A 4LBYA 4YXWD 1S4QA 2PX3A 5DI9A 1CR2A 2DFTA 1Z28A 3LX8A 4QBFA 3OEHA 1S9HA 3ONWA 3EPLA 1T3HA 3K9GA 1EGAA 2IYWA 4RCYA 1W36C 3L0SA 2E1RA 1VG9B 2ZI7A 1W48A 2AFIE 2V9PA 3ND9A 2XTZA 4AYTA 3GJ6A 4PC3A 1YJ5A 5FR1A 2EU8A 4LCBA 3K70D 2CCGA 4Q5IA 4AYWA 1R8QA 3FHCB 4QNRA 3AP3A 4M9SA 3SFVA 3Q7QA 3BGWA 4Q47A 3N70A 1L4YA 3WXMA 4LJ4A 2WKQA 2PBRA 4GNKA 3BC1A 2N1BA 2A5DA 3AF2A 1RIFA 1T4GA 3TVTA 4US2R 3ADBA 2D3WA 1M7BA 4ZKDA 1GL6A 4W5WA 2ZIAA 2JIZD 2GJAA 1QF9A 5BYJA 1PUIA 3BFXA 2G6BA 3W90A 3U7EB 4XH9B 4LJ9A 2H18A 3DMDA 2JLSA 1UJ2A 3GJ3A 3RS0A 1R0WA 5DI3A 5TARA 1S1MA 4QGGA 1TU3A 2FEOA 3MSXA 1EFRA 1NVXQ 1RYHA 2ZROA 3KB1A 1UBEA 1X1SA 4GMXA 4W9MC 3IHWA 5G53C 4F7WA 2NPIA 4RZ2A 1T0HB 1GRRA 4Q4AA 5AR1A 1QHIA 4LHWA 1VCMA 2J5XA 4IRUB 4YC7A 3B8HA 2BHRA 2QP9X 4WZAE 2KBEA 3KJIA 2FE4A 4GZLA 4Q1AA 5EQTA 5DN6A 4URVR 4FWIB 5AK0A 2GVDC 2QP3A 3AVWA 1G6OA 2Z6VA 3LNCA 2TMKA 2JAQA 1PJRA 3UMSA 3U4QA 2O8EA 1M7GA 2GAAA 4BEBA 1XEWX 2J0UB 1IAQA 2KE5A 3LBHA 1CJKC 1NBMD 3SYKA 2MSDB 3VFDA 3SBDA 1E4YA 2NO6A 4WA7A 4O25A 3EAQA 4PSVA 3K0CA 4D4MA 4UJ5A 3F8TA 4YMSA 1E9RA 2QBYB 4EUNA 2GXUA 4MRSA 4EJSA 2WWGA 3QF7A 1K6MA 4CYMA 1CU1A 1E2MA 1G4AE 3FOZA 3I1FA 1W49A 3AVUA 2O8BB 1SVLA 4QFMA 3P1JA 1II9A 3QSYA 1KK3A 4C4PA 4IVRA 2HEIA 1H65A 3WYFA 3IIMA 1Z3IX 5E7IA 1SHZA 2OBMA 3K0SA 2OXRA 4JLDA 1HYQA 2IK8A 2IA5A 4M1YA 3GLFA 3TQFA 1HTWA 2OCAA 4PQYA 2XZPA 3HU2A 5FUXA 1ZC3A 1US8B 4PTLA 3WNBA 5GVSA 1SKYB 1NMYA 2VP6A 4BE7B 4CW7A 1RVDA 2FSIA 4TQ9A 1NJFA 2J0UA 5FPSA 2CL0X 3D31A 4JSTA 4A9AA 4C0QC 3EZ6A 3ZZUA 3GLIB 3K53A 3B1WA 3QKSB 1NY5A 2B8TA 4P31A 1HH4A 5LB2A 5HKKA 2EVWX 1JEEA 4Q9KA 5K8UA 1J2JA 3LY5A 5AJVB 4DB4A 2CEAA 2AHOA 1AM4D 4FMDF 4HLUA 5GADl 4M1MA 1DAMA 3IEVA 2QTHA 1TL7C 4ZDWA 2WPDA 1N3BA 3LVQE 1YRBA 3TGPA 3RDPA 4TL7A 1EK0A 4TYWA 3SI7A 1KAGA 2H8KA 4HAUA 1Z83A 1R6BX 5CDFA 4EFMA 2DBYA 2Q0HA 4PHHA 3H84A 1QHHB 3C8UA 4IVPA 4A15A 2JLUA 5DLQC 3M1IA 1X8KA 1JR3A 3O8RA 2FEMA 2YYZA 5H68A 3VR1A 3VHLB 4TLCA 4DUGA 2F1HA 2HJGA 4C0SA 2XTMA 1GOTA 4FCVA 3GJ0A 5C18A 1TPZA 1Q22A 2G77B 4DLVA 4PHTA 2XXAA 5DHFA 2ZRGA 2ONJA 1VMAA 2JGNA 1ZUHA 1A7JA 1UDXA 1IN6A 2WWIA 5DE3A 2ZRHA 3ZQ6A 2WSSD 1AZTA 3U3MA 1ZD8A 3ZQJA 4NYJQ 3NWJA 3OAAA 3CZQA 2OCPA 5JHHB 1ZD1A 3R9XA 1DE0A 2W2VA 1HURA 2QRNA 621PA 4GZMA 4A2PA 1KSGA 2XNDD 4B2IA 2ZR7A 2CK3D 1RJ9B 5HE9A 1VIYA 5CK4A 1UDWA 3IIJA 3RS3A 1G3QA 3L8ZA 3CH5A 3M0EA 5B58C 1II8A 3GMTA 1EWRA 2D74A 2XTNA 1FX0A 2QEQA 2O0HA 2IS6A 2FG5A 4Y0VA 1SGWA 5D3QA 4TL9A 1XCMA 4KU4A 2IYYA 4I1SA 2QGNA 3QENA 4OYHA 2JJ1A 2XZOA 3LWNA 2XNSA 3FMIA 3B1XA 3U61B 1Z5ZA 2BWJA 4DC9A 4HLCA 4BASA 1OFHA 1YR9A 1ZM9A 2D2EA 2FPMA 5TVKA 1NBMA 1OHHD 4PZYA 3SS8A 5KDLA 1IHUA 1G5PA 3K09C 3UWOA 1H8ED 1WDTA 1OPXA 2YC2C 1NVVQ 4UXJA 4P4TA 2VP4A 2NOAA 2IXEA 4IXNA 4C0KA 1XTSA 2OILA 3U3RA 5CITA 1MKYA 3TR0A 4B3GA 5A5GA 4JYBA 1NIPA 4Q03A 1SXJC 2ZE7A 3TIFA 1WCV1 2REBA 4HEJA 1OE0A 2V6JA 2OBLA 3FKQA 4P4SB 1HA3A 2JLYA 2FFBA 3W6NA 4GOJA 1EX6A 1X1RA 1G3RA 3LLMA 4ZIRB 2N42A 1LS6A 2RGGA 3WBJA 1H8HD 3RNLA 2JDID 2NMVA 4F4CA 2ZI5A 4M53A 3T35A 4C7OA 1I4DD 2EW1A 4RJLA 2CVHA 3HP1A 2VYFA 3NC1C 4ERNA 3DEFA 4F92B 4MRRA 5DSZA 4LJAA 2CCKA 3D3QA 5ELXA 1GIAA 1U8AA 3VMFA 5F3WB 1J90A 2ZI4A 2AKYA 3IO5A 2X8AA 2CLCX 1JQJC 3DOFA 3EWAA 2ZAMA 4EPXA 2NO7A 1FFHA 3SNHA 1N6RA 3A36A 1RC8A 2GZHA 3TRFA 2DWQA 2J45A 4FW9A 2F9LA 2QSYA 4XTRA 2J46A 4RCZA 3TAHA 1W1WA 2BMEA 2VRWA 3ZYCA 4Q19A 2H1LA 1W4CA 2GAOA 3UG7A 5FBQB 2IT1A 1P2TA 1P2UA 3MD0A 1KK2A 1E0AA 4B48A 2WWFA 3RRZA 5IHPA 1VCIA 4IOKA 2AWNA 1ZMXA 5HCIA 1M6NA 2QMUA 3ZIAD 3HWSA 2C9CA 2DWOA 2C03A 2X19A 2ZUDA 4PSAA 2W58A 3LH5A 4IDOA 4CEJA 4JJKA 1XD2A 2QAGB 1N6KA 1ODFA 1E1QA 3ZD7A 1TUEA 1P60A 4EPVA 1N0UA 5KNBA 2VSOA 2QRZA 3AM1A 2XB2A 3S1AB 1KGDA 1KMHB 3L0PA 3ZS8A 2A30A 1W5SA 5LB4A 3BERA 3X1YA 4N0DA 3AP1A 2XNDA 2ZRLA 4MDFA 3DZDA 1OXTA 3PR1A 3I3SR 3ZS9A 4HATA 5HCNA 1XPOA 4Q1DA 2KI5A 3O47A 1M8PA 3QEJA 4GOKA 3K9LA 3U7HB 3VX3A 2AXNA 1ONBA 2BBSA 6Q21A 1XBTA 3AKEA 1OJLA 1AJEA 4DEYA 4QJ4A 1SVKA 1UBGA 2GKSA 4KFUA 4HAZA 3L8YA 1VYVA 2A5FA 5FTJA 3IBYA 4CRWB 5EJEA 3U2QA 4CEJB 4OQLA 1RRGA 1E79D 3LFUA 3NH9A 1KZGB 3OIWA 2ZJOA 4KHZA 1KJZA 1COWA 4PZLA 3VR2A 1L8QA 4Q02A 5C4GB 5B64A 