5HILA

Crystal structure of glycine sarcosine n-methyltransferase from methanohalophilus portucalensis in complex with s-adenosylhomocysteine and sarcosine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
244
structure length
240
Chain Sequence
DHYEEEYVLGFVDKWDELIDWESRAESEGDTIINILKERGVKKVLDVATGTGFNSVRLLQAGFDVVSADGSAEMLVKAFDNARDHGYLMRTVQADWRWMNKDIHDKFDAIVCLGNSFTHLFDEGDRRKALAEFYALLKHDGVLLLDQRNYDAILDSKHAHYYCGDTVSVYPEHVDEGLARFKYEFSDGSVYNLNMFPLRKDYTRQLLHEVGFQEINTLGDFKETYKEDEPDFFLHVAEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine sarcosine N-methyltransferase
publication title Structural Analysis of Glycine Sarcosine N-methyltransferase from Methanohalophilus portucalensis Reveals Mechanistic Insights into the Regulation of Methyltransferase Activity
pubmed doi rcsb
source organism Methanohalophilus portucalensis fdf-1
molecule tags Transferase
total genus 86
structure length 240
sequence length 244
ec nomenclature ec 2.1.1.156: Glycine/sarcosine N-methyltransferase.
pdb deposition date 2016-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5hilA02
1R8YA 4QVGA 3IHTA 2XVMA 4QDKA 4RWZA 5LSAA 5FWDA 4ER5A 5EMKA 3BT7A 4C03A 3I53A 3TR6A 4OX9Y 1TPYA 2Z6UA 1HMYA 2ZFUA 3EVFA 4EK9A 2JG3A 1MHTA 2EX4A 2PXXA 1AF7A 2HWKA 3FTFA 5LQAA 1R18A 3OU2A 2IIPA 2OY0A 4GOOD 4E2XA 4CXMA 3FUVA 2AOUB 1JTEA 1EQAA 2JHCA 3DXYA 3H2BA 2QM3A 3OE4A 3FPEA 3QOWA 4QDJA 4RVGA 3ME5A 5DM1A 4KDRA 3TQSA 4CTKA 5GM2A 1NW7A 4AX8A 2OB2A 4GUAA 2ZZNA 3FYDA 5DX8A 1NKVA 5EHIA 5GWXA 4AZSA 3DULA 4YMGA 5BXYA 4YUXA 2FRXA 2PGXA 3P9KA 1JQ3A 3LL7A 1FPQA 4GEKA 2R3SA 5EIWA 1L3CA 1O9HA 5EEHA 5H02A 3THRA 2R6ZA 3VSEA 5KS2A 5CIYA 4RYLA 3UJ7A 5GINE 4RTRA 3ANXA 5EKUA 1N7JA 1YB2A 3KQSA 2AOTB 1JG1A 4BY9E 1M6YA 3MERA 5DTQA 1XTPA 1RI2A 4L7VA 4FSDA 4EQZA 4C08A 4QPPA 3TKYA 3Q87B 5D1NA 5CCXA 3KQPA 2H11A 2IP2A 4IV8A 3DMHA 2BR5A 2IPXA 3M6VA 5EZQA 5CD1A 1BOOA 3EGEA 4WVLA 3LX6A 2BR3A 3REOA 5LQNA 5E8RA 4YUWA 9MHTA 2PT9A 2IDJA 5EPEA 3LGAA 3DLCA 3G2QA 3E05A 5KQSA 1M0EA 3R0QA 4F84A 1VP9A 2Q41A 3EVBA 3KQTA 1NV8A 2O05A 2JHAA 2AOXA 5FHRA 4EKIA 3B7PA 5FA8A 2AS0A 5E1MA 1VBFA 2GAFA 1JTFA 3NW9A 3VC2A 2HNKA 4LECA 1KP9A 3JWHA 4F85A 5DRYA 2BM9A 1UIRA 1NBHA 1AQIA 3THSA 3P9IA 1VQ1A 3UJDA 5LR6A 1X1CA 2PBFA 5HEKA 3ELUA 3IYLW 2C7RA 1L1EA 3R9XB 4GF5A 1X1DA 2O0LA 3UJBA 3G88A 1DUSA 3EVDA 1SUIA 3HM2A 5T64A 3O4FA 2CKDA 5K0GA 4R8RA 1EJ6A 1RI4A 2B9EA 3L8DA 3OFKA 1NW3A 5EQJB 3DH0A 1KR5A 1XDZA 4KW7A 4GQBA 3BWMA 5K0EA 1YFJA 3PTAA 1JSZA 3JWJA 4AZWA 3DTNA 4QPNA 3GJYA 4CTJA 5EMJA 5EC8A 3SMQA 3LDGA 4EVIA 3UJAA 2GB4A 3AXTA 1NBIA 1INLA 4HGZA 1DL5A 4P7KA 4PYOA 4DF3A 1G60A 2P35A 1V39A 3MCZA 5CM2Z 2ZCJA 1ZGAA 1R00A 3KQQA 3T7RA 3BUSA 4DMGA 1SQFA 3E7PA 3GRZA 5HIJA 2PSSA 3CBGA 4P7GA 1RI3A 5F2KA 2O57A 2YTZA 4PYMA 4OA8A 1G8AA 1DCTA 2NXNA 4C05A 2ZBRA 5FCDA 4KRGA 3LECA 2PKWA 4ER6A 2C7PA 3G2MA 3FRHA 5ERGB 2NYUA 4XUEA 3NTVA 2XBMA 1KPIA 1JQDA 3EVAA 1VPTA 3PVCA 5E8JA 7MHTA 4WXHA 3R24A 5K03A 1G55A 4K6MA 4X41A 4E70A 3HVHA 1D2HA 3KPJA 2P3LA 2DPMA 1X19A 5CUQA 1MJFA 3SSOA 1FJXA 4R8SA 5KVAA 5T67A 3EGVA 1Z3CA 5BW4A 1XJ5A 4RTJA 1KXZA 2PJDA 3KR1A 2AOWA 1VL5A 1KPGA 2K4MA 2P41A 3LKDA 1QYRA 3FUXA 1P91A 3PFHA 4E30A 4POOA 2IH5A 3MTEA 1UWVA 1WXWA 2AVDA 4HH4A 5JUWA 2B2CA 1WS6A 2P7IA 3HCDA 1L9KA 3MCTA 3C6KA 5HILA 2GS9A 3GO4A 5EEGA 5EIFA 1RI1A 3UJ9A 3F4KA 4HG2A 1D2GA 4A6EA 1QAQA 4YUVA 3TM4A 2OKCA 4RTMA 3T7TA 5BP7A 2FCAA 3BGDA 2NXJA 1NW8A 2B25A 3EVCA 3OU7A 2ZW9A 3UJ6A 1YFLA 5E1DA 2P1DA 3FTDA 2Z6AA 3RW9A 3EEYA 2FK7A 3M70A 3K6RA 3SVZA 3KQOA 4FT4A 3TLJA 2O06A 5E2BA 1XXLA 4QQNA 4HC4A 3HCCA 1P39A 4OBXA 4YV1A 1QAOA 3GRRA 4BLVA 1QAMA 3CJQA 3JWGA 4A6DA 2BZGA 4BLWA 2ZVJA 3AY0A 3ER9A 4GOND 2ZLBA 3TFWA 1T43A 2PX5A 5E1BA 2ORED 3HCAA 1H1DA 4BP3A 1QZZA 5K0BA 3EPPA 5ICFA 3UBTA 2ZWAA 3G89A 3G8BA 3QV2A 1P1BA 2B78A 3A7DA 4M36A 4RTNA 2FK8A 4R6WA 1FP2A 5E9WA 3FUTA 4UOEA 3FPJA 2VDWA 4CWAA 3ER8A 3CJTA 2H1RA 2AR0A 3GU3A 2OZVA 3AXSA 3DXXA 2ADMA 3KQVA 4OQDA 3R6TA 4PWYA 4QTTB 3G5TA 2PVCA 1ZHFA 2FHPA 5FADA 2IBTA 2Y1XA 3VYWA 1WZNA 4PINA 2G8NA 2QRVA 3E23A 3G7UA 3GGDA 3MB5A 3TPZA 3LBFA 2CWWA 2I62A 3ID6C 3PX2A 3GRVA 1R6AA 4DQ0A 3PLAE 2WA2A 3FUWA 3OPNA 5G02A 2IH2A 3A25A 4OBWA 1JG3A 1B42A 3HCFA 3S68A 2XVAA 2YVLA 5LQJA 1G6Q1 4C07A 3DXZA 3HVJA 4KDCA 4R6XA 4GOMD 5DTMA 3GXOA 4YMHA 4DKJA 1YZHA 1RJDA 2QRVB 4IKPA 2Z6QA 1N2XA 4FT2A 2WK1A 2VP3A 5E9JA 5FTWA 2VZ9A 1O54A 5EMLA 5JR3A 2AN5A 5DTRA 1SKMA 3FRIA 5CVDA 5DLYA 3WSTA 5EHGA 3G2PA 4DCMA 4FR0A 4XUCA 4G56A 4C04A 1YUBA 3HNRA 3MGGA 3P2KA 5E1OA 1FBNA 1I4WA 2OB1A 2AN3A 3GNLA 3KKZA 5CVEA 3SXJA 2UZ4A 4RSRA 2O07A 3ELYA 2IDKA 3KR9A 2PX4A 2LD4A 3FUUA 5GIPE 2ZIEA 2YX1A 4V0QA 2VDUE 1XVAA 4V0RA 2IH4A 1PRYA 3FTEA 3NVKI 3DLIA 5K05A 2G70A 2G71A 3AWIA 5FQNA 1VP3A 5F2NA 1IXKA 4U7TB 5ICGA 5DWQA 5C1IA 3HTXA 3B3FA 3UWPA 5FUBA 2JH8A 2H00A 5KYGA 4X60A 3EEOA 5GIOE 3FPFA 4RVDA 3MHTA 3SR4A 4KVZA 2YXLA 3EVZA 3NVMB 3BXOA 2JHPA 2VDVE 1EG2A 3LBYA 2ONYA 1IY9A 2DULA 5IKMA 2UYCA 1YF3A 3SX0A 1D2CA 1NV9A 2NP6A 4HRAA 1EAMA 4MWZA 3MTIA 1OR8A 4PCAA 4YV2A 5FA5A 2HV9A 3KQMA 5FULA 4ATNA 1JSXA 5EG5A 1X1BA 3TRKA 1BKYA 4EKGA 2AZTA 4E2ZA 4KWCA 3GDHA 3V97A 1R8XA 1ZG3A 3UZUA 3UJCA 4YUYA 4PNEA 1SVUA 3LCVB 2C7QA 5MHTA 2NNWB 2YQZA 2EJUA 4DA4A 3HA3A 3QOXA 4LWOA 4ZTBA 4E2WA 5DM0A 3M4XA 3OE5A 5F2OA 5T6BA 3PT9A 3CC8A 4P7FA 5EZSA 2E5WA 4E33A 2I9KA 1VIDA 1WG8A 3O7WA 3D2LA 1NE2A 2ESRA 3BKWA 4JXJA 5DSTA 4EMSA 4KIFA 5KQRA 3NWBA 3HA7A 3HP7A 3SGLA 4E32A 3M6UA 3PX3A 3C0KA 1Q0SA 2P40A 4BP1A 1FP1D 3LHDA 4Y2HA 8MHTA 1YZ3A 5CVUA 5P8WA 3KPYA 4FZVA 2ZBPA 5HFJA 4PYJA 2VS1A 2PY6A 2ZZMA 3SM3A 3GRUA 1XDSA 2JH9A 5HIIA 3A7EA 4HTFA 5EGSA 3IV6A 4YV0A 1KYZA 1Q0TA 3PB3A 3T0IA 3X0DA 4GC9A 1KIAA 2GA9A 3EMDA 4RTQA 2G1PA 3I64A 1TW2A 2ZWVA 4O29A 1WY7A 4ER3A 3UJ8A 4PYQA 2PXAA 5DXAA 3LDFA 2WA1A 5DSXA 2GLUA 3LPMA 3OZTA 4GOLD 4YUZA 4RTPA 1XCJA 4P7JA 2CMHA 2Y1WA 4RVFA 4DM3A 2BR4A 5DXJA 2FPOA 1EIZA 3DMFA 4P58A 4IV0A 1JQEA 1ORIA 4LG1A 4ER0A 2HTEA 2HR1A 5IH3A 4B17A 1O9GA 5C0OE 1G8SA 5K09A 3FYCA 1HNNA 3HCBA 5DPMA 3T7SA 3RIEA 2IFTA 2XYVA 2P8JA 1WXXA 1IM8A 5M5BA 1VLMA 4FGZA 4C06A 2OO3A 2GH1A 3MAGA 3BKXA 2YXDA 3NMUF 1SQGA 4QTUB 3BWYA 3M6XA 3LDUA 4XUDA 5ICCA 3C6MA 3KQYA 4M37A 1R74A 5E9QA 2NXCA 1ZQ9A 3B5IA 2ZSUA 2AVNA 3P2IA 2A14A 3PS9A 3E8SA 2ZIFA 3LKZA 5ICEA 2AN4A 4PYKA 2PLWA 3R3HA 3FPHA 2QY6A 3I58A 1X1AA 3KR2A 3BWCA 2AOTA 2UYOA 3EVGA 4U7PB 3C3PA 2PXCA 2CL5A 3TOSA 5LQRA 4C4AA 4E31A 2AOVA 1PJZA 3RODA 5GOZA 2EFJA 3C3YA 3IEIA 2ZIGA 3EVEA 5D1HA 3A27A 3DMGA 1VE3A 4OQEA 4MTLA 5DRTA 2N47A 4CKBA 3LCCA 1AV6A 2FYTA 4QVKA 5GP1A 1UFKA 3P9NA 3AJDA 4PGGA 4OA5A 2IBSA 3OCJA 4M7RA 3NDIA 3A26A 2B3TA 1RJFA 1XCLA 2ERCA 2AOUA 5K0FA 1KHHA 3KU1A 2ZBQA 3DR5A 4NECA 4M38A 2OBFA 5LQKA 5CCBA 4FS8A 1NW5A 4RX1A 2ZZKA 4F86A 2GPYA 3B3GA 3G2OA 2YXEA 3ELWA 4PIPA 2PWYA 4AZTA 1BC5A 3FTCA 5FQOA 5EKXA 4RTLA 5HIKA 3GWZA 3KR0A 2C7OA 1QANA 3I5UA 4GC5A 2PT6A 4QQKA 4R05A 2F8LA 1ZKDA 1JG2A 2CMGA 2PWPA 3NJRA 5CVJA 5DM4A 5BW5A 3B89A 4HSGA 2ZTHA 3VC1A 2JJQA 5CVVA 3MQ2A 3G5LA 2XYQA 5DX0A 2G72A 1I9GA 5HIMA 4ER7A 1G38A 3SSMA 3CCFA 3BZBA 2XYRA 5EMMA 5HOQA 4HGYA 3FZGA 3I9FA 1RJGA 2YUIA 4MQ4A 1EJ0A 1ORHA 3NDJA 3UA4A 2BH2A 2OPBA 4PYNA 4X1OA 3TMAA 3TM5A 5HZMA 3FPGA 2EG5A 4FP9A 2V74B 3LCUA 5EVJA 5K8VA 3HCEA 3OFJA 3NWEA 5K0JA 3HA5A 3ERCA 4PCLA 4RTOA 3DOUA 3U81A 3K0BA 1F38A 2BM8A 2V7EA 3P71T 4H0NA 3GIWA 3KPVA 10MHA 4RTKA 3SSNA 3BGIA 3HEMA 3KPWA 3A4TA 2UYHA 5U4XA 4FSXA 1RJEA 1KPHA 3B3JA 3P8ZA 3HVIA 3Q7EA 4ISCA 2HMYB 1XDUA 5K0LA 3LSTA 4PYLA 2ZULA 2QYOA 1TW3A 2PV0A 4BLUA 1AQJA 2QE6A 3HVKA 4PYIA 5DM2A 4X61A 5E2AA 3UFBA 5K0CA 1U2ZA 3EGIA 5B1SA 4AUKA 3KQWA 3V8VA 2UYQA 4RVHA 1BHJA 4HTFB 3CGGA 4MIKA 4MHTA 5K01A 1ZGJA 2PX8A 3DUWA 3PFGA 1L3BA 4Y30A 4E2YA 4X63A 4PONA 3CVOA 2YR0A 4CKEA 3KPUA 1SG9A 1JR4A 3CJRA 3CKKA 2P3OA 3BWBA 3OZSA 2IGTA 1NW6A 2I7CA 2OYRA 4DZRA 4AZVA 1P1CA 3P2EA 1I1NA 3P97A 4DCGA 3ORHA 5GM1A 5DT2A 1L3IA 3EMBA 1M6EX 2NP7A 5EOVA 2P3QA 5C9ZA 1JG4A 3M6WA 3TKAA 2PX2A 3M33A 1F3LA 1Y8CA 2P7HA 3KHKA 5LQUA 4XCXA 3GRYA 5LQCA 1NT2A 3DP7A 3OU6A 4PGHA 1KYWA 4PIMA 4RV9A 5DX1A 4GBED 2OXTA 3BGVA 4CKCA 2EJTA 4KIGA 3JWIA 4RTSA 3O31A 1RI5A 2KW5A 2NXEA 2ONZA 3OZRA 4IWNA 3G8AA 1SUSA 2I6GA 4LWPA 5FWAA 3ELDA 5K0NA 3P9CA 5FHQA 3UA3A 4Z2YA 3GCZA 1N7IA
chains in the Genus database with same CATH superfamily
3ZWQA 1W85B 1ZYUA 1NJ2A 1SUCA 2VJMA 4FYYA 4OMCA 3H9JA 3ONEA 1S8OA 1R9JA 2QYTA 5KNLA 1I80A 2PGOA 1NUUA 1X9GA 2B5VA 2JJ8A 3QU2A 1M2EA 5EMKA 1CLEA 1AG9A 1U9ZA 4BECA 1NR5A 5K8CA 4TMTA 1CS0A 2EFHB 2GEVA 2JZCA 4KBYA 3KB8A 2UZ1B 4CIYA 2GGSA 1AF7A 2XDYA 1Z12A 3CX3A 4NCNA 5AKIA 1EFVB 3HQ4O 5AKLA 1TA4A 3OU2A 3AEUA 3DCJA 3G1WA 2MJLA 2CB9A 3HBJA 1APBA 4OPMA 2H59A 4ZO6A 2JAPA 2JHCA 1HYEA 3AVXA 1WDLA 3OZIA 4IX1A 4EQ6B 3QVOA 4YPFA 3OLCX 3A10A 1TRHA 3QFRA 4HFMA 4KO2S 5DHUA 2PX3A 1RADA 3UOGA 5L3SB 2H63A 4DMFA 3E1SA 3ZVRA 4J90A 4TXJA 4NZYA 4EUEA 1G1AA 1VYVA 3FTPA 3P52A 1YRYE 3EZXA 1BHSA 1XTSA 3VH3A 1EFVA 2R3SA 3WR5A 4AY3A 1YL5A 3EPRA 3WGNA 1D1PA 2F67A 2C07A 1LTHR 1N7JA 1T9GS 1K1EA 2BGNA 3AERB 3ENZA 1SCKA 3BIOA 1T2CA 3VR5D 4D3ZA 1V5WA 3TDNA 4ZEVA 4BWFB 2PSEA 3BGSA 5AI6A 5H3HA 1Q6ZA 1TB4A 3U3MA 3GP8A 1P5RA 1KXJA 2C2MA 2REOA 3KQPA 1FFGA 2O8EA 5JJKA 3N76A 5DBIA 3QF7A 5IM5A 