1WE2A 5TDHA 1SKYE 2PLFA 3QUSA 4QGFA 1OH7A 4BRUA 1KJYA 4CGZA 4EDHA 1RW4A 3CNOA 3UATA 1KK0A 4RD0A 4JKIA 5SZHB 2WJIA 2DHRA 5FPHA 1EWQA 5C4MA 2ZSAA 3PXGA 1E2FA 4JL8A 3GLHB 3CRW1 1DO2A 2CL7X 4POAA 2BV3A 2IWRA 5FL7A 3T5GA 1S3SA 3U7FB 4US1R 4OQFA 1OFUX 4ILEA 1E2HA 2VPPA 4LHXA 2O8EB 2F43A 5A4JA 1A2BA 5H1YA 1TTTA 4EPTA 1BMFD 3BD9A 3T12A 3VR6A 3RWOA 1A1VA 5FI1B 2DB3A 1E2GA 2GDJA 2G88A 3CLVA 4JJZA 2BVNA 4IDHA 1PZNA 2ZRPA 2C2HA 1G19A 3FKSD 4KV9A 2CHQA 3QOFA 4G5RA 4P0TA 5GJCA 1OXXK 4ESVA 1F2UA 3C5CA 4D82A 3IEUA 2GBLA 4FD2A 2FGKA 1RRPA 5FH9A 4ZDIA 4R2IA 2BKUA 2A9KA 5FL3A 3EXAA 2ZRJA 1X8JA 1L4UA 2QM7A 4BPBA 4FMDB 2QT0A 2X1VA 4PSKA 4EQ6A 4MRPA 2VHQA 1XWIA 4TLDA 2IF2A 3BORA 3EC2A 4RZXA 4F91B 4NU0A 3WHLA 2ZRKA 3GEHA 1DG3A 2JEOA 2O52A 2J0VA 2WSMA 3NHAA 3TQCA 1XTRA 2PX0A 2V7QD 4QHTA 5UKDA 2LCFA 3QBVA 4BRWA 3PCRB 2EFHB 2O8FB 2A2ZA 2Z4SA 5P21A 3OEED 1XMJA 4HI0E 3NBFA 4A2WA 4E09A 1G41A 1G7SA 4IOLA 2HV8A 2YKGA 2GXQA 3NXSA 4L9WA 1P6XA 1OXVA 3WNCA 4TYQA 4IEEA 4TMXA 3LBNA 4NE2A 4B74A 3PUYA 2FSHA 1TEVA 2OXCA 2XJ9A 4AIIA 3CPJB 3DMNA 4Q4JB 1CJTC 2G1KA 1NLYA 2ZE8A 1KSHA 3AUYA 3BXZA 4I81A 4BQSA 3ASZA 5AUQA 2JA1A 4Y0AA 221PA 5E7MA 2P3SA 1NJGA 2OCYC 5H70A 1G8PA 1CBUA 3SU8A 2YWFA 3ADKA 1T3SA 4K46A 5KO2A 1MRNA 3W8NA 2F1RA 4QM7A 3BB3A 3CRRA 3GFOA 1HT1E 3PG5A 2OBNA 4DLSA 2R44A 4AY2A 1KOFA 1GL9B 3PIRA 2REOA 2JJ8A 4DCVA 4YMUA 3ASYA 1N5LA 5JRZA 2SHKA 2BOVA 2K5UA 4DXAA 4DBLC 4OK3A 1VECA 3O8CA 3R20A 4K8OA 1KI1A 1B23P 1E9SA 4KLZA 3KQNA 3NIBA 2VHCA 5E7JA 5JI3E 1TNDA 4LI0A 3O8BA 1YR7A 1SVIA 2C5LA 1DELA 3KXIA 2VHUA 3U3KA 1XFAA 4DDVA 4LY6A 2GJSA 4HDCA 4DZZA 4Q4AB 1TQ6A 4YMVA 2G1JA 3TSWA 2EWWA 3IGFA 3LDAA 3QG1A 3GJ5A 1OSNA 2ZJBA 3DOEA 4AWXA 2CCJA 2G0TA 4G3XA 4YXWA 1PLJA 3GJXC 4V0LA 2GEUA 1IXZA 5SZKB 4O0MA 5AWFC 3QPVA 1BO6A 4JL6A 3SJBA 4C9BA 3PUZA 1VYUA 2YC4C 2FA9A 4GRAA 1E2QA 2QGZA 1EFCA 4R7ZA 2VF8A 4JMPA 4LGMA 4Q7KA 4HAXA 4QBHA 1UKVY 1JPNA 1JR3D 3N2IA 4PX9A 3KQLA 3PEVA 1ZVQA 4RFSA 5CK5A 1E2JA 4BFUA 3K1JA 3GEEA 2ASEA 4UNRA 5HTKA 4A0FA 2CE2X 2NZJA 4MYUA 5C2JB 4DCSA 2PJRA 4B71A 3GLFB 3LW7A 4X8HA 5DH9A 2FX3A 5EE0A 1IY1A 2ZJ2A 5JRJA 3B13B 1BIFA 2ANBA 3TH5A 4MA4A 1GKYA 5EE1A 3LX5A 5G40A 3TK1A 2ODBA 5DYGA 5EXPA 3SHWA 2J59A 3ICQB 2PLRA 3GP8A 3W5JA 1J99A 2DR3A 1ZM2A 3P20A 3QQ5A 4XIGS 1LNZA 2WKRA 2P2LA 4NBSA 1WQ1R 3RS4A 5ANRB 4LZZA 3BK7A 1W0JA 3VR3A 2QAGC 4IVQA 1LTQA 2W2TA 2HYIC 1CXZA 3QXXA 4WVFA 2KBFA 1G16A 3CX7A 1NKSA 3T34A 2HJVA 4MYCA 4Q48A 3X1DA 5LDDC 3KXLA 1S1CA 3HPRA 4LPSA 2RHMA 5FTKA 5GJWC 3ZIAA 3ZH9B 1DPFA 1XXHA 3BFKA 2JATA 3C14C 2WBLC 3L0OA 4QJ3A 3MWKA 1LF5A 4Q4LA 1C9KA 5EP3A 5DGXA 1T8UA 1KO8A 1NNEA 1OHHA 1AS3A 3ICEA 4Z1MA 1FQJA 5IDVA 3L0IB 1JQLB 4N0EA 1IXSB 3CW2A 3AEZA 1K5DA 3W6PA 5IK2D 4JBWA 4UNQA 4DLZA 2CBZA 2REXB 1QVRA 4R98A 5L8VA 1E2KA 1GKIA 2GJ9A 1F2TA 2QP4A 4RZUA 1OLOA 4HZIA 1Z29A 5DHAA 3SYLA 2GRJA 4G5GA 4GPTA 4IHQA 4MRVA 721PA 4HSEA 2WWYA 1F2UB 3Q8XB 4D0LB 1UKYA 1M7HA 3X1ZA 3L82B 4Q4HB 3RAPR 2GZDA 3ZLJA 3PITA 2DFLA 3CR8A 1N0WA 2F3RA 4OBEA 4JKYA 4M9ZA 2WJJA 3BIFA 3HDTA 1KDTA 4GI7A 3EPJA 1Z0IA 5DISB 4AURA 5FBVB 1Q1EA 2ZVQX 1KMHA 2PT5A 2AR7A 2FSFA 1NVWQ 4TSFA 1GUAA 3EA0A 1CR1A 1YR8A 1EG7A 1T0JB 2ZUCA 3PJRA 3P32A 3QBTA 1G5RA 4QHYA 3P4YA 4PR0A 4WIAA 1MV5A 4JIMA 4XWOA 4H9GA 1JPJA 2QROA 1U2RA 1WF3A 5C46F 1I4TD 4IFEA 2I1VB 4Q1FA 1BKDR 1P4SA 2H92A 2VP5A 2IWHA 3SHFA 5FOUA 1KO5A 1O87A 2ZU6A 3KKPA 5J40A 3RYTC 4NMMA 5EXTA 1E3MA 4B34A 3B85A 1TQ2A 4PQFA 2XZLA 2ODWA 1CJVC 4OKSA 1KSFX 1Q3HA 2AD5A 4C3ZA 2FFAA 1BH2A 1SXJE 3ZZ0A 1OF1A 2RGBA 2Z4RA 1NMXA 2QI9C 3OIUA 3QKRB 1E99A 3UK6A 1GFIA 5B30A 3U5ZB 4BFZA 3F0TA 3L43A 4F38A 1QHNA 1MO5A 5FUVA 1BYUA 1ZJ6A 3P26A 4TYNA 3TUIC 4L16A 4WXPA 2PJZA 1DAIA 3CPEA 4KBGA 2IS1A 5JFGA 1PLLA 1R0ZA 3C4JA 1P9WA 3I32A 3CH4B 1X6VA 4I99A 5HZHA 4IKEA 1E2DA 3VNVA 1HE1C 3U6KA 1P9NA 1KY3A 2F3TA 1KI6A 1NSTA 1XEWY 3KKOA 2E9SA 3VHXA 3VKWA 5KU1A 4Q18A 4P33A 4TLAA 4KXFB 3TUJC 4A6PA 2P6NA 3H0KA 3QXJA 4XWAA 3WNDA 4DCNA 1CS4C 1NLZA 2EFGA 3CR7A 2B7CA 3OAAD 4IW3B 1OFIA 2BEKA 4R9UC 1ZM4A 3LBIA 2ZPTX 2XOKA 4N1AA 4PHFA 4ZPXA 1LV7A 4I4LA 4NCIA 5GVRA 3RANA 1VG1A 2C77A 1G4UR 3QKUA 3ZD6A 4GFDA 4LHYA 1I2MA 1PUJA 3OEEA 1AN0A 