2FJUA 4C01A 3GZNA 1MEOA 2FWRA 5KOIA 9MHTA 2IDJA 5IMBA 4LJ4A 4EKDA 4JI0B 1T5HX 1GGVA 1VJCA 3TTTA 4D3FA 1PT6A 1P81A 3CH5A 5FI5A 1MX1A 5KSWB 3K9CA 2NZ8A 2W11A 3TSOA 2VZ8A 1SH7A 1D9XA 2AS0A 4OHUA 2VJYA 1Y42X 2C4UA 1Z15A 4URYR 5DCUA 1IM5A 1M1NB 1T2DA 3KU4A 4PLTA 1N34B 1G6OA 5SZKB 4D57A 1EDZA 5BSTA 3MRVA 3S2IA 4RK5A 2X8JB 4S35A 4KYTA 4JKOA 5GVSA 1WDMA 2CF5A 4YAJA 1VYTA 3QY0A 1RWKA 4BGDA 1KQFA 4BHTA 1EFHA 3A6FA 4A36A 2ODNA 3FCOA 1LK7A 1JS1X 1E98A 4GF5A 4KXVA 2XB9A 4G5GA 4GLFA 1NPTO 3LPDA 4V38A 4HPXB 4DIOA 2V6JA 1NVVR 3PU6A 2CJFA 2B9EA 2QD5A 3PC2A 3RRNA 5BQXA 5JXWA 1FF9A 5E6SA 1OC4A 2Z43A 2I54A 1GV1A 1TCVA 3LT0A 3NHKA 1R0WA 4NBNA 3ZWOA 5A03A 1AA6A 3STVA 1GZ6A 3HJFA 1T4BA 2JFXA 2Q1YA 3O2NA 3L8YA 1NN3A 3VZQA 3HUTA 5KTOA 3NTLA 1WPGA 5HTKA 3DT8A 4P7KA 3EEFA 1CUSA 4IEIA 2XOKA 3NHWA 4I19A 2AMFA 3QFSA 4KN6A 4X8MA 3L0PA 3KJHA 4BIMA 4JS0A 4F3CA 1LJ8A 1SU4A 2HU2A 3CH4B 4FD3A 1JX6A 2IIQA 3K2IA 3QVSA 4RD0A 2YCBA 2A94A 4PCUA 4WEQA 3RH0A 3C7KA 3HMQA 3HBFA 2O57A 1NMXA 1NJGA 4YASA 5CTAA 1XI2A 1FS4A 4PG4A 3QEKA 1E9VA 5AW6A 1SUWA 1XCOA 2WKQA 2ZBRA 4J0KA 4KN8A 5FCDA 3TPZA 2XUOA 5IKOA 1NLUA 3NTVA 4IG9A 4QGFA 2NV2B 2IXAA 3EVAA 4LEIA 4CMKA 1IJKA 3R6GA 1E2EA 1U8ZA 3I30X 5AJVB 3ZX5A 1V8PA 3NETA 1V1JA 2C58A 2H1CA 2I87A 3B13B 4X41A 2FXIA 3ESDA 3FCAA 2FLKA 5M04A 2FUCA 4XWYA 3W5BA 1XKXA 2QB5A 3QXJA 4Y7CA 3FYUB 4M86A 3WDSA 1E66A 3VO9A 1AGNA 1DRKA 3KZ1E 5CB6A 4IMRA 1Z8NA 1TZKA 1XTQA 4QE3A 1KXZA 2HHLA 1OIXA 4ZGWA 1HLGA 1W9HA 2FQYA 3EXHB 1B93A 4N5IX 1CUXA 2BFCA 2MSKA 4UTZA 3RB8A 2PGJA 5IKPA 3AKZA 3ZHYA 2HQ1A 4K8RB 4ZZ2A 3VR6H 1WXWA 3KKOA 2V7TA 3GGOA 2CV2A 5HILA 4CTOA 3E5HA 2RHHA 3F74A 1VLZA 4CKCB 2RHWA 2J6CA 2VPTA 4G9GA 1B8NA 1MJGA 1P62B 3HR7A 4BNZA 4FILA 2B4YA 1YHZA 2A35A 3FI9A 5EXSA 1VKJA 3UJPA 3E8MA 5EWLB 3TUZC 1DB3A 5K8UA 2YS7A 1BJKA 4JD5A 3T0FA 4G1VA 5J4LA 1BJTA 1CG6A 3EVNA 3FKSD 4EYQA 1KKMA 4DXAA 3T5DA 1L4FA 2I6SA 4OBXA 2D1TA 1OU4A 4UMVA 5TQ0B 4BLWA 2ZVJA 3NDBB 2O3UA 2Q45A 4F6RA 2R68A 4IVPA 3KWLA 2HA7A 1H1DA 2LKCA 3PC7A 4WY5A 3I01A 3ZI0A 1RC1A 4KK3A 2ZSFA 4YR7A 2IVFA 4CM7A 3V1KA 1RAHA 2E1RA 5CLIA 1MHPA 5EIBD 3FPJA 2VDWA 1JIJA 1ID1A 4G01B 2LE0A 3IR5A 2AMLA 2AR0A 1E2QA 4WCVA 1FMTA 4L95C 3ZYZA 1GLNA 3B9RA 3JATB 4PRYA 4BMYA 4D9CA 4MDEA 1VHTA 2GBLA 2R6R1 2O0KA 1N5JA 5C3MA 3K7EA 4QKQA 3RF7A 4LY9A 1EFPA 1Y5RA 3E1GA 4U6SA 9LDTA 5K9ZA 1KI6A 1U1EA 1MAAA 3ID6C 3K5PA 1GCUA 2D13A 5JALA 1Q1NA 3NCHA 5L40A 5F98A 3OPNA 1FNDA 2VIIA 4A5OA 1U5CA 3A25A 2Q6TA 1II0A 4EFKA 1B42A 1FDWA 2VNKA 4B2IA 5GTDA 2RHJA 3TIGA 4CNQA 3CR8A 3DBHA 3GD7A 1M66A 2BMDA 4YMHA 4FHEA 5LL6P 4MVJF 4MGIR 2AHRA 4CIAA 2B20A 2WT8A 1N2XA 3ILSA 2WK1A 5FF9A 5CCDA 1F2UB 4EHKA 1RP1A 4LKOA 4ZJUA 1TZCA 3A31A 2PAAA 3FRIA 3NIFB 1A9XA 4ZU3A 4BASA 2W2TA 2PCLA 3N2NA 1IONA 1Z6TA 4MRVA 2V1UA 1SC3A 1QYVA 3SC4A 4BRSA 1XCPA 4CHGA 3HH8A 1KZ9A 3QEBZ 3Q10A 1ZCAA 5G0WA 4AZ3A 5EPOA 5BMOA 4CG0A 4FW9A 3B6EA 3M1YA 5HBRA 1EFCA 2Q3BA 1MO5A 1N5IA 5IC4A 2V3VA 4KXXA 2VWQA 4V0RA 4BRWA 4KGVA 4UDXX 5T3YA 3T3EA 2G70A 2OWDA 5BVHB 1K98A 1UF9A 2BISA 2PKEA 2XT9A 5K3BA 4BMCA 2NO1A 4B76A 2ZWIA 3OIYA 4RWEA 3A05A 4XOUA 5GIOE 1MO4A 3CM0A 1TUIA 3CH7A 4MP3A 3WBFA 4YCMA 5IN4A 3UYKA 1VRVA 1AO3A 4WJKB 4DMCA 2Q5JA 4S04A 3QUCA 2HXYA 1GNQA 3K2BA 4HD8A 4GE0A 4UASA 5JS6A 2O2EA 2AKYA 3AWDA 3PUJA 4ITVA 1NV9A 3K1TA 1LB1B 4NH0A 4AB1A 2C5HA 4EATA 2PLNA 2P65A 1P6QA 4CHTA 1Z8HA 4TVOA 3F78A 1JSXA 3TRKA 3B6MA 4FCVA 3GLGE 2ZBDA 4XSGA 4YV7A 1G3UA 4IM7A 1KS2A 3T5GA 4LX8A 3WHLA 1NOKA 1YE5A 1ZVMA 3KKMA 2C7QA 2F8TA 1KOJA 3TLKA 4J76A 3S1LA 3VYVA 2FW1A 4DQKA 5NULA 3PJRA 1ZS9A 5JHHB 2R48A 3FW1A 4CLOA 3V8MA 1PFGA 3GNSA 4MICA 2E5WA 2GNOA 1T4MA 2RHCA 3AL2A 3QVLA 1UPUA 3UT0A 3JQDA 2I9KA 2YJZA 2XF2A 1YOVB 4MLZA 2PNFA 4IEEA 4PTYA 3HA7A 4L6IA 3GRAA 5HE9A 5KOJA 4LTDA 3MQFA 2JEYA 1SXJD 2ZEJA 4QXPA 2O2XA 4XWKA 2RI6A 4EKEA 1J8FA 3RV3A 4AJ4A 3UCXA 1L5MA 1WSWA 3FI0A 4I6EA 3AESB 5AVOA 1TVEA 3UAYA 4LDQA 4AM8A 5IP5A 2J09A 1F8YA 1JDNA 2PMCA 3A7EA 3CINA 3MD0A 4UAJA 1YS2X 3PJEA 3GMIA 1VG1A 4KKVA 4II2A 1K4YA 3TTSA 3RGGA 2GHIA 1ZM9A 2VPZA 1KETA 1XWIA 4MARA 3LDFA 3MOIA 4C3VA 1QGUB 1KQOA 1YAJA 1QG4A 1JHRA 1M2GA 3QJGA 4TYMA 5LCXA 4RTPA 4ZV9A 2OK8A 4P7JA 4HV4A 1JQBA 1JT2A 2BR4A 1JAZA 1MPXA 2RG7A 2XECA 4XQEA 5GGXA 2BGKA 2O8CA 1JXMA 2VHEA 4UEOA 3KHUA 4IOKA 4EL0A 3O4JA 1QCYA 5J58A 1UC8A 1DIAA 1MVNA 2F43A 2RG1A 4O4HB 2FPXA 4YUAA 3ACCA 5L3ZA 4B6RA 3UT5B 1KHTA 1O6BA 4YHHB 3M6XA 1EP1B 1H4VB 2DBVO 3M6FA 2QAGA 2XKJE 1T3TA 1FFAA 2O8CB 1OB2A 1XQ1A 2I2AA 1OGJA 1XAGA 4FXOA 3MMPA 5D7BA 5SY6A 4B6OA 1FDTA 3TLGA 4EAAA 2L42A 3LKZA 5ICEA 2HZ7A 1A72A 3QBEA 5C8YB 1O58A 3C7TA 2UYOA 1QK4A 1NONA 1RABA 1M9NA 4YIKA 3BE8A 2QSYA 2JI9A 1YNSA 2XNDD 5CIWA 3CRNA 3IEIA 4DWJA 1LS1A 5DRTA 2HLPA 2PK3A 3GCGA 4IHAA 4LBVA 4PPFA 4ESEA 2E4YA 5FLXA 4P0QB 3EQ8A 4Z1MD 4Q0MA 2OBLA 2XQGA 3ROEA 2ERCA 5LXTA 4UBOA 4ENPA 1Z5UA 5EE1A 4KR9A 1FLAA 2ODWA 3KU1A 4NECA 4TMKA 5K3SA 3RAEC 3DTVA 2CMDA 3UXEA 2FLVA 5KBYA 2QRJA 2R8XA 6REQB 4B3GA 5FNVA 3UUWA 3HBAA 3FTCA 5HIKA 5JTUA 1XTTA 4L76A 1QANA 4ZZIA 2OG1A 2GUGA 5HFAA 4QQKA 2PT6A 1M5TA 2IP4A 3UAZA 621PA 3MT8A 3COSA 2D0OB 4Q6BA 3M81A 1UK6A 4TS3A 4QBGB 1E4YA 1WTCA 1LQUA 1UMDB 2A4KA 3AIOA 2IQIA 3WJ1A 3LTNC 1KU0A 2P9CA 3TL6A 2R6DA 3RUDA 3N6VA 1TLLA 3FZGA 3S28A 1CUIA 2WFLB 1P72A 3O1HB 4LDPA 2BPOA 3O3MB 4ND6A 1Y98A 5C7YA 3IC5A 5AW0A 3KTDA 2ATIA 1L4EA 5CT6A 4KHZA 2D2VA 1U28A 4LYYA 3VSCA 2BM8A 4RS4A 1CR1A 1AO0A 4H4DA 1PW5A 1ZHOA 3MUFA 5HQJA 3MPOA 3L7KA 1N1MA 4GG1A 4BZXA 4DLAA 1NRWA 2X2PA 3B3JA 4OGWA 4RM3A 3BA1A 3I1IA 3HVIA 3UMSA 1H42A 3GJ4A 4W8HA 1T5LA 5LA6A 2X1HA 5K2MA 3I42A 1YRBA 4AO7A 5I7WA 1VBNA 2QX9A 2QXTA 1V5GA 4GOXA 1NM5C 2CJXA 3WI7A 2BELA 3B2QA 3D4OA 1YCGA 4TQGA 4EHDA 4GYYA 4M2LA 2UYQA 4K9NA 5K3DA 3IOEA 3INRA 3D6JA 5LZ5A 4QWWA 1R8JA 7AT1A 3HO1A 4D97A 5K01A 2C1ZA 1Q17A 2NSHA 3EXIA 4JWKA 3QLTA 2XHZA 4E2YA 3ASYA 3BC1A 5JZOA 3H9GA 4Q47A 4G23A 4LVNA 4JY7A 3OJWA 3VC7A 2PJRA 1OZGA 1YR1A 5DCWA 4PNZA 1UMBB 3I9LA 2FOIA 3LFHA 3P97A 4JP2A 3KTAB 4XAQA 2QAGC 4C7KA 3VUFA 4ACBA 1XXHE 3Q7PA 4JEUA 4KI0A 3ODPA 1J8DA 4KYIB 1LSSA 2ACEA 2ZRPA 3KVVA 4RETA 2P9TA 4HGQA 5JZBA 2A7XA 4ENTA 1GITA 4OHVA 1B00A 4KQKA 1S2IA 1QF6A 5BN1A 3JPYA 1M33A 3L49A 1F4VA 1B0AA 3H2KA 1T29A 4O59O 4B8WA 4BATA 2OXTA 2RAUA 1RI5A 1PL0A 3IUNA 4K6KA 4LTMA 4PBRA 1QH1B 5H4GA 1KO8A 5CRIA 3W4JA 3CWQA 3MTJA 4GGPA 5MN6A 2ZYWX 3UA3A 4OLAA 1J0DA 2EBFX 3FHTA 4R1NA 1SBYA 3MAJA 3PE4A 1VB3A 2C3PA 2I71A 3TIXB 4CCYA 1V16A 2PE5A 3A2KA 4CMAA 1JR3E 3BB4A 4ZARA 2DQYA 3A58B 3HRHA 1UR5A 2CCKA 2Q6OA 1L9XA 2Z5VA 3OFNA 4YAOA 3U4QB 1UWLA 2IEZA 4O08A 1FVHA 1NN0A 2QLJA 4YVFA 4BMDA 5K45A 4QXMA 4KREA 3WMEA 3RLIA 2I8LA 3NHSA 4LXYA 4RZHA 1LZLA 4LOJA 2JFZA 1NT4A 3N07A 1CY4A 1W94A 1Q3TA 3FPAA 4OHXA 4EK9A 1TCAA 2PXXA 4AYTA 2VG8A 1JNXX 3L07A 4MVJI 4NYJR 4RLSA 4UM7A 4EB6A 5BWNA 3FTFA 4OQXA 1CUWA 4WH0A 4YXFA 2D74A 1SU6A 4E2XA 2ZATA 4Y9TA 3LM8A 5HKBA 5IZCA 1O94D 3CR7A 4DEYA 4PY2A 1L7XA 3GLQA 4OGKA 3ZKAA 5HTOA 2O2HA 5HZKA 2X58A 1BXRB 1NKVA 3AR2A 2EZ8A 1ML3A 4YMGA 2PJUA 2FRXA 2N75A 2XA1A 1E2JA 1FPQA 4CU5A 4NONA 4ZVSA 2R6ZA 2ZUDA 1G8KA 3HGQA 3LO8A 3OMWA 3OLXA 3ANXA 3KJNA 4R16A 2VUHB 3IEPA 5GONF 4JI1B 1SZCA 3AF6A 2VJOA 3ZZTA 1GA6A 2XTAA 1PSDA 4OM7A 1JN0A 3KSMA 2ZRNA 3NT5A 2IYWA 3VH4A 4KU4A 4C87A 4EG7A 2Z3WA 1R12A 3QITA 4S1VA 1YVDA 1J8QA 4JI7B 1BXRA 1QHXA 4EITA 1L5GB 2Q8QA 5F7JA 1MIOB 1K06A 3CBQA 4HLUC 1MVLA 4PS1A 1PT5A 3QFCA 4F1WA 2BI4A 3L8CA 5HNKA 2L2QA 4WVLA 1XHEA 3ORSA 4MB6A 2C20A 3IAEA 3QPBA 1YB1A 1TZBA 4ARAA 1ZUWA 1VP9A 3QF4B 1JYEA 3W8EA 3ST7A 1COZA 1SKAA 1YBAA 4JGGA 4L4ZA 1FDVA 1C41A 1E92A 3G23A 1TF5A 2XE8A 1JTFA 5EJ6A 5KYWA 5CXSA 1K8YB 1NM5A 3GEHA 4M0PA 5B1IA 3KWJA 4G4JA 1RQRA 2AQ8A 4HMOA 3E35A 4MS4A 3RFFA 1ICEA 3TL3A 2C9ZA 5LQDA 1MRNA 2VJLA 2O54A 1ML4A 2H5EA 2P6MA 3ELUA 3IQIX 4EOGA 4ZVTA 1Y4UA 2POCA 1WHTB 2IPMA 2HMWA 2X5JO 3ROKA 2Z2XA 3VR6A 3ZLVA 3M34A 4FMCB 4I08A 5T4EA 2FB9A 1CJCA 3BDIA 2BEVB 3DMYA 3O8NA 3MT9A 1HE8B 3BXGA 4G5OA 3O4FA 2OXIA 4ZYYA 1K0UA 1UKEA 1ORDA 2GK4A 3GJXC 3OM9A 4HH1A 4TS1A 4WBXC 4D56A 4V0MA 4KMMA 1NNLA 2YIDA 2Z3VA 3PD0A 3L92A 4FGLA 5ITWA 2NPIA 4CM3A 2R4TA 5CA1F 1AUQA 2QTTA 3GT3A 5LN1A 2WNIA 4I1RA 2YYYA 3F96A 5AOAA 4INAA 4HDSB 4PSDA 4X1KB 5TXGA 1JFVA 5LMNB 1NBIA 3DSRA 5JVDF 3IBSA 5JROA 3PQCA 4UMFA 1V39A 2HPAA 2V7PA 3A4VA 1HBJA 3T7RA 1IXSB 3BUSA 3OAAD 1V45E 4LHYA 3MYYA 4F21A 1YBMA 5I51A 3S2FA 2YW2A 5TPZD 1V96A 4IXWA 3PNOA 4Q39A 3GCWA 3T5PA 1BWSA 1DJMA 4RJTA 5DI3B 2Q2WA 2WWHA 5DYTA 4B82A 4EH1A 5BN3A 4CM6A 4IGEA 3RIHA 3D0QA 2WD7B 1NNI1 2H9AA 2OP0A 3PNQA 2VA9A 1E9RA 3FBTA 2V45A 2GBLC 3UPUA 3DCNA 1TUBB 1MAHA 4HK4A 4AJ1A 3KUXA 4ONEA 2OYSA 2ZRLA 1I6LA 1G55A 4QPJC 5LUBA 2CNOA 1NDQA 3JWEA 1ZJJA 2DHRA 4WKPA 1KK2A 3INTA 4O25A 3OEHA 5DI3A 4KIUA 1SNYA 2WJWA 1XOIA 3DBIA 5ARBA 4TL9A 4PAMA 4AY6A 1YJAA 3I5XA 2OV6A 1Z3CA 5BV2P 3ROGA 3V8NA 4AWBA 4BQEA 5JV5A 3F5MA 4OMUA 2EJCA 4XM2A 4MQMA 1KU6A 2ZKIA 3MWYW 3QE4A 3PFHA 2WWWA 3BD9A 4IFEA 5JS1A 2CHEA 5TARA 4DV7B 1DXOA 5K20A 4UJ5A 4QHTA 1ZNZA 3L8GA 4HZUA 1A7UA 5CGZA 1TCCA 1W8DA 4IKOA 4LGMA 1D2GA 1QAQA 4XDGA 3W6UA 3CUEF 2I3BA 2HYIC 2YASA 1N5DA 5ECDA 3T7TA 1OWPA 4WCFC 3BYZA 4J9VA 1NYRA 5F2EA 1B26A 3GPDG 1U81A 2PRJA 3MMSA 2QK4A 4QJ4A 5AKKA 3WL5A 4L7QA 3TNYA 1SIWA 3MGAA 4I8DA 4US0R 1JIQA 2FK7A 