1FX0B 4I1UA 3NH6A 3T15A 1E2PA 2HCJB 2AK2A 1L2TA 2YWHA 4FCTA 5JWOA 4O2LA 3GFPA 3MMPA 4NP6A 3OIYA 1UBFA 1SHKA 2QN6A 2IX3A 3THYA 1DAKA 2L0XA 3TSOA 1MO3A 1EFTA 2PEYA 1OIXA 4FI3C 2GCNA 1KI9A 2R6CA 1XJQA 4LC1A 4OJKA 4QGHA 3X1XA 1MR3F 4GT1A 4RSGA 4MGIR 4B47A 3BRWD 3AF1A 5LD2B 4HZUA 2GZAA 5BW8A 3UPUA 4OHWA 1J70A 4MKIA 4ACBA 2LKCA 1Z22A 1JBKA 1H8EA 1XCPA 2FJUA 1UF9A 1B0UA 3HYTA 2ATXA 4RY2A 2MSCB 2CNWA 1Z2AA 5AJZA 3TLXA 1JI0A 3T61A 3B6EA 2WSSA 4IOJA 4C0JA 1AIPA 3OIVA 2R6GA 5D3MB 4BZXA 2HT6A 4EFLA 2ORIA 2GCOA 2XSZD 1W4RA 2Z43A 1DO0A 1NBME 1IN7A 2OFWA 5FPYA 2Q21A 3DDCA 4MQBA 4EPYA 3KQHA 1DS6A 4B35A 2ZRFA 2FF7A 4KYUA 1WMSA 1OXSC 1YHNA 1EX7A 1KZ7B 3WRXC 2V1UA 4HB0A 2IC5A 4M2LA 5B2ZA 2FWRA 1P2VA 3DPUA 3OF5A 2Z0MA 2RGXA 2GA8A 4HZUB 2ZJZA 2O5VA 2QTFA 1XMSA 5HR5A 4JVLA 4EIWA 3R8CA 3WYGA 2GNOA 3HU1A 4PC2A 2QENA 3QKSA 3QNUA 2RGNC 4G1UC 2AFHE 2ECKA 1ANKA 2IBMA 5KHOC 5SZJA 2W83A 5EXSA 1FUKA 1E2LA 4URYR 1KYIA 3A1TA 3CF0A 4GP6A 5G3ZA 1T91A 4CEIB 5BXQC 2A5YB 5D3MA 3JZAA 1Q44A 4XD7A 2XX3A 1G21E 4B44A 3AKCA 1TF5A 4PQRA 2J0QA 2GETA 4M1SA 4URUR 2C99A 3UMFA 2OESA 1EESA 4FCWA 1E1RA 2ZU0C 1DAGA 3LD9A 2WPDD 3A4MA 3CZPA 3SQWA 4DIEA 4L9SA 3UXMA 2VP2A 2RGEA 2JCSA 2ZI6A 4Q9HA 1OB2A 1KKLA 2D62A 3EZ9A 4L4UA 4G5OA 1IXRC 1W0KA 4TTRA 3IO3A 121PA 5AJXA 4NH0A 2PZGA 2BCJQ 4AI6A 2RKOA 1ZRHA 2J7PD 4PO1A 4FN5A 3GJ8A 1NVUQ 1VG8A 2A3RA 3ETLA 1KSJA 3K9NA 3UMRA 4TZ6A 1A82A 3I5YA 2OAQ1 5EE5B 2NGRA 2W0SA 4LYFA 2Q3FA 1IOZA 4X8OA 2OLKA 1GITA 3A1WA 3K8YA 2GEVA 2XOKD 5CYPA 4TMKA 5JEEA 1II8B 4KBFA 5CM9C 5CIWA 2W6JA 4ZCLA 1AZSC 1RJ9A 5H8WA 2HYDA 2V7QA 3EW9A 5SZIA 3CUEF 4OK6A 5A0FA 4DT1A 5FPKA 2F1IA 1MABB 3IQWA 1CKEA 2NO9A 2F43B 3RWMB 4B3BA 2Q9AA 2QE7D 3CIOA 5DI3B 1WBDA 1XD9A 1LS1A 1UM8A 1W44A 4OHZA 1Z08A 1E2EA 4RKFA 4QJ5A 4Z51A 1WRBA 2CHVA 4B33A 1JAHA 2ATVA 1GL7A 4M4SA 1Z0AA 2VL7A 1TF2A 1FNNA 2IUSA 3CKLA 3DHWC 5AJYA 1Q1QA 2NZ8A 2BBOA 2P0EA 4XSHA 5JECA 3Q5DA 3NBXX 2WJYA 4QHSA 5CLQA 2C96A 4KVAA 4NYIR 1U0JA 2EFEB 1TEXA 2AL7A 2BM1A 5KPJA 1NN0A 3SYNA 5FL7D 2GK6A 4URZR 3U3JA 5KSZA 2OG2A 4DRZA 5TB5A 3Q9LA 1GSIA 1IBRA 2IYSA 3GFTA 1WP9A 1BMFA 1UFQA 2BC9A 3BB4A 3EIEA 5DNYB 2O8FA 1D9XA 1NG1A 4EFNA 2JASA 3Q72A 2I4IA 4LV5B 1HEIA 1M74A 3AF0A 4E07A 3QVUA 4NKRA 3IBGA 4H1VA 3THXA 1HQCA 2IUTA 4B6EA 2BEJA 4D2IA 2QU8A 1SVWA 2A5GA 1E9CA 4GMDA 1N5JA 3K70B 3SR0A 1F60A 3U4QB 2QMHA 2IYQA 1E32A 1K5GA 2QMEA 1TAGA 1HY3A 4EKDA 3VTKA 2JLVA 1NP6A 3NC0C 2OFOA 4JLOA 4LPKA 3DO6A 3GJ4A 5LD2C 4TMVA 4UNSA 3A1SA 5J4LA 2CLDX 3A37A 4E5UA 2QPAA 4DLTA 2R2AA 3WMEA 1XJCA 5HKKD 4NYJR 1X86B 4D4LA 3N2EA 3E1SA 2G9NA 1DVRA 2QUZA 1SXJD 4BFYA 5CJPA 4V0ME 5BQ5A 2ZI3A 1P7CA 2W2XA 4V03A 4LHVA 4ZV4A 2IYXA 1U81A 2FMXA 1TQDA 2BJWA 5JJKA 1Z06A 2NQ2C 3DKVA 1NG9A 4LC0A 4FIDA 4PO8A 2ERYA 2V1XA 3AGQA 5EP4A 3THOA 2VTKA 4A92A 3FKSA 3QKRA 4QBIA 3A58B 1TU4A 1S96A 2OO7A 3MWYW 4AG6A 1MRSA 1D8TA 4OI2A 3TW4A 2EYQA 1V43A 1ZAKA 4LOAA 4Z1MD 1G3UA 4Q01A 2J0SA 4CVNA 4CEHA 3LW8A 4OQMA 2UZIR 3LAWA 3WP0A 1VIAA 5IT5A 3TNFA 5EXXA 2ZE6A 5GJVC 5FBLB 4TWZA 3U7GA 1I2DA 3G82C 3H86A 1E1QD 1EFHA 1P61B 2E87A 3ZVLA 1OYWA 2ZREA 5JCZA 4Q9IA 4BUJA 2IEYA 3QPUA 3GJ7A 4PZZA 3UWKA 3GLHE 2CXXA 2CLSA 2CJWB 2B8WA 3QVVA 4B3DA 1P75A 1R0YA 1N6PA 2O8DB 4PC1A 1OYYA 3TKLA 1CR4A 1KO1A 4R2HA 3T06B 3TSZA 2OSBA 2YOGA 1ZYUA 3IHLA 1ZNXA 1N6LA 1W0JD 5KNCA 2R9VA 4UKDA 2XJ4A 4M9XA 4HLUC 4QKQA 1Z6YA 4B3CA 3RS2A 3LXXA 1KY2A 2JLRA 2ZS7A 4F93B 1G5TA 1LVGA 1P9RA 2PL3A 3ZJYA 4D4KA 3R8FA 4RFVA 3RRYA 3ADDA 3OFND 4CEIA 4AK9A 3HPQA 2QORA 1NN5A 3B82A 4W7SA 3W3ZB 2BMDA 2XITA 2FFQA 2H17A 4MUAA 5L3QA 4FWTA 3HJNA 2QNRA 1GWNA 2W6ID 1T3LA 1Z6GA 4Q1CA 1NN3A 4TMZA 5JEDA 2RB4A 3CNLA 2XEXA 3OE7A 4BFTA 4WZ6A 3I5XA 3TAUA 2WKPA 4UXHA 3FVQA 4Z54A 2CNWD 2HDNB 2G0NA 2RGCA 3EPHA 3JVUA 3CRVA 1N6IA 4OHVA 2ZM5A 5EE9A 4Q1BA 1NN1A 2IXFA 1NIJA 2BCGY 1K8RA 1CIPA 4LK2A 4KLNA 4ZDJA 2P5TB 4F4JA 1N0VC 2VLIA 1E69A 4Q4HA 3SEAA 4LX0A 3ZZTA 3PEWA 4UJ3A 1W36B 1QG2A 1E96A 3VAAA 3A6PC 1GILA 3AP2A 4AKIA 5BN4A 2EFCB 2XB4A 2ZR0A 1U9IC 3AF3A 2GXAA 1E6CA 2AWOA 3JZMA 1KI7A 4QOSA 2GHIA 2P65A 3P27A 5FUWA 2ZEJA 1H8HA 1G64A 2QY9A 1Q3TA 3NBZC 4PPQA 1DADA 4QL3A 1G7TA 2ZRNA 3SZRA 1JR3E 5KNDA 