1R0ZA 1SQSA 2VDQB 5D00A 1X42A 3R7BA 3L8ZA 3QIVA 3D59A 3RROA 3TTXA 2SCUB 3AVYA 2QM8A 5CVCA 2HDHA 2WJIA 1Y8QA 3RUFA 1WCYA 2AA3A 4ED9A 2YZNA 5LMCA 3K6SA 3UWSA 4GOND 4FMDF 2HHAA 5FL7A 2GN2A 1J39A 1R4ZA 3NJ8A 1QZZA 2BCJQ 4ZP1A 3D5QA 2ZRMA 5ICFA 3JSAA 1RZ3A 2P2SA 3OMLA 3RYFB 1NJFA 1P1BA 2XKAA 4QFBA 2Z2KA 3ZDYB 3O1JC 1VA5A 2AK2A 2DR3A 1F1JA 2VRBA 3CURA 3PICA 4XLZA 1USWA 2J1LA 3SHFA 4BO5A 5IG2A 2H16A 4OXNA 1A8HA 4I50B 5DX8A 1N6OA 3G5TA 3HY3A 1FXUA 1HH4A 2HTFA 1YZLA 2D2IA 2ILVA 3TQQA 3F8WA 2Z8ZA 4MKXA 3FDIA 2YV4A 4OQQA 5AHRA 2FWMX 4IMPA 3N7UA 1CQWA 5ELMA 1KERA 4JUIA 3WKAA 3MJHA 2QL5A 2Q21A 4R0VA 5CURA 2ECPA 3D1JA 4RKRA 4KXQA 5G4KA 2KBEA 4ROTA 2BSAA 4I50A 1A96A 3BMOA 3N0VA 4TMFA 1N6RA 1Q3KA 1U1IA 1YVEI 2QPTA 4C07A 3OZEA 4AJOA 4QUHA 2IU0A 3PI7A 5JNSA 3E9QA 4AG6A 3Q7IA 1YJXA 5C18A 3KFVA 4DG9A 4D1YA 1ECCA 3IR7A 2AN5A 1RE0A 2VHTA 2GM9A 3PFWO 4QUDA 3VOSA 4BFCA 2W6JA 4IS2A 2XUQA 3G5AA 4M1TA 2O5EA 2GDJA 3SD7A 3P2YA 2EL7A 4YB8A 3IUYA 3S0JA 1RXCA 3P2JA 2QD4A 2V7QA 1M8PA 2BZ1A 1PG0A 3CFYA 5D3QA 1N2CB 2FFAA 4QTYA 1GL3A 2FMUA 5JJIA 1OPXA 1IY8A 2QIOA 3LHSA 2QZJA 3BIXA 4I99A 4PF1A 1K6XA 3ZD9A 1IY1A 1UJ4A 1TJ4A 1E9AA 1KFBB 2AMVA 1D2EA 3R5HA 3CF6R 2OKGA 1ZU4A 2QTRA 3NUZA 4V0QA 3SLGA 4FTWA 5SYMA 4XARA 4TTSA 1JDJA 4Q7QA 2Z6VA 4Z4FA 2VZEA 4O2AB 1SVMA 3KAPA 3WMFA 4X91A 5D5QA 1EVJA 2X3FA 1E1CB 2IPAB 2CV0A 1KO1A 5BW8A 3HU2A 5LWQA 2O5CA 1F9AA 4OO3A 2C98A 1ULTA 3OE1A 4GEGA 3Q98A 2GK7A 2IW3A 3Q40A 1U2SA 2BHNA 2D1QA 1LF5A 1J2EA 1W25A 1ZD4A 4HB4A 4ZQHA 4DARA 5C81A 2CVZA 1FY2A 1TU4A 2SBTA 2O52A 2VEDA 1AV7A 4LI3X 4MW5A 2I5PO 3JVDA 4QXOA 4X90A 2QBYB 1EK6A 3LQYA 3ZQKA 2LWIA 5F1KA 4B9EA 2H2WA 4X6YA 4YV2A 5CG1A 4OYLA 2W9XA 3KQMA 1LC0A 1A2KC 3EIXA 2OFXA 1CR0A 2B4RO 1XU9A 1E8NA 4WQMA 4AI6A 3V1TC 4E2ZA 1ZM4A 4OXIA 1DJLA 3MNFA 4PLFA 4AKSA 2YHBA 1NBWB 2IKQA 2IXFA 2RK6A 4KR0A 3QBJA 4PQYA 4TQ9A 1U1GA 3S8MA 3RADC 4Z9AA 4RIIA 4BNNA 1D03A 4MUBA 5A2QA 5TE9A 3TBHA 2BUAA 1OXXK 2EX1A 1P5FA 1QQBA 4I1SA 1LSOA 2C7BA 2VKQA 4PC2A 5E0OA 5DDIP 1A9OA 1KI1A 1NVVQ 4O2RA 1PQ4A 4D9BA 3PKIA 2QRZA 2WF9A 5HSGA 5JD6A 1TPZA 2QTFA 2QVXX 1P5ZB 3O7MA 4HUQA 3IRUA 5EZ5A 3IFSA 1EXNA 4HS9A 2FEPA 3UWMA 1CJUC 2GN9A 2HJHA 3RAJA 4WKGA 3BXZA 4U02A 2HO4A 4LBWA 4KYUA 8MHTA 3M9LA 4BNUA 2XXAA 1XZEA 1EWQA 3QKIA 3TYXA 4PEVA 2JH9A 4M4SA 3PFBA 3C15C 1UJ2A 3W5JA 1KZHA 4E5PA 2EKZA 3PYXA 1FNSA 2CZGA 4EG3A 4A8JB 2L0XA 4R83A 3ESRA 1LDMA 2LKDA 4Q37A 4HUJA 4OJTA 4YUZA 3VNUA 4WCFB 1Y6RA 3GBVA 4NZ9A 3ZDAA 3SM9A 2VDPB 4QTZA 2I4IA 3Q11A 4F3KA 1P0CA 2ZT8A 2I6XA 4I14A 2B5WA 3HKBB 2R8RA 4LG1A 3FFAA 7REQA 2JLUA 1JHQA 1C30A 4RPLA 4BE7B 5LZ2A 3I2YX 4C0KA 5ALRA 5K09A 4CM8B 4J7AA 2JFNA 3LL4A 3SDSA 2CXSA 1E94E 1P2UA 5ALLA 2P75A 1Z17A 2DQZA 4QTUB 3U40A 3VPHA 2OGWA 3AR9A 1JR3A 3MD9A 3L41A 1JEOA 1LI4A 1PJBA 1QH8B 1WMDA 4RO0A 1PJ2A 4F4CA 4Z4IA 2ZSUA 2QTLA 5KTNA 2IC5A 3N8GA 2F3QA 2YWBA 1XUOA 2QY6A 2W6ID 4PX5A 4Z99A 2PXCA 1TA0A 1D0SA 3OQHA 4A26A 3B6ZA 5AVUA 4I4LA 4PVCA 3QKRA 5GOZA 1XMPA 2DFNA 1QH8A 2BF4A 1EM8B 3JATA 1XE3A 2C84A 3D0KA 4OL0A 3LCCA 4JLAA 3K0FA 3FGOA 2ODBA 3CW9A 4OA5A 4PPGA 2FH5B 2O3RA 4M7RA 1YKSA 1RJFA 1SPBS 2C97A 2Y1GA 3T4XA 2CXUA 3O8OA 5BURA 3ZDDA 1GZHB 1NMZA 1OX4A 2QE7A 3AIKA 5LOVA 2ZZKA 1CDDA 4GPTA 4D4IA 4EJ2A 1BC5A 4G4IA 421PA 3S8YA 1URPA 3GWZA 1KIMA 3E22B 4X9XA 5HYVA 1ZXXA 3GV0A 3JX9A 3HN7A 5BW5A 6GPBA 1GAQA 2CMGA 1I7SB 1MTZA 1QB7A 1SWWA 3QVMA 2VT6A 4OHKA 5TR9A 1C3JA 2W2LD 3JQ7B 2PS1A 3KZXA 1U5BA 1QK3A 3AEKA 3M82A 4HDCA 4Q6WA 2H2DA 5DX0A 5DOVA 5EJ9A 4NH4A 4A0SA 4B3FX 2V0NA 3COPA 4F3NA 3W5IA 1G3MA 5JXIA 1JV2B 1YI1A 4IZ6A 1OTYA 3W1EA 5IJWA 4HI0E 5MN5A 1ZBQA 4JI2B 2HCTA 3BQ9A 3DO8A 4XIIA 3UA4A 3C8DA 3GZNB 4GZ6A 4JBWA 1R8QA 3W9UA 4AJLA 3SBEA 1XGKA 3QQ5A 1DARA 1SY7A 4QYIA 1G20A 3SX4A 4O63O 4J91A 4AS2A 4YXWD 2IHTA 1DG3A 1OT5A 3CPSA 5JNVA 1QHEA 2I66A 4C2UA 2HA3A 2YW9A 4KL8S 1IJBA 1NJ5A 1UZAA 1QONA 2ZTMA 3IUEA 4IS3A 3U49A 5K0SA 3L0OA 3IPCA 4BVBA 1JAXA 3FYSA 1DBQA 3K92A 4PQGA 1MX3A 1XYVA 2A0KA 3G0BA 3KSDO 1W30A 4UJ3A 3TF5A 5FL7D 3S8EA 3H04A 1XDUA 4IOLA 1PJ3A 5BPHA 3WZMA 4KQIA 1VJRA 4D3XA 5CFQA 3V2HA 2CD7A 2Y76A 2V0GA 1V6SA 1B6TA 1E5XA 3HV0A 2CUZA 3D1LA 1EVZA 1M6HA 1RRPA 4OHYA 3LH5A 3KQWA 4B74A 1PUXA 3FE2A 2AZDA 2J33A 4FIDA 3ZOKA 1E1LA 1GA4A 1X7YA 1UDXA 3AKCA 2O5RA 2O8DB 1YFKA 4RW0A 4ZEOA 2Z2JA 3K1YA 2J85A 3ZY6A 2OFFA 4FDMA 3ESYA 4AS1A 1O5TA 3R9WA 5I8PA 1GPNA 4FEGA 4KQ9A 2JLWA 2DQSA 1E1YA 1LKZA 4CKEA 4M0UA 1PHPA 2DUNA 1JR4A 2F3TA 2OTCA 3QXGA 4FE3A 1THZA 2DH5A 1L8OA 1VFNA 3EGWA 3K72B 3TINA 3H75A 5DN6A 3EBPA 3P2EA 3P0IA 3ZGOA 4IZOA 3OF3A 4K9LA 1K7CA 1LLFA 2X1MA 3C4JA 4BBZA 4DCGA 1PTKA 2CWDA 2JI6A 5EGNA 4XUGB 5B55A 5K4GA 5KTSA 1Z4LA 3G7SA 1RC8A 1Y7IA 3D54D 2EDCA 2ZU0C 3C7CB 1U7WA 3AM1A 4AJKA 2GCEA 2PTHA 5JSHA 1QIHA 3GN1A 4FM9A 2A3NA 3CPJB 3GRYA 4XIGS 5KOJB 5ENDA 2AG5A 7GPBA 1DAOA 1G8PA 1R88A 1YDFA 3LUKA 4DBZA 4LWPA 3V4OA 2AJDA 5TS2A 2PN1A 1SUSA 2B1RA 3FNHA 3KOUA 5DK6A 4D0RA 3WGZA 3H8SA 2A78A 3NHMA 4PCAA 5G4LA 4RQBA 3SJCA 3BX1A 3FYTA 3ZQUA 2ZE5A 1G7RA 1NIPA 4DADA 2OXEA 4N12A 4ECEA 2JNWA 4BO3A 2HADA 5ALXA 2O7QA 4URWR 2UYGA 4P4UA 2AX3A 1CDOA 5EHNA 3SC2B 1W8IA 2J6IA 1REQB 1OXMA 2ZK7A 4UNNA 1PUJA 1OU0A 1W2WB 3Q8WA 4RKQA 3ZI4A 4C5BA 4AKHA 1HMYA 4BFXA 4MA0A 4MQ5A 4PRZA 5CU7A 1UFRA 1DJPA 3ER6A 2RHOA 1SRRA 3GEEA 5AR1A 3GQBB 2H1HA 3S2YA 1Z28A 5DEOA 2QM3A 3OE4A 4GIBA 1GRQA 3H2YA 2HSGA 3I37X 4PIVA 4NVRA 4M22A 1KI8A 4ZI7F 1JEEA 4RUKA 2HQBA 2ZYHA 3HV2A 1GGMA 1T6YA 4GPAA 4U2FA 5LNK6 3OIGA 3W6ZA 3ENKA 1EGHA 2I3GA 4PX3A 4N5LA 1M54A 3LL7A 4PZEA 5AJYA 4B0PA 1L3CA 1C0EA 1O9HA 2QTMA 1XVLA 4YT8A 1VLVA 2WD9A 4NMMA 4LSMA 3UQYS 1JG1A 3DVQX 1FX1A 1HT2E 1KEVA 3M6IA 4L51A 4P4SB 3SZUA 3WK8A 3COJA 3A06A 3PWZA 3VX4A 4MWOA 5FUYA 2EP8A 4H4EA 3FLEA 2WKSA 2OO7A 2HZBA 4TXHA 4L0MA 3V42A 5KNCD 2IPXA 1SWVA 4OU5A 1ISHA 2CUKA 2IYZA 2P2LA 2X0RA 3PJDA 3KYDB 4NHEA 4PO3X 4OBBA 3RSFA 3O9ZA 2AFIE 2FWBA 2J45A 3T4UA 5I9TA 1H6CA 3LF2A 2V8OA 2FZKA 1XMOB 1N36B 3FD8A 1JL3A 3PXBA 2R751 4KO1S 3DLPX 4EGAA 4F84A 4MGYR 4Z6KA 3K3PA 1YR7A 2O05A 3GMDA 3URKA 3VGPA 3PHBE 3R9XA 1P19A 4RF2A 3HM9A 3PGMA 3VA7A 3AUJB 3PXAA 4LECA 1KP9A 4XD2A 5DRYA 4EECA 1Q16A 1ZWLA 1OCEA 1B4DA 1WP9A 2D1FA 1TC1A 2GK6A 2I34A 3AEZA 3CLHA 4WVFA 4D8VA 4D82A 2CJPA 4AMBA 3I62A 3RJTA 2QX7A 1E0KA 1VMEA 3R9XB 4X71A 4YRLA 1CJKC 2ZRQA 3CKMA 3JVUA 4Q4CA 2FQQA 2FWJA 1OWLA 2A0UA 3HM2A 2ASVA 3QELA 4GHWA 4JQOA 4ZVRA 4F2GA 5CVTA 2FF5A 3AHFA 3L8DA 1NW3A 3ICVA 4ZZ3A 3O3NB 5EJIA 3K9WA 4AQDA 4R2XA 3W2GA 1XRSB 1R6UA 3F98A 4X93A 4HEQA 4NS4A 3OIUA 3DF7A 4CTJA 5EMJA 3VKHA 2I67A 1AXGA 2R1TA 1LTKA 2NSYA 4S2UA 4TZTA 5BNFA 3QTLA 1XYGA 4JJ4A 4IICA 1IIBA 3INNA 1PE0A 2UUAB 5T3UA 4C4RA 2P35A 5CNJA 5AMXA 3OI7A 3ADKA 5D84A 4QTXA 2WE7A 2WSSD 3HP1A 3AF4A 2NPFA 1DRUA 4LJ5A 3FWKA 3T52A 3OUZA 4EEXA 4DGSA 2O3SA 5JJCA 2PZKA 4KIJA 3A3PA 3WBKA 3MINA 1K8ZB 2BGMA 4PZ0A 1EI9A 1F60A 3U7GA 3FMVA 1EKXA 4U00A 1XEXB 4UE6A 4BNKA 5A62A 1GU7A 1KVSA 1M1YA 4F97A 1IG0A 4JP8A 2F1JA 1D6MA 2Y1KA 4UHBA 3QSYA 2DR2A 4XIYA 2JAHA 3EH1A 5DBHX 4PBTA 4A03A 1XROA 2VTKA 3H5RA 4K6MA 4DLWA 4HVLA 1NF3A 3Q7SA 1C50A 4U2GA 1UINA 1E79D 5TV2A 1E6MA 1UQTA 3LP8A 1D0IA 2VP2A 3N2EA 4J43A 3GEMA 3OLQA 4JHLA 5CUQA 5EJ2A 3WGOA 5K6AA 5K3EA 3DMTA 3OCZA 5KVAA 2Z2ZA 2Z4SA 4LISA 4BWVA 2VTBA 1NA5A 3RQIA 4NC9A 1SQ5A 1H8EA 3G0OA 4OY3A 1OFTA 2YMPA 4LYJA 4XVQA 5CITA 3C5CA 4C9BA 4POOA 1RJ9A 2R8BA 1Y3FE 1QRTA 1UWVA 4NCXA 4M9QA 4TZ6A 4ALIA 3GO4A 2RGDA 3D7KA 3IELA 3JASB 5E3IA 2XT6A 2JJ2D 2BHSA 3NHJA 4X8HA 3U1TA 1A9TA 5DNWA 3DNMA 3LJKA 2YBDA 3V9AA 2ZUFA 4ARZA 4C0BA 5BQFA 2HK6A 3GNTA 1D4OA 2J5KA 3ZGVA 4YLGA 1SK9A 4OVKA 2ZETA 4MRAA 2XCSB 1J0CA 1EBUA 2RIRA 4LVCA 4CIDA 4DLZA 3QLEA 2RGEA 3LLCA 3HCCA 3T3GA 1CUUA 3VPCA 4IHJA 2FSSA 2P6RA 1QAMA 5AM5A 4AZ0B 2DP4E 4MIEA 3AY0A 3W8DA 3AIIA 1ZD9A 5JW6A 3U16A 2PIDA 3ER9A 3AETA 2OQ2A 2G1KA 2ORED 4RC9A 2ZUWA 4JK3A 3CZMA 4B3BA 5E4YA 2X1VA 4EELA 2GHQA 2AD1A 2FCRA 2BFNA 2ZVPX 4M36A 2DOKA 5DVZA 2ZUTA 2L17A 3RO7A 3A9RA 4QAJA 4FGKA 5B30A 3WGTA 3GEBA 4J4HA 3TVDA 4DBLE 5EJGA 5HBGA 1X7ZA 1QTIA 4PWYA 5IF3A 2FF7A 2OLEA 4UNSA 3AFNA 4BVGA 1P80A 1B7GO 1VE9A 5TMEA 3FFWA 2YVQA 4X45A 2W4QA 4JIGA 4FFRA 4NV3A 4DJEC 3I3SR 1RCUA 4HMQA 4IIFA 4YCJA 1TGYA 2VPXA 3A70A 3GRVA 3L6CA 4FFLA 2OMEA 2G80A 3JYNA 3LCMA 1C3OA 2Z8XA 1NF2A 2MU1A 3HJTA 1O03A 1NFFA 2JJMA 3HCFA 3IOYA 1UDRA 2YVLA 4WZBA 2AXEA 1ZVQA 3GZTB 1SURA 4ND1A 1MO2A 4BLRA 2XHEA 4ENVA 3GXOA 1EBFA 1ZM2A 2GQ0A 3O91A 2H8GA 3A4MA 1R0YA 1V5FA 2CF6A 2EFDB 1ZISA 3G9QA 4G1CA 3GVCA 4Q9HA 3EZ7A 1GYPA 4U7JA 3STUA 3GYGA 1IFXA 4R2WA 5CVDA 3NPAA 4DA0A 2C7GA 1W5FA 2PUWA 2VUIB 2YZ7A 2WHPA 4OIFA 3WSTA 2PZEA 1FFSA 3UEOA 3AUKA 2W6QA 1E9EA 3OEHD 4D4HA 3P2KA 1OI4A 1FBNA 1BMDA 3GNLA 1W1UA 4OF4A 3SXJA 3KUDA 3CU5A 1M1NA 2ZAGA 4NYIR 4RZIA 3LUBA 3DAYA 3M83A 4YO7A 4TT3A 4Q18A 3RRMA 3TK1A 5HRUA 4EPVA 1RYBA 4BLOA 5BVHA 1I4OA 1P8JA 2Q8PA 1Z16A 3AHGA 5FOSA 3ZWVA 5KMGA 1W35A 4KKXB 4G2NA 4TN1A 2G71A 3FJ1A 3WMWA 3VVMA 3WGGA 2HK9A 3D4BA 1TO2E 5DWQA 3K4QA 1UAGA 2COEA 3ITKA 5EXTA 5B58C 3QX7A 5DW0A 3FWHA 2OAP1 3PDWA 4ZICA 1YBHA 4ZYUA 1GKIA 4L50A 1IQRA 1NHWA 3IOBA 3ES9A 4Y9RA 4U7WA 1M8GA 2BL4A 3G2LA 1H9AA 4RIHA 3BORA 4RZSA 1EWVA 4N3BA 4BVLA 5CCEA 1VLLA 2GF9A 1XTKA 4IW3B 3IIJA 3TPFA 1D2CA 2KQUA 2QMQA 3RWBA 3PITA 4R01A 3UANA 1C8BA 3ZWYA 