1ZIOA 1M1YE 3AGPA 2B21A 4OHXA 1XRJA 3BH7A 3C15C 1XB2A 4P4UA 2DPXA 4ASUA 3GPLA 4TZ0A 1V5WA 2VHJA 2GVZC 3D7MA 1X3SA 1JXOA 1XZPA 3U6BA 2IYUA 1TUIA 4MDEA 4AKEA 2I1QA 4A36A 2IL1A 1FTSA 1OFTA 4A0GA 3BH0A 4C0LA 3KQKA 1MOZA 3DM5A 2R65A 2Q9BA 2GEDA 1KNQA 3QY0A 3IILA 5CYOA 1KNXA 3QKTA 1KDPA 2UKDA 3I92A 1E0SA 1UKZA 3U60B 5F2EA 4OI0A 5TMPA 2PMDA 3HYRA 1YRAA 4A8JA 4ON9A 5EZ5A 4YMWA 3UANA 1FPMA 3FYHA 2IW3A 5L3SB 1CRQA 4X8MA 4IDNA 4Q4JA 2Q6TA 1P62B 4M8NE 2GWHA 2ZJ5A 1TF7A 2GK7A 4A1FA 3O8DA 2IUUA 3B9PA 2CHGA 4MKHA 4M0LA 4CT4B 2QZ4A 4KCGA 2DFNA 5TY0A 5CDFE 1SVOA 5FR2A 1Q21A 2F6RA 4I1OA 5KSYA 4JS0A 2EQBA 4OL0A 1OH5A 4FMBB 2IS2A 4LRWA 3EPKA 2FSGA 1LB1B 1XD8A 4TYPA 1N6OA 4AC9A 1Z0JA 1RRCA 1IONA 1Z6AA 2W6JD 3CWZA 1XTJA 2FDCA 4QC2A 3TR5A 3FHTA 4BFXA 1KKMA 2ZRMA 3AVOA 2BIFA 3AQ4A 5JWHA 1G8YA 4Q7LA 4WXRA 3WBKA 4JLJA 1AKYA 1JJ7A 1EFRD 4TTPA 2WHXA 2IS4A 3RLFA 4OK5A 4Q7MB 3C16C 5JS8A 4X8LA 3K0AA 3W9YA 4L5BA 4TSFD 4WBSA 1I4LD 2QAGA 4RD3A 5E3HA 5CB8A 1NRJB 3OFNA 3M6AA 2FOLA 3PUXA 3GLIA 2DY1A 3B2EA 1FTNA 2IYLD 4TLEA 4PANA 1AQYA 3FWYA 3KUDA 3UG6A 1KI6B 2WMOB 2C78A 4LYHA 4GOXA 5FOWA 2OT3B 2XAUA 4L15A 4M22A 2PZFA 2ZE5A 4V0NA 3OZXA 3U44A 3AVVA 1BYIA 2HLDA 1FZQA 4ZCMA 2P67A 4C30A 4LWZA 2B7BA 5FUYA 2WTUA 2GBLC 2IHYA 3H2YA 4G5SA 2FFHA 4PPGA 4BZPA 2JLZA 1U9IA 3CRQA 4JLMA 4V0MA 5KUTA 2JLXA 3OESA 1E1RD 4D0NA 1CTQA 3IDQA 4A8JC 3KJGA 1ZNYA 2D7CA 5K8TA 4UXIA 2WMNB 4GSYA 2ZANA 4WW0A 4M1OA 4HB3A 1RKBA 1UEIA 1R10A 1P72A 4OJQA 1U0HC 3X2SA 5JMTA 2YVUA 3RS7A 1E0JA 3CX8A 1D9ZA 1LW7A 1R5BA 1US8A 8OHMA 3PEUA 3A4LA 5DYIA 4LBVA 2IHBA 1YVDA 2BBTA 4IDQA 1E4VA 2EWVA 4TQAA 4XJXA 4E03A 1OW3B 3UIEA 1ZD9A 1DAHA 2AKAB 4LBZA 1IN4A 4PO9A 2F9MA 1W2HA 2RCNA 4KODA 1T8TA 1GNRA 2C04A 1XMIA 4TT3D 2CDNA 4LDJA 1RZ3A 1JNYA 3BWDD 1G6HA 3MGCA 2WAYA 2IYZA 1F3OA 1BS1A 1L7VC 3AV0B 5FOVA 2WJHA 3LVRE 3D8BA 4D4JA 1S3GA 2NG1A 3S1AA 1VTKA 3K0CC 4U00A 1R0XA 4PAMA 4BLQA 1CEEA 4QGAA 2Q3HA 2VO1A 4D6PA 3QF4A 1R8SA 4B2PA 4U02A 5JS7A 2RGAA 1LF0A 2R6DA 1RFLA 3W34A 4JT2A 2VEDA 4KYIB 1ZC4A 4KFTA 4QRHA 1E94E 2WWWA 1F5NA 2IXGA 4H1UA 4KSBA 2VA8A 3U44B 1AK2A 2FZ4A 4YMTA 4B73A 5JI2E 3GD7A 5K8LA 3LO5A 3KTAB 1UEJA 3RC3A 2H7VA 4AKGA 2J7PA 1D5CA 1E9AA 4UQOA 4DDWA 2ZRCA 3LRPA 3R7WA 1OT3A 5KDOA 5JJIA 1W7AA 1Q0UA 2YINC 4LV8B 1ZCBA 3BE4A 4LYAA 4CT5A 1QRAA 4V02A 4PHGA 1XXHE 2C95A 4URXR 4BGDA 5EUMA 1GNQA 1W5TA 3N5CA 3GQBA 1E2NA 5LBIA 1ZNZA 2JIZA 1XPUA 4KAXA 1YZNA 5DIFA 1SVMA 4HB4A 2DYKA 2ZYTX 3EARA 3QF4B 2V54A 1GZSA 1Z6TA 4BLSA 2GJ8A 4DIDA 1RYFA 4OHYA 3IPXA 2FN4A 2NTYC 2YHSA 3VU9B 2WWXA 5IF9A 2WIBA 3FE2A 4K81B 1E9FA 1F2TB 3I62A 4TTQA 3AVYA 4A0HA 1GP2A 5KYKA 1P3JA 1G8HA 2QQ0A 3CB4A 2O0KA 2ZRIA 4PC7A 1OKKA 2GF0A 1JJVA 1NF3A 2GXSA 4MITA 4RD1A 1XD2B 3QPWA 4BFVA 2O8CB 4F4IA 4B32A 2HLDD 2ZSEA 3FMOB 3K0FA 5HZKA 3I8XA 1E2IA 3WY9A 3KJHA 3LV8A 2FU5C 3REGA 1RRFA 3BBPA 4PXAA 3EG5A 1F6BA 1PV4A 3PUVA 3PFIA 4A6XA 2ZSFA
chains in the Genus database with same CATH superfamily
4EOGA 5B4VA 2AN9A 1Q0LA 3ORFA 4WK0B 3VR5A 1U3DA 1UINA 3NALA 1CDEA 1NI3A 4V2IA 2QJTA 1WKBA 1GTSA 1L4MA 2YV5A 4MYHA 1W36D 4R1MA 3VDXA 2J6CA 3CKYA 3QJYA 1F8GA 2AIRA 3AOEA 3O0DA 1E3JA 4P38A 4YWHA 3SR3A 4B79A 3H7IA 5BY2A 4RC9A 4HNSA 4M7WA 1KHTA 3V8PA 2FMKA 2NVUB 2JANA 1QMPA 3L5OA 1UK6A 3IKLA 1C30A 3GRUA 4M21A 5JD5A 4Z4EA 1QHXA 4TS1A 3J81k 3CW9A 3UJCA 1P2DA 2ADMA 2LE0A 5GM2A 4H7FA 1U99A 1V9CA 1Q12A 2UZ1A 3STXA 4ZC8A 3EOAI 2BBWA 1P0PA 3FGOA 4JYMA 5SYAA 2VF4X 2FH5B 4EGSA 5CA0B 4HMOA 3WY9A 3ENWA 1C3OB 1NBAA 5EMJA 1N2CE 3FDIA 1Z0FA 5AUNB 1CEXA 4B3FX 4UBKA 5AOVA 1AQNA 1LFDB 4IX1A 4LJ6A 1VCNA 2HCBA 3MS7A 1N3YA 3UGJA 1LFAA 1K2WA 2C4WA 1T8RA 4IQ4A 4FZJA 3ZI4A 1GDHA 2I7VA 3GDGA 1MT3A 1XZMA 2V55B 3F1LA 3H5OA 1LUAA 3LCUA 5A6SB 2NO1A 1QGUA 2OEPA 3THRA 2W42A 3KKNA 4MS1B 1Y1LA 1S0UA 3NWBA 4KNYA 1GGJA 3G23A 4G4SP 4MUEA 1J2YA 4RWEA 3MLEA 4U2CA 4G07A 3V8BA 4N4AA 3LGSA 4DQVA 2C7GA 3HZRA 3HS3A 3AUFA 3W3AA 1IJFA 2FMTA 4CUJA 5K09A 3R7DA 2FSUA 2OWDA 1JYEA 3NHUA 4Q9LA 3T1OA 1YA6A 5DBOA 1Y81A 4RO0A 4B40A 3LC2O 4NWIA 4KV7A 1ZEJA 2FGJA 2IZ7A 1ZIXA 2E5FA 2NNLD 2R6AA 2VSXA 1VPEA 1NW6A 3EVNA 3LA8A 4TS3A 1MQAA 3W1VA 2D4HA 3JQAA 3T9DA 3P52A 5JV5A 2VDWB 