1KJIA 1CU1A 3LQRA 3Q9NA 2HA4A 3CSUA 1N6NA 4X24A 1JHPA 4ZHQB 2NMVA 2CLIB 3H87A 4P80A 3ZUGA 4Q1DA 3NATA 4BO9A 4FE7A 4LZOA 1DEOA 3MGCA 2QR5A 3FTQA 2R5WA 4GL2A 3LQ1A 3VMFA 2BY4A 1CE8A 2GRJA 2PR2A 2YQZA 3AZQA 4C3OB 1G8MA 4URVR 3AY7A 4RJKA 2AEJA 3OH8A 2GM3A 2OO5C 3QOXA 5ICSA 3MCVA 1FFHA 1WL8A 2I2XB 2JIMA 2NG1A 4LWOA 1DBPA 1MB2A 1LDEA 1S89A 2A8YA 2P2ZA 2VAWA 2XQVA 1Q2XA 4RY2A 2PH3A 4M1EA 4KR7A 2W8BA 1YI0A 3DEHA 2O5VA 2HSDA 3BXHA 2WD7A 1C14A 4P93A 4QDXA 4E33A 4H35A 4WX2B 3SKXA 3H5WA 2JK1A 2VR1A 4D2IA 4KLNA 3SGLA 1SZJG 1DBWA 4N3GA 3NANA 2IXTA 1IXZA 5DGTA 5IAAA 1FP1D 1LU9A 4MR9A 4RLHA 2G9RA 4MROA 1P0IA 3G2JA 3KOYA 5L3QB 4W5QA 3ZXUB 2W22A 3OMXA 5B1EA 1UWKA 2GD6A 1EGVB 5JNRA 3UB4A 2BEUA 5J4KA 4PHCA 5TLSA 3KQHA 1GN8A 2VWGA 2EJBA 1E99A 3QXHA 2XADA 1ODCA 3H3FA 4Q82A 1X1SA 3PB3A 2FN4A 2QPAA 5A0FA 2FTKE 5B3JC 2NO9A 4B46A 1ZD1A 2HNBA 1FMLA 3GVIA 1DJOA 4NNPA 3D7LA 4MRRA 1TFRA 4P36A 3U7RA 2PXAA 2WQZA 4E5UA 4ER3A 1YA6A 1E3TA 2N46A 3OZTA 1OLXB 4BN5A 4I46A 5IKXA 4RLFA 4QO7A 3QJYA 2HMTA 4MA4A 2CMHA 3L7NA 2DUUA 5BSUA 5A1JA 5CA1A 2EP7A 4OKNA 1EIZA 1P18A 1Q92A 4F8EA 2QD1A 4P54A 3Q8LA 2VJKA 1XV5A 5DWVA 3DAPA 2OO5A 1JFFB 4BJ1A 4FB4A 1CRPA 1O5OA 1PI3A 3UGTA 1GZ3A 2NV0A 3HCBA 1KR2A 5DPMA 5EKTA 3LVRE 1GCGA 2H07A 2PV7A 2R1VB 4ZCSA 5HVNA 1KJWA 2YY6A 3QRWA 3VPAA 3FVQA 2RC6A 1ZGCA 2OOKA 2O19A 3O4GA 3MAGA 5M2QA 3DOFA 4QO8A 3V2UA 2ORIA 1G7CA 5JI3E 2OHGA 2XF8A 5ITZB 2O59A 1MNAA 3A1WA 4HFNA 4N3CA 3QW2A 3WQQA 5L4NA 1JFFA 3H65A 5MDHA 1Y9DA 2FY8A 4EY3A 5DP1A 4KPFC 3FVRA 2B5OA 3L0YA 4P32A 3D81A 4FSHA 2JAXA 3SY8A 3I58A 3IDFA 1XTIA 5GV8A 2WU8A 3K8QA 2FW0A 2J5XA 2QTHA 5C5DA 5FBKA 4QUKA 2X19A 2YNMA 3AUXA 1FYFA 3RODA 1IDOA 4AZ3B 1SXJA 1F5SA 1UXGA 2ZE8A 3TPCA 2NZJA 2Y1FA 3OLZA 3PDIA 4CMHA 2PUJA 1ST2A 1IULA 2QVYX 1KEWA 3D7SA 3U1VA 3WMRA 1AC5A 1HYHA 1V7ZA 3ORRA 1F8UA 4HAOA 4M60A 4ZO9A 2F4VB 1LQ2A 1JG7A 3ITEA 2W83A 2COKA 4RX1A 3G2OA 1KAHA 4N54A 1L1QA 4LIPD 4LNHA 2ZREA 5EKXA 3OLVA 4KK4A 3IIMA 3RBZA 3O1IC 3B2NA 1OWNA 1ULHA 4FNMA 5J2TA 2C5EA 4BP9A 2VQFB 2ZYRA 3A1UA 4Q01A 4NK4A 4V03A 3VYUB 3QP9A 3UCFA 2PRSA 4RIGA 3DV9A 3CCFA 1E3SA 3LSYA 4YJHA 5DHPA 1M5UA 4L5JA 3MRXA 1NYLA 2RDMA 1NW9B 3ADPA 4TROA 4YJ3A 5F52A 3VQTA 4CMBA 3AHDA 3ESAA 4C3ZA 3NDJA 4HGRA 3M4NA 2OPBA 4PYNA 1YR9A 3H2JA 3SVLA 1PSZA 2UUOA 4RAQA 1P9RA 2NU9B 4F6LA 2R5NA 1SMKA 2QV0A 2VWHA 5I8ZA 5AJZA 4TSFD 4BKRA 2XGGA 3CT4A 1HRDA 3IO3A 3W3AH 3HGMA 4D43A 4DJTA 5IUJC 1PWYE 5KWJA 2GYUA 5LP6A 3ZDBA 2QRHA 3UMFA 1NOJA 1MGOA 1C4WA 3IAHA 2V5UA 1H05A 3AKEA 1VE5A 3HLYA 3VYRB 3UW1A 1NI3A 1D5CA 2OENG 1AN0A 2EQ5A 4CEJA 5GJCA 1Z4MA 2Y0DA 1GNPA 4JNKA 4Q9KA 2GXQA 1KY3A 4DXHA 4A0RA 4ZDJA 3QTBA 4O4IA 2WJ3A 4N0EA 2C8LA 4XGNA 2AC2A 2OBXA 5FOVA 3GLSA 4IJVA 1GJRA 3W5SA 4YIHA 1Y6ZA 1KP3A 1Y82A 2PX8A 1L3BA 3AC0A 3OX3A 4MXDA 4I4CA 5K8LA 2YR0A 2JVIA 3GG9A 2NU6B 4YMIA 2CHGA 2F59A 2F90A 4KCGA 4W5OA 4Y2GA 1ADJA 4NE2A 1EZ1A 2F9MA 4U4AA 5K3OA 1J23A 1RRGA 2NYAA 2W43A 2B61A 1QG6A 4PC6A 5JCOA 4ZIRA 5GM1A 1ZIXA 4QAQA 4Y6RA 2CLKB 2AZXA 1W1WA 1OIVA 2VI5A 1RWPA 2L18A 4OREX 3N05A 2CLMB 2OORC 2NU6A 3IMGA 4FFOA 5EPUA 3GLGB 1PEDA 4IIGA 3VBCA 1D6NA 3M33A 1VPLA 4R9SA 1W4CA 1Y8CA 1OHHD 1ZGZA 3PSAA 4O2BF 3V4FA 3K4PA 3QPCA 3JWIA 4N8SA 1BN7A 2KW5A 2J9FB 2OAEA 2Q0SA 1SULA 2YWCA 4U8GA 2AFVA 4TRMA 5AVZA 5K6AC 4RE5A 5KS2A 2FETA 3EH2A 4MRMA 5FAXA 5IJAA 3GLGA 1UH5A 5AM2A 1PJ8A 2DTEA 2C4NA 3V4ZA 1FNMA 5JC1A 3Q6MA 4JB2A 4OQLA 4L8GA 3S3TA 9ATCA 1JPVA 5HUHA 2N1MA 1Y6QA 2XVMA 3NRCA 5JAIA 1R15A 2YWRA 2A1UB 3O38A 4JLDA 3GJ5A 4C03A 4O33A 3I53A 3L7MA 2I2WA 4UUNA 2CNWA 2WAXA 4X7PA 1QXSA 5ADUS 4AJHA 4NNJA 5REQB 4JITA 1JHDA 1JYFA 2JIPA 4JFRA 1CQPA 5LQAA 2C57A 2IHUA 3TZKA 1BKSB 1DBVO 3DV2A 1DFHA 3N3BC 4G5FA 4D0GA 3BQMB 3TR0A 4O3MA 1JLMA 3R44A 3ME5A 1XRPA 2ZBFA 2AD5A 3FXAA 4KDRA 4MYTA 4URZR 3HFRA 2AEMA 3E9CA 4E09A 1MNQA 2V7QD 1Y3CE 1L6RA 4KO8A 4EVSA 2OCKA 5KTRA 1Z4OA 3V8EA 3L8EA 1GLGA 3RTGA 3I04A 1NI4A 3QJ5A 4J0IA 5JVDB 2WJAA 3LUJA 4M53A 5I47A 4GP7A 2C00A 2FG6C 1QZTA 1DO0A 2O20A 2Y1LA 1OVMA 3NHRA 4Q66C 5IBQA 2WAOA 4FSDA 2JGDA 5HK9A 1PWHA 1A5BB 1VCIA 4Q7JB 5FEMA 2VJNA 1MABB 2BGIA 2WJGA 3C6ZA 3HO8A 2XX3A 2H2IA 3OO0A 3BFKA 3P2OA 4UUMA 3WWPA 1ECBA 2GZDA 2DBZA 4TS4A 4BN0A 3DHWC 1FJ2A 2Y77A 1LH0A 2DPHA 4FONA 4FWTA 3KE8A 2WJVA 1CY0A 5HXAA 2ZUEA 1L8XA 6REQA 4JAVC 2C3YA 2Q41A 2G08A 3ZKWB 4F93B 1H6DA 2C88A 3B7PA 1H5NA 4NOMA 3DV0A 2DTXA 3L06A 3QI2A 5IANA 4MO2A 2NIPA 3ZIAA 4PLPA 3R6DA 3TGPA 3JWHA 2ETVA 1UIRA 2MYPA 1AQIA 1QF7A 1WUIS 3P9IA 4UCFA 521PA 3ZK7A 3OECA 2W48A 2ZGVA 1TLTA 2PBFA 1YU9A 4JLJA 1XXHB 1L1EA 1DAFA 3TOCA 1QRRA 5BV0A 1NVWQ 1X1DA 3UJBA 1OLUB 4WOCA 