1C4OA 1P73A 4UCQA 2HHAA 2MCFA 1NL3A 1SQSA 2ICAA 2YN0A 3I6MA 4XWWA 1K7YA 4S0ZA 4XVQA 1ONOA 3IR6A 3SJZA 5CITA 2JAOA 4FDAA 4WZBE 2GVNA 3TW0A 4BFSA 5HRAA 3IUYA 4CM9A 5JJLA 3FGNA 1EFUA 4IDCA 4L3WA 2ZRAA 2O6LA 1Q0HA 2JCXA 1MIOB 5REQB 3WKCA 3TO5A 4EL0A 5IJ9B 1XF9A 3R6TA 5JJCA 4NCJA 4FQ7A 1ETUA 2ZJAA 4KH0A 1FRNA 4V39A 2VEOA 4NHEA 3K2IA 4RVCA 1N6NA 1PQWA 1QUFA 2NSLA 4PSCA 1WB9A 1AS2A 2QR2A 1P5ZB 2ODNA 2VIIA 3R5HA 4G0XA 3SEFA 2WOJA 5KNCH 4F3NA 4TGLA 2ZS9A 4GXQA 3L01A 2EGHA 1SCUA 3G7NA 3V4RA 5IT4A 2GZ2A 1X7WB 4JOCA 2FPKA 3Q11A 5CB4A 1GPUA 3I6BA 3K9HA 4CL2A 1GZ6A 2NXJA 1YB4A 4WASA 1UMKA 4MEBA 1U5BA 5FFMA 2Q9UA 5E6UA 3P9KA 4RK6A 4EHKA 3WKEA 2HSJA 2YXNA 4NFSA 4RD6A 4IWNA 1SZPA 1PFQA 2AVNA 1L4FA 4NCBA 2C9ZA 4QUAA 2QVYX 1KIMA 2X15A 3KOXA 3J81A 3FOEC 1BDIA 2IYEA 3BSFA 1ZXLA 2OCIA 3NZEA 5FOXA 3ESCA 3A70A 4DLYA 2XIQA 2D59A 1ZIPA 1Z5UA 3F3KA 1AURA 4Z86A 1F6WA 3CMMA 5JSQA 1FRFS 1WR8A 5KYTA 1DEKA 4WNAB 1HE4A 1E0KA 1RLJA 2RJNA 2Z83A 2PZEA 2CUNA 4XPIB 2ZI9A 1TYEB 2C9YA 1UM9A 3W6UA 4TRRA 3WHKA 3ZGVA 4KQ9A 6CHYA 3UPUA 3HKEA 4HGRA 4QWWA 3VKHA 4OGKA 4C20A 3MYRA 3AK4A 3SFTA 4C03A 5AVVA 3H9CA 1XZBA 2KJQA 2ZJ8A 3KZ1E 3N7AA 3I6QA 1ORRA 2OK7A 1V45E 4EZIA 3AUJB 3HBAA 2DLNA 2IHTA 4O4IA 2XXBA 4MULA 5J63A 4E4RA 5JC1A 2OBXA 3IUPA 1RZRA 3RGGA 4U8HA 3WGYA 3O3MB 1U4NA 2JFXA 4ES6A 1NI4B 1S2NA 4WKOA 5LP6F 2V3VA 1PR5A 1QWOA 1XU4A 2YFKA 4NYMQ 1U2SA 2ZDHA 4GQBA 3UV6A 1JG3A 3EGDA 3LA6A 1ZVMA 3FY4A 3I53A 3ML1A 4MGKR 3X1MA 5FNZA 3PDHA 3MJDA 1VA5A 4DCOA 3ECCA 2Y8EA 4E4TA 2ON6A 2AGVA 2VKQA 3DDZX 2QQ5A 4WFKA 5DNEA 4H6XA 4XPZA 4XUGB 4FR2A 3VXKA 3KO8A 1OH8A 2HXYA 1TMYA 2Z9CA 2B78A 4F11A 1RKUA 2PMEA 2OD7A 4BCDA 4TT3A 5DIZA 4KQ6A 2ZYAA 4QT0A 4B80A 2CLMB 5FTMA 3ZHYA 5B1HA 1CUVA 5J2TA 4LSZA 2CY0A 1JQKA 1XWWA 2HF9A 4IEIA 1GQOA 1UJNA 4KXWA 4MWEA 2XMPA 4O5AA 2DE0X 4XSGA 3AKYA 5I8WA 5B55A 1OQAA 2P2NA 3I30X 3IEXA 2G80A 4B4DA 1M2HA 3GOHA 1CF4A 2D06A 1L7XA 1ULSA 4FONA 3GIDA 3TR6A 2WUDA 3OHMA 4O3FA 3SJAA 1XQXA 3FAKA 4S3MA 4GBGA 2OGZA 3PENA 1IM2A 2N46A 2J9FB 5L4NA 3VZRA 4GICA 4RYLA 4NZZA 1AUQA 4LOIA 1XA3A 3G5UA 3OJOA 4OQDA 4QOHA 4RKYA 4COKA 4UPEA 4M55A 4UUNA 2M1ZA 1BE1A 3HDYA 5AXCA 3VYVA 5JVDA 4S2UA 2QE7A 3KZXA 2RH5A 1V8OA 3IIKA 2G67A 5ERXA 3U80A 3ZDYB 1UK9A 2PBLA 3V97A 4EA6A 4NF2A 4GPZA 1KMNA 1N2CA 1VLQA 3JQEA 1R74A 2VF7A 2GZ3A 2UXDB 3EXFA 3WLPA 4Z3KA 1XHEA 4LWPA 3C8ZA 1XEXA 4HL6A 3RGWS 4DLRA 2BFFB 1BOOA 2WIAA 2PVPA 3Q12A 1KGSA 1U1FA 2OV1A 4UNPA 5ICGA 3FFWA 5DX8A 1ACMA 2JJMA 5JARA 1ES9A 4NDNE 2QN7A 5JIBA 821PA 1WV0A 3EC1A 3F6BX 4U2FA 3SHOA 4M1TA 1MVLA 1XEFA 5COBA 5KI6A 4EENA 2XUHA 1CRPA 3R0JA 4KFSA 4DARA 2I62A 3IAEA 1VOTA 1FP1D 1NMSA 3Q6NA 1W19A 1D3AA 3LGAA 4J0FA 2ZYGA 1W2GA 3WA7A 5LUBA 5KQPA 3W6OA 2Q8PA 4KK4A 2XTJA 4L5AA 3IE1A 1Y63A 3N6XA 3AWIA 2QHXA 1ORIA 3NRCA 5CLGA 3JYOA 4LOKA 2BE7A 3LZ6A 4G8CA 2B3DA 2XRMA 3U9TA 2JJ2D 1BEEA 4OQNA 3VR0A 2VHTA 3FPLA 3F5FA 1K66A 3C1UA 3D4LA 3QBDA 4XAQA 1PQYA 2P75A 3CG0A 3CWQA 3SSNA 8AT1A 3IEPA 3UT5B 1QZXA 2V3CC 3IELA 4EL5A 1L1EA 1PT8A 4XGRA 5IKOA 3LXUX 4ZHQB 3P2EA 2EZ9A 4YUWA 1FMLA 3ZVRA 2DH5A 3ZLUA 3ZNQA 4FBMA 5EHIA 2I4MA 1YCGA 2O1SA 3GLFE 1G0NA 5EZ6B 4LE1A 5T41A 2WB2A 5LZ4A 4MW0A 5MFPA 3L7JA 3PGKA 3THYB 3F97A 3QXSA 1BMTA 4R51A 3TZBA 1G17A 1R6XA 4LJ7A 4NZYA 2G1PA 3NGLA 4DLUA 4DR2B 1SCQA 1KR2A 4L5YA 3I01A 3NBYC 4KR0A 2P8JA 1VGQA 1E9DA 3KPVA 4QXPA 5ESRA 4XD7D 2OCLA 4AXBA 3KQUA 3DF9A 3DUFA 2F8MA 4IJVA 4EVRA 1UZUA 4NPHA 3W5IA 4MI3A 4BQRA 2AXPA 1F9EA 1UXKA 1XZQA 2FQWA 4AG3A 3UKOA 1E1CA 1E7RA 3WLSA 3IODA 1HQYE 2QJWA 1OB5A 2QX6A 3FETA 3PB3A 1RXCA 4ENTA 5KX5A 1Y6JA 3DFMA 1RMQA 4YCCA 4CFYA 3VC3A 3VHRA 4Z4IA 2FMUA 1MOPA 5E9AA 1GRNA 1HX7A 4C4AA 4EW3A 3TPZA 3ZDXB 1B26A 1ZONA 3T7SA 1PVOA 1VSBA 3DTVB 4DQKA 2D1RA 5C5IA 3KT0A 3QE0A 3RSFA 2WZQA 4JJ6A 2VJMA 3MB8A 4L8WB 4OIMA 4R1UA 3H1PA 3TRKA 4DPLA 4YQFA 1H22A 4PE5B 4DBLE 2R7AA 4IGFA 2ERXA 3QPCA 1KOGA 1SBHA 2XOXA 1FQKA 1PZHA 4QXMA 3ZJTA 1FBNA 4CFZA 3LY9A 3ZE2B 1HORA 3BIJA 1CUYA 3ANTA 5E9WA 1Q0RA 3HB0A 2BM9A 2I3DA 1TE2A 1CRWG 3FZEA 4RCVA 5A0VA 3NUQA 1MNAA 4NXMB 2HSGA 4C2AA 3HHEA 4L0MA 2IEAA 4NPCA 5TQVA 1I3LA 2BH9A 2A9QA 4OG2A 3I04M 1W0CA 1A2QA 1LRJA 4QXAA 1Y3CE 4Y9SA 4D56A 1VKRA 2BN4A 4D57A 5BV0A 4LE0A 1HRKA 4KQXA 3NUZA 1JI3A 1OZ0A 2O2HA 3HVHA 3NHBA 1WCIB 2OAEA 4FDTA 4G89A 5BUSA 5CR9A 1L4HA 2DT8A 3VKGA 4U9UA 3M2TA 1KI4A 1DOAA 4DDHA 3GLGB 3G2MA 2X2PA 2ZTVA 4OI4A 3CNNA 4WNYA 4X85A 3PR3A 1ZM7A 2DUJA 3B2NA 4HS4A 4Q3CA 2VSFA 4QJIA 3VYTB 3VAZA 1JB1A 2P11A 4MQ5A 3DFKA 1O3YA 1NR1A 5THQA 3T0GA 3V7NA 2ZFUA 3QWBA 2GYWA 2L69A 5CHEA 4YRFA 5CLLA 1N9GB 4KIFA 3SKYA 2TRSB 5BN4B 4YAGA 1PR4A 4FGZA 4D3FA 4HGQA 5IC6A 3ZXIA 4J4HA 1ULUA 3C2QA 4RWZA 4IBOA 3EDMA 5DEOA 5G1NA 4BLOA 3P9SA 5IJ0A 4LRUA 5J5CA 3I2KA 3S5UA 2ZUBA 3ZHTA 4DQDA 4ZHSA 2ZIGA 3GNSA 4FNGA 5KIAA 4GDFA 3A31A 2AR9A 2JH9A 2BRUC 1YUNA 4PG5A 1J1IA 1FLVA 4NV0A 5DRYA 3V3TA 2VYCA 2C9OA 2GJKA 5HJEA 4BEJA 1RWPA 4B3TB 1FFEA 2J5BA 1YI0A 2X2FA 4LNAA 4G01B 4RGQA 1VCOA 3Q0TA 4CM4B 4OL9A 5AHXA 4IMRA 4L57A 2HT1A 1Q1BA 1FLNA 3LIIA 1EFPB 3ND8A 1IZ7A 2YUIA 2YY6A 4QVGA 4L95C 1QZTA 3ASVA 3GUHA 1OGJA 1EUCA 1W6RA 1ZESA 2FJ0A 3NBKA 4DCUA 5HYVA 2ETXA 3RS5A 3VJKA 2X6TA 5DHSA 3MYYA 4WAUA 2NV0A 3KL2A 2ZAYA 5EIBC 3C7CB 2AOVA 1NOKA 3PUHA 3TUZC 3BJRA 4K03A 2P2YA 2HWWA 3K5HA 4YDHB 3OCWA 1YZVA 3RJTA 3Q40A 1YJ8A 5EXDA 3M1AA 1X7YA 4MUIA 1I1HA 1TQ4A 3GB9A 3RSLA 4DBVO 3IAS6 5TQ0B 4BQFA 1AO3A 3MQ4A 1JXAA 2WJGA 2JW5A 3EZ7A 1CJMA 4DSNA 3P96A 4S12A 1KHHA 1RYEA 5CT8A 3BJIC 4H0NA 1YB5A 3TLGB 5AKIA 4F1KA 1K63A 4LJYA 2BMVA 2HA5A 3RABA 1F1BA 2DG2A 4HDNB 4HZGA 4EYKA 2Z2YA 1QZUA 1ONNA 2QYTA 1FP2A 1NXVA 2XNHA 3D7SA 1CP2A 2SCUB 2BP7A 3QEKA 3SC2A 4AN4A 4CKBB 1EFVA 1W4AA 1Z5VA 1ESNA 2XYRA 4N8SA 3MW8A 4OHBA 4OM7A 5ETJA 5JDCA 2XNCA 3K71B 2Z6UA 3QKIA 1JFSA 5DOZA 5TNXA 1U90A 4LOJA 5TQ2A 4FNMA 4PLYA 1Z38A 2XYQA 4G5QA 4XVCA 3MGBA 2AUNA 3OCZA 3AUXA 1I2CA 3I2FA 4N7MA 2QNBA 4YK7A 2JZCA 4X3CA 5EWLB 1OGIA 3VR6D 1XX6A 4BKQA 4CT0A 4D5EA 3V2GA 4MW4A 5J2TB 1USVA 3OHSX 3L7NA 4C6TA 1RQXA 4C21A 2NPOA 3NO4A 3GWGA 1ULZA 3GZTB 4G1VA 1MJHA 1X8LA 3V00A 1JH9A 1JZQA 2FHPA 2B92A 4HUTA 5JNTA 1T10A 3CF2A 4N5DA 4BN5A 3NEJA 2CZCA 2JDIA 1K7XB 2CE7A 3EEYA 2I33A 2LXNA 4LY9A 4J0KA 1RXIA 1SXGA 4PGFA 2RHDA 2WPNA 4TMTA 2V03A 3I2JA 1G7CA 3QXCA 1U0LA 3DB1A 2CBXA 3CGWA 2EG9A 2AMVA 3OQIA 2JVJA 5IUNC 5EY5B 2X0RA 3L7YA 4YRNA 2ZXFA 2X2EA 1QHHA 5JAOA 1NY6A 4GKJB 4HC4A 1M5RA 4AZTA 1N6HA 3C8DA 3KEGA 3ZCTA 2R6FA 3TTXA 1YZGA 3PYMA 2VWHA 1EGMB 2BJVA 4XTCS 4BRZA 5AICA 1M2FA 1R1DA 4RKEA 2IW1A 5K0TA 4R71A 2WJ4A 3T1YB 1E5LA 4OBBA 5TXGA 1P5JA 4X45A 4UVEA 2C4TA 3OU2A 4HADA 2JLQA 2NTNA 1Z7YA 3OX1A 3VH2A 3WL5A 1JPUA 2CVZA 2QQFA 4EJ6A 2B25A 3EG9A 1L3BA 4Y2VA 2IU4A 3D7LA 4B31A 2CFRA 4YBZA 3VJRA 2YFYA 1L4BA 2XCTB 3M83A 1ISHA 3NKVA 2OE2A 3R8XA 1T0PA 4L8FA 3IUEA 4NG5A 1PWHA 3BL8A 3VPFA 4MUHA 1YZQA 3VVCA 3MILA 1ZSYA 1BWRA 4K6HA 2ZYVX 2H5LA 2G76A 3UMBA 4DNXA 4CM9D 1YJBA 4C2UA 5CT5A 3Q8WA 3WLJA 1ZGCA 2YNMA 3ENKA 4RS3A 4YAOA 3WP1B 1LCIA 3BCUA 3FFTA 3QFRA 4BX9A 2PMBA 4HAWA 5DGIA 3UW1A 3GNTA 1L7PA 4RFLA 2YV4A 3COWA 4F6LA 1YB7A 2WLSA 3I64A 4JYCA 4BE4A 4EZEA 4FGUA 3TVDA 1I4WA 5I7VA 1JLLB 1L7MA 1BXKA 1ZNWA 2ZETA 3ANMA 1TA0A 4OH7A 1SBIA 4PPFA 4YJ2B 3NTQA 1KJWA 1USWA 2D1YA 3ESQA 4MYTA 1JKIA 3EISA 4LYGA 3KKMA 4ECEA 5AFSA 4MEAA 4KYTA 4M54A 3MERA 1KBQA 4B46A 3W2TA 2PU5A 4E1BA 4EITA 5TQ2B 4KOAA 3EQ2A 2R0QC 3BICA 5JCPA 2F3QA 3NB0A 4PWZA 2ZT7A 4FXPA 5LIPA 3PPIA 3AESB 5E6RA 2P7IA 4Z2YA 1M8JA 2Y66A 5IC4A 2HF8A 1T4MA 2GTIA 3COPA 2JFOA 3JD2A 4FW8A 1MIOA 1JHQA 1UKEA 1U2GC 1XJ5A 2BEWB 2C61A 2DTEA 3QELA 5J4HA 1PS0A 2J9ZB 4U7DA 1D2EA 1YCHA 4RGBA 1MUUA 4RJKA 4UE6A 4P6VF 1U7WA 1IUOA 4P81A 4ZOAA 4K6FA 4B43A 3N6VA 3ZW7A 3A6EA 4J9VA 3HU5A 4QULA 2IU6A 3NIWA 4RLQA 4Q24A 4C6TB 5L3QB 3P2MA 4NCNA 3T94A 3O82A 5D86A 2P6OA 1ISFA 3VDNB 4BJ1A 4DJAA 4CODB 4DMRA 4J6FA 1A95A 1QO9A 3BHNA 4DR7B 1OMOA 1GG8A 4B3XA 1QTRA 1YJXA 2AEJA 4I14A 4ND8A 4YXWD 5JBNA 3SE0A 1LDEA 2XWJI 2WF8A 5DI9A 5JANA 2ZRQA 4QOIA 2DFTA 2IPOA 4TX1A 2KQUA 3DAFA 4D7AA 1S9HA 2YVLA 4O02B 4BQNA 3EPLA 2CMFA 3KEQA 3ZD9A 1I32A 3L0SA 1Y42X 2D5IA 1RHUA 1UCFA 2ZI7A 3ETGA 1A4UA 4U1RA 5CFOA 2AFIE 1ZHOA 3ND9A 2ERCA 3OD1A 4L8YA 2XTZA 1YQQA 2GH1A 3SBOA 2OV6A 2FUKA 4LCBA 5CA1A 1E1LA 2W2OA 2BT4A 1LXCA 5J5AA 4Q5IA 5K3DA 1JKFA 4NRDA 4XX0B 4JU9A 4EA9A 4K9LA 3HXOA 3E35A 2I6TA 5EJ6A 3EIFA 3DEIA 4DDMA 2F62A 3D8TA 3WE7A 3O6VA 1EAMA 4EI7A 1RJGA 3KEOA 1L4YA 1OWPA 4KXUA 4LFBB 3RRFA 3FUVA 5HDQA 4FFMA 2A7XA 2OL4A 2A5DA 2C31A 2PSJA 1L9KA 4PN7A 2D3WA 2AOUA 1GL6A 2DPLA 1YQEA 3GDOA 3GGSA 3ZHUA 1CF2O 3QTTA 3T7IA 2JIZD 3CS3A 4QIHA 1C80A 3KYBA 4ILKA 2GJAA 2XCUA 2ZB2A 4JXJA 5KWIA 3BFXA 3W90A 2HV9A 1GPBA 1JMVA 1FDWA 3DKRA 3JAKA 5U1PA 3RS0A 3C1AA 1BW9A 1W25A 5KYWB 2FEOA 3MSXA 5HILA 3WYNA 1RYHA 2QRKA 1NLMA 4K6GA 5DXAA 1RCUA 4Y6QA 3BMOA 5G53C 5D6OA 4F7WA 1K6JA 1NJ1A 4B09A 4LHWA 1VCMA 3QWIA 3HYLA 4G85A 4IRUB 2FX5A 5DMXA 2BHRA 2QP9X 4WZAE 2KBEA 2H06A 3AEYA 3ED1A 4UDXX 5ICFA 2R97A 2PSDA 5EQTA 1JU9A 5EJFA 1H2EA 2ZG6A 5HIIA 3ZWWA 1JFFA 3TZ6A 1L4NA 1GEGA 3K4QA 3LVFO 4A8HA 2CNKA 1C4KA 4LVCA 5H5JA 2PQMA 3D59A 2OHJA 5AHKA 2ZKIA 4O8CA 3A6KA 1IAQA 3ZW8A 4S05A 2MSDB 3K32A 5DLQC 1J07A 4DCMA 4H4CA 2R84A 4O25A 4PSVA 2I6QA 3FYTA 2R8XA 3G0OA 1AKUA 1C0EA 2WD8A 4MAAA 4UJ5A 1RRVA 3RU7A 1SUWA 4W9NC 2C1EA 1K6MA 3DZFA 1CU1A 3QEMB 3LKBA 3O03A 3FOZA 4K28A 2VTBA 2O8BB 1MBZA 3OWXA 1SVLA 4M8KA 2TECE 4OHKA 3RU2A 2YIJA 3AVUA 1II9A 1USKA 3DOJA 4PONA 5DBHX 4CDRA 1JV2B 1BFKA 1F20A 2QSJA 2R6R1 2FYTA 5BOSA 1Z3IX 3HQ4O 1HDYA 2JHFA 2P68A 2Q7OE 3V4SA 2OBMA 3ZUGA 4Y2RA 2OXRA 1ECLA 1HYQA 2HA0A 4QNNA 4K9SA 1JIJA 1QP4A 1CSEE 1FP4B 1ZC3A 3DAOA 3ESXA 3OZIA 3WJ7A 1GG9A 4BE7B 1JYSA 1CB7A 1PZMA 2HK9A 1F8YA 2QLBA 3GT3A 3U19A 4IIUA 2CL0X 4KQ1A 1TW2A 1NV9A 1Y6QA 1UPAA 4JA0A 3N0VA 2FSVA 3RNOA 4C0QC 1X80A 1YI8A 2QX7A 3EZ6A 4HCJA 2XLBA 1TTQB 2FUEA 1NY5A 3B1WA 3QKSB 4P31A 1HH4A 4FOLA 5LB2A 5FWYB 3SR4A 3WGMA 5C3MA 5HKKA 1CDDA 1U2QA 2X86A 3EVFA 3OZAA 4UUPA 3DE0X 4Y7CA 1J2JA 4FKBA 2L19A 2AHOA 1NQWA 1GKLA 2NUTB 2V0NA 1E59A 4FMDF 4S1PA 3LFTA 4QYSA 4M1MA 1A7AA 2GMWA 3G88A 3IEVA 2CXSA 1ECGA 2QTHA 2WPDA 1Y3FE 3GFBA 5H16A 3TBHA 1RTTA 4RTRA 3RWBA 1ND5A 3L4JA 5I4IA 1P8JA 3ZTYA 4BNHA 2YJ6A 5EJGA 4BIIA 1B42A 1PEYA 3LKDA 4LXQA 5CDFA 3R3WA 3UWSA 2Q0HA 4C22A 5ALMA 3TTUA 4HBGA 1SRQA 3FOAA 2PV0A 3HUDA 3ZH2A 1NYLA 1PUXA 3M1IA 2UVPA 1JR3A 1NX6A 4IIBA 4KTVE 4RIIA 2FEWB 2YYZA 1EGQA 2MT9A 4ZC1A 3VR1A 4BMNA 4RXMA 4DUGA 1OX4A 4RKQA 5C80A 1JA9A 3SCZA 2ALJA 4JI5B 4FCVA 3GJ0A 1TPZA 1ZIYA 1P4AA 4GC9A 4DLVA 2FZCA 5BW5A 2A4MA 5DHFA 4ZAXA 3L4BA 3CNHA 5M7EA 2ONJA 4D8TA 4H77A 4ZJUA 1HDGO 3U3ZA 3R77A 3H4VA 1G8MA 2IYAA 2ZRHA 2WSSD 5AK6A 1I7PA 5DE3A 3ZQJA 2V58A 4JP5A 3U3MA 2RGYA 1GA6A 4RDXA 5BVGA 3VOAA 3RV4A 1DE0A 2A86A 1HURA 5K0NA 4ETNA 3PNMA 4GZMA 4RVOA 4AUNA 2I2BA 5TLSA 3L1UA 4G0WA 4W5NA 3VZCA 1J20A 4DY4A 1RJ9B 3VYUB 3I5AA 4EHBA 3JVIA 2G08A 4EG5A 1T26A 5B58C 1ISPA 1II8A 2SKEA 3I58A 4F4DA 3DDNA 1RXWA 4K2HA 2XMDA 3GOQA 3KD3A 5A9SB 3I9V1 1XZGA 2IGBA 4L73A 3A4VA 5ELMA 4Y0VA 1SGWA 1H5NA 4OFXA 1TUBA 2ZJ7A 4UOZA 4DEVA 1YIDA 3DZCA 4O4HB 3DA8A 2OQIA 4IYRA 3GARA 3S99A 1NXPA 3E8MA 3L93A 5IMSA 1TD9A 2PUTA 4HLCA 4ALJA 4EY3A 2CHEA 4CGYA 2NVWA 1PW7A 2FPMA 5EQFA 1FS5A 2PL1A 1OHHD 1TB4A 4TTTS 5KDLA 1IHUA 3UWOA 3CLTD 1H8ED 1Y7LA 2JPDA 5IAKA 4DADA 5F76A 1NVVQ 2VP4A 3RF6A 1EMDA 1TLFA 3QELB 4IXNA 2V59A 3GRVA 1WHTA 3UUGA 1QCZA 1YMVA 3ELBA 3MA0A 2BUBA 1DLIA 1MKYA 1YSCA 2XKJE 4BIMA 3OU6A 3RUIA 5BN1A 1VJ1A 2FDXA 4FC6A 1R8XA 2LDXA 3KKLA 2L42A 3NBQA 1OE0A 1FU8A 2J32A 4I55A 4BNIA 3FKQA 1WDKA 2XUDA 3FHLA 4LF4B 3W6NA 2V7GA 1XZAA 3H13A 1YL7A 4UAVA 4B8WA 3RCBA 2A9OA 4ARVA 2C59A 1PL6A 2G63A 1N1DA 4QASA 3REOA 1NXOA 4N6OA 4KLAA 2PY6A 2YN2A 5A62A 1J2RA 5LWHA 2LRHA 4FN4A 4MPJA 1YU6A 2IYOA 4MW2A 3SF8B 4HMPA 3SYTA 4K5QA 4GOOD 3PI7A 4E32A 1KIAA 4KSYA 1TIBA 3P2JA 1SQ6A 1MB2A 1SK9A 2V5AA 2CVHA 3MUEA 3NC1C 2WIDA 4MW5A 2CCKA 5JS2A 3WGNA 1XXLA 2GKGA 4FSXA 5ELXA 1NW7A 1TRHA 3D3EA 1Z4PX 1U8AA 1SC6A 4OPMA 4IP0A 2BGNA 1J90A 1RAEA 1P0IA 2WFLB 4OM8A 4BV2A 3IO5A 4RMNA 5T4BA 1ZHHA 3EWAA 5H80A 4ZEXA 1FFAA 1WM1A 1W5AA 1WZNA 1V16B 5D1NA 1C9MA 4RTQA 1DAOA 3H3FA 3F49S 2BZ0A 3BKWA 2ENWA 3OJFA 2VNSA 4FMPA 5KYGA 3DOOA 1N6RA 3CX4A 5CH5A 1RC8A 1SHUX 1P0MA 2F9LA 1YHYA 1F5SA 3KQTA 4TQGA 5FUBA 4CCAA 3HGTA 3RSQA 3L8MA 3D4OA 4N6NA 1JSZA 3OZCA 1W4CA 3BF7A 1U5AA 1V4VA 4ZTUB 1PJBA 5DW3A 2NUAB 3UG7A 4KE6A 2WU4A 1P2TA 1P2UA 1H2XA 1K9SA 3HCEA 1CJSA 2WWFA 4FEAA 2I9KA 1VCIA 2W6CX 4IOKA 4EJ2A 4U7WA 1ZMXA 2FR8C 2GFIA 1M6NA 1WNTA 2FPIB 2R1VB 4UD2A 4QUEA 4DLNA 2NU6B 3PPYA 1WD7A 2PZJA 2X8JA 3K9WA 1SY7A 4HRVA 4PSAA 5HKAA 2PXCA 2XDQB 3H6KA 1EM6A 5M34A 3LC7O 4MVJM 5IZCA 5D5QA 4Y1RB 2BW0A 3QLEA 3TLKA 3D2LA 3I42A 1WHSB 4HXGA 2HZBA 4J4TA 3V4PB 1SCBA 1N4AA 2GO1A 3J80A 2H5JA 1IB0A 1J2TA 4URHA 4GF5A 2DR2A 2OHVA 1ETHA 3DQZA 4EPVA 4CM4A 5F1PA 3AB8A 4HLNA 4PLWA 5KNBA 3AM1A 2TS1A 5A7FA 4KDCA 5F3RA 1KGDA 1KMHB 1OYVA 2GRAA 3ZS8A 1W5SA 3B6ZA 5B7PA 1DBIA 3X1YA 1X7DA 4DJDC 2R8OA 2XGMA 1YACA 3L0CA 3VO8A 3G2JA 4PW0A 2SCUA 1VI2A 1WDLA 5CFQA 1CERA 4HATA 5HCNA 1MA3A 2E4WA 1VE5A 1FDIA 1REQB 3AR7A 3IV7A 4LNUB 3K9LA 3GFQA 3ZK7A 1XBTA 4UCFA 3UJHA 1NQOA 4DNQA 5DT2A 4DEYA 1ZH4A 2ZK7A 4E5DA 1RHRA 3R6DA 3A11A 1NFFA 2Q4TA 1UPUA 2AQIA 1JR4A 2NTJA 3BHIA 5K3AA 3L8YA 1VYVA 4Q3NA 3LUFA 2NZ2A 5FTJA 3GFRA 3IBYA 3RH0A 4CRWB 5EJEA 3BT7A 3BDVA 5C8XA 4OQLA 1J00A 1BZYA 2RH4A 2PMCA 3GPCA 2SICE 2FP4B 1OPRA 1ZLYA 4OREX 3OIWA 1RJDA 2ZJOA 3L46A 3ZTWA 1JT9A 1COWA 1UKBA 1E8DA 2BL4A 4DCJA 4HP8A 2QVZX 4AIRA 3I5MA 5TDHA 1SKYE 2FTKE 4M46A 3C3WA 3JPYA 1KZ4A 2HNAA 3D4BA 1OH7A 1FSSA 3OPXA 4HR7A 3HXPA 1D2HA 4CGZA 4G0MA 3UPDA 9LDBA 1H1DA 1J22A 2W90A 3KKEA 3MMZA 4UZFA 4CTNA 4FEYA 2HAEA 3QLVA 4MWGA 2DHRA 1QZZA 2B1RA 5FPHA 5EZYB 4E46A 4JL8A 3CRW1 5ALEA 4Q3BA 4IUDS 3WSWA 5B1YA 3OA2A 2RARA 4LRYA 3TXYA 4DIUA 1MC4A 5K2MA 2FX2A 4US1R 5KVVA 4OQFA 1O5OA 1OFUX 2CD9A 3N9IA 4ILEA 3CVYA 2VPPA 2O8EB 1V39A 1A2BA 2R7MA 1H6DA 3X2EA 1BMFD 4LEIA 3BD9A 3HEBA 3VR6A 1CB0A 1N4DA 3RWOA 1A1VA 4HXYA 4DV7B 3R41A 2G88A 3A05A 3D3WA 3NWEA 2AG8A 2C2HA 3ESAA 2IIPA 3AR6A 1INLA 2G7MC 2GAIA 1OXXK 4ESVA 2X13A 3VZQA 2WA1A 5B3JC 5AW1A 2GBLA 3GJRA 4FD2A 2FGKA 4FQ5A 4MWOA 5JG7A 4ZDIA 3L1IA 1W93A 4YRRA 2NAFA 3UN1A 3FGPA 4Y2XA 3IV9A 3RVPA 3EVZA 3EXAA 2QM7A 4JGBA 1AGXA 4BPBA 3IQFA 4FMDB 2X1VA 3M6VA 1PT7A 3PPVA 1R18A 3FI0A 3GBVA 3DXXA 1XWIA 2NQ8A 3B38A 4QQ8A 3BORA 4TLDA 3P5BA 1N7IA 3IAHA 4UREA 2C4HA 3EDCA 4NU0A 5B37A 3JQFA 4ZRMA 1NURA 5HF6A 3V4VB 3WHLA 3ZBQA 1FLDA 1JMYA 4TMYA 2PUVA 2O06A 2D2IA 4UUMA 2R751 4G84A 3OPVA 1QIIA 4INZA 5D85A 3RSHA 5A6VA 2BCEA 2C0PA 2PNFA 2PX0A 4QHTA 3T6KA 2LCFA 2ID9A 2MIIA 2EIHA 2Q29A 2GO7A 3QBVA 4NOMA 4XLTA 5DM1A 2NP6A 2EFHB 4EP1A 1TFUA 4GBED 3UK0A 5CBKA 4G97A 3QMVA 4BVBA 2ZYSA 3BFJA 5P21A 3VGPA 1BXGA 2JIPA 4HI0E 5EIHA 4E09A 1G7SA 2C2MA 4LGCA 1XZCA 3COZA 3A7EA 4QDXA 2PZBA 3NOVA 3WNCA 2Q6LA 2Q5FA 3DGFC 3MEQA 3LBNA 4WCFC 1WW2A 3AEUA 3AEXA 2EW2A 2V8BA 4UPVA 3PUYA 3A6LA 4C5AA 5IJ0B 1T24A 1TEVA 3N59A 1IK6A 2OXCA 2ZJ3A 3UC5A 2XJ9A 1K75A 2DU8A 4JNCA 3TB4A 2FEKA 5E1BA 4DA9A 3D5QA 3VPSA 1BCRB 1R00A 2G1KA 1GR1A 1R8JA 1SG0A 1GADO 3C3PA 3L1KA 1BMQA 5KQGA 3U56A 3WAJA 3VOSA 4OXYA 4Y0AA 4UHDA 1Y8CA 221PA 1QMGA 2P3SA 5E7MA 5FFFA 5H70A 1FDUA 3K8ZA 4JX8A 1W581 1M6VB 4LWOA 2HA2A 2I55A 2QX9A 3ADKA 5KO2A 1T3SA 4Z4FA 3QHQA 5IEBA 3RG8A 3JARA 2ECQA 3BTUA 3D0OA 5T4FA 5FIUA 3WVNA 4EG6A 4AZ3A 3ZDDA 2OBNA 4I3FA 4M7OA 4NU6A 3SJUA 5C7OO 4WADA 3M7IA 1WS6A 2C5SA 2DECA 4IXWA 5KJ1A 1BC5A 1J2EA 1DIAA 3L6CA 4DCVA 3ASYA 4GXNA 1N5LA 4W8OA 2SHKA 1N7HA 2GSDA 2BOVA 2K5UA 2Y6UA 1PJLA 3JAKB 4OK3A 4P5PA 3CZCA 1VECA 4UFNA 1DEXA 1X77A 1E3DA 2TMGA 1QONA 1H5QA 1APBA 4O4LA 1JFTA 4ZVLA 4FVTA 5EYPA 4KIUA 4LC9A 2TYSB 1U2DC 4W8GA 4KLZA 3KQNA 4NECA 3ABRB 5TSDA 4IY1A 2WWVD 1QVWA 2YRWA 3UAXA 4K7JA 3HO1A 2CLIB 1TNDA 2ZLBA 3UJ9A 1G20B 1OAOC 4OFZA 4KVFA 5CA1B 5FBZA 1HETA 3LPCA 2OOSA 2PKQO 2ZKLA 5F23A 4JVOA 1DCTA 5BRJA 1J9EA 1NQVA 2ZIXA 3BGIA 4YMVA 3D2AA 1PJTA 1DAPA 2NUPA 3HBNA 3ZHCA 4PYJA 3CMCO 4OIFA 3HCNA 3IGFA 3N76A 3NCTA 1OSNA 1A1SA 4MV6A 4YRAA 4AWXA 2PYIA 4RZIA 1JEQA 1H2HA 2QJRA 4UUAA 3GJXC 4V0LA 4B9EA 1L9XA 1ZVKA 3UT5A 3PD7A 4P98A 3WQSB 3QYPA 5A5FA 1PQPA 5AT1A 5AWFC 1TZJA 4F2HA 3SJBA 3ZKWA 5M29A 3STUA 1U65A 1UJCA 1HK7A 3KJNA 2FA9A 2G70A 1E2QA 4QDTA 1V3UA 1CC1S 2YMLA 3EXG1 4R7ZA 4TTSA 2C84A 4ZRNA 3M3DA 3U39A 2DBVO 1GPKA 3ZWPA 1QOQB 3FYUB 2GAJA 1V35A 4QBHA 1UKVY 3ULKA 3MQFA 1Z4IA 2JGEA 1DC8A 3V2UA 3DVSX 1TC1A 1E2JA 2YWCA 4BFUA 3K1JA 5HTKA 4IILA 1AU9A 2HU2A 1CUCA 2WYWA 3ZHBA 5F3DA 2PJRA 4B71A 1EQUA 1LGYA 4OKIA 1G63A 4X8HA 2VHEA 4U7GA 3PDUA 4FFVA 5EE0A 2ZJ2A 2OZKA 3T5CA 2DH6A 2AQ8A 3B13B 3WKAA 3HA7A 3W5BA 4YV2A 4MA4A 1F0NA 3QVOA 4JITA