4C0AC 1L4BA 2FUG6 1S8NA 2WV9A 3KOWA 2IEIA 2JIZD 1W1IA 3B7GA 5K0GA 2O8FA 4NCKA 3A2NA 4RDHA 4DZTA 1DCFA 1J21A 3DH0A 4ND8B 4TWRA 5FWYB 4YAKA 1WF6A 4RBNA 2FJ0A 2XLBA 5DF1A 3QWBA 4HOYA 2ZJ3A 3BCUA 5F73A 2QG9A 2W2PA 4BQIA 4QPNA 4FHZA 2BGRA 5EC8A 1LZKA 4NLLA 2QTCA 2IYFA 1F17A 2VDRB 2XWSA 2VBGA 1GZSA 3MJTA 2RAVA 5JSZA 2PQ0A 4I9GA 6Q21A 3SHQA 2FFJA 4B47A 1R00A 1ZCJA 1WMFA 1LA2A 1PR9A 2G7MC 4DJDC 3D7NA 5JYCA 1N75A 1BMFD 3AJ8A 3L7OA 4WIAA 1YB5A 4ZMSA 4FOPA 1HEYA 2ZSIA 3CBGA 3K30A 4DVGA 5CDFE 4CZ2A 1JG6A 5JH7F 3W6OA 2DM6A 3DXFA 3AJAA 3EZGA 3HHPA 3I01M 4Q21A 3VKWA 3SIWA 3L2OB 1LGYA 1ORWA 4FKMA 4UFPA 1O8BA 2F62A 2QY9A 2REQB 2R1ZA 1ZX1A 1WRBA 2VNHA 4NZMA 5CX1A 5EINA 7ABPA 1P1HA 2EQBA 2UVQA 1O95A 3QPWA 3IPLA 2XZOA 3DHVA 2FW7A 1CZNA 3FOCA 1L6IA 3KVYA 4WXHA 3UWDA 1EP2B 1THGA 1EAYA 3FR7A 4DSAA 2VUTA 5K03A 2AJBA 3MBIA 4AJPA 4F7WA 1TJ5A 2DGDA 5IM4A 1FTYA 4JEIA 1TCUA 1ZI8A 1R4NA 2O3TA 1KSHA 1U0NA 4RA9A 4CKEB 3D6NB 3OP1A 3GWGA 3T3IA 2JKZA 2BBWA 3ND6A 4FHCA 4D7AA 1VKOA 1RYEA 1YQ9A 3C5WP 5CJPA 3EAFA 5AKYA 5IVDA 1A5ZA 1RIFA 3TOXA 2ZU6A 4S2EA 1BYUA 1ZH6A 3C3CA 2AOWA 3E9NA 3KLMX 2P41A 4DV4B 1IPHA 3AIMA 4KQHA 6AT1A 2YXPX 1Z26A 3MRTA 4E30A 3MTEA 1XEAA 2AVDA 4HH4A 3S2EA 1TMGE 2OVFA 3EISA 4WHMA 4DIDA 1NZJA 3GVPA 2GS9A 5EEGA 5C9ZA 1BFKA 1Q7EA 3LE8A 2OOSA 1HG0A 1ZK1A 3A3OA 4FI3F 3DA8A 2IOFK 1RW4A 2R8PA 1EQ2A 2QN7A 1GIAA 1V4BA 3AZOA 4GLBA 4YS6A 5FR1A 3AF1A 1O0SA 3W90A 4F60A 5BSEA 3EGXA 2WWYA 1B23P 3N8NA 4ZMBA 1N2HA 3O9VA 4X54A 3JYOA 4ZYWA 1QNFA 4LF5B 1QP4A 5JLJA 3PHLA 3TLMA 5JNTA 3V2IA 3U5ZB 3NNDA 2EHJA 1UPBA 3JQGB 4XIJA 3EFHA 3EZ2A 3LYAA 3JQBC 4MAMA 5CT5A 5E2BA 5JPCA 3RV4A 3OCVA 2X0DA 2XLCA 1E2GA 4RDIA 1TTHA 4KXUA 3RAGA 1Z45A 4KV9A 4LHVA 3HB9A 3A6KA 5ALTA 4ZAFA 3LUDA 2ZWAA 2G0TA 4HVAA 2QX4A 3ZWMA 3UBTA 5KB3A 2HPVA 3QU4A 3B7WA 3O73A 3CTPA 4YAEA 4G36A 1FTGA 4O4JA 3CX8A 1FP2A 1P0MA 2VYVA 5CW2A 5IC5A 4DDUA 4KX3A 5BMVA 1O95C 3ORQA 1I51A 1M0EA 1SOVA 5AICA 1ISJA 1GXSA 4OBEA 1J2TA 1J24A 2QVBA 4MMXB 1DDGA 1X87A 4KJXA 4M0FA 5FKJA 1N3IA 4PINA 1NVAA 4A0QA 3E5NA 2QQ5A 3ETHA 3T54A 4BQPA 1IATA 2WLSA 4E5SA 3CONA 3E3AA 2F4NA 3CTMA 3WJ2A 5EZYA 4BO0A 1Y4SA 1OF1A 5DK4A 2W00A 4LX0A 2KM1A 3LKVA 1EM6A 3RU3A 1E6KA 3IKJA 4IMIB 1XRMA 1RYZA 5ALVA 3FNGA 4KG7A 1WIWA 4MUJA 4P0TA 1ABBA 5A0VA 1IMJA 5BY2A 2C2YA 4BNLA 3DDNA 2CZCA 3X43A 3CLKA 1JDTA 5C31A 4A4DA 3DO5A 4RH0A 2ZTLA 5KQGA 1JTVA 2QL7A 1TTTA 3RWOA 2AX4A 1R6VA 1TFUA 2NUTB 2RGUA 4HGPA 1E5TA 1M2OA 3RFTA 3TCXB 3LF1A 1H66A 3C43A 3I6IA 4G56A 3VKFA 1S4MA 2UV8A 3H4VA 5ERXA 1I4WA 3NVAA 4P4NA 1P33A 5CVEA 2P6PA 3CXRA 5FV4A 4WN3A 1PGJA 3D2CA 5GIPE 2VJQA 1AK1A 4P3OA 2H52A 2Q4BA 4H7FA 4L9SA 1PDWA 2WUVA 1YSCA 1V8BA 4P4GA 1AVTA 3EXEA 1XVAA 1GGHA 1QIIA 2GRUA 3B2EA 3IE2A 3FGZA 4GW3A 2II6A 5BQ5A 1ESDA 4PSKA 5EJ7A 2VK8A 1FFWA 1Y34E 2BTQB 5T8KA 3ZJVA 3L77A 1G2PA 3URMA 1F4LA 1N6HA 1P45A 4HWKA 5KOHB 4INZA 1ZRHA 3FOAA 3NVMB 2ORWA 3EPHA 5KNBH 2C0PA 2C5LA 3H5NA 5HKAA 4E11A 2F1KA 3O8QB 4DR6B 1U2GA 2QRPA 2FR8A 4FI3C 5FOXA 2HIMA 1B8UA 3PIDA 3ZWDA 3BDVA 2WKWA 1KJQA 1KSGA 4CV1A 4ZDWA 4LXUA 3S29A 1SQ6A 4L73A 4EGQA 5FA5A 2HV9A 5DH9A 2HNAA 4L4RA 1UAAA 2MMGA 2WTNA 2BHRA 1BFUA 1GCAA 5BPFA 4TXNA 2B4TO 3KJEA 2J07A 4WSOA 2V7XA 3V97A 2XXBA 2AKAB 3WGQA 4C7XA 4DA7A 2PRKA 5KNBA 2C59A 2X1LA 3T5BA 1FMJA 3DM5A 3EZ6A 1FSSA 3NWPA 4Z1MA 2JLRA 2VNSA 1PWEA 4B6PA 1M75A 1U3VA 1A71A 3T3NA 3LWDA 4O2BB 4YRSA 4DA4A 2PKCA 2WF8A 4QOFA 1H2ZA 3EOZA 5AUQA 3UMVA 3ECAA 5F2OA 3WLIA 3SXPA 5BORA 5ITVA 1LF0A 1W46A 3W7BA 4LDJA 4P7FA 4JP3A 2J87A 3LWNA 1QFZA 3WGHA 1RAAA 4LZWA 4XB1A 1U8UA 2J5BA 3K9LA 1QB8A 1YD7A 2J9RA 3I9JA 1N9ZA 1WCIB 1XHLA 1ZD3A 2IYRA 3PX3A 2QUZA 3Q41A 4QDOA 2V6MA 3GELA 3A1VA 1F51E 4LOHA 2QIPA 3FDZA 2PD4A 5KAMA 4FD2A 1E5VA 2ZBPA 2G5PA 3P26A 3NEPX 5IM4F 2JD1A 5CJJA 3GLTA 2A58A 2NU7B 1XDSA 5HIIA 3RS3A 4QYSA 4RXTA 4KQGA 4B4UA 4JDPA 4FDLA 2AQHA 4A91A 5KSYA 1E2MA 1H93A 1KYZA 1S1MA 2V9PA 1Y5IA 4UOZA 5KCZA 3MSXA 3PZRA 1T2AA 2BMJA 2GA9A 3PXGA 1XD2A 3BPSA 1WDTA 4L78A 2I9PA 3HZOA 2VH5R 1ZA2A 3E82A 1BGVA 3LRXA 3DMRA 1MT0A 3AW9A 4EJSB 2VXYA 3RSGA 2DFPA 1UFVA 4ZV7A 2XEXA 3DMFA 3CF4G 4IV0A 3Q7QA 2Y93A 3UGJA 2RAFA 3A6JA 2CFSA 3RU7A 1EFRD 4UPDA 3GFRA 2HR1A 5HWSA 2HREA 2YIMA 2ZJ4A 4XDHA 5FOTA 3RCBA 1YVPA 4H6PA 2Y0CA 4WINA 5F33A 3TAHA 4FGZA 2ZYVX 1ESCA 3BKXA 3T7CA 1CY7A 3VOTA 3ZHUA 1MC8A 5BW6B 2DB3A 4Q1FA 2CL7X 3MJCA 1V2GA 2HIAA 1OFVA 1E4VA 2ZR8A 4NDZA 3E9RA 4QATA 4BVKA 4K9DA 2C42A 4KITB 4OK5A 3LWZA 1B16A 1T5OA 4D4KA 2QTZA 4AECA 1T1SA 2CCGA 2CL5A 3T3HA 5ED0A 1AKMA 2HJGA 2JI8A 3IKLA 5EVCA 5EYPB 3EIUA 3WWDA 1PJZA 1LI7A 2Q5FA 5I7FA 5KJCA 1FQJA 2EFJA 1V2HE 2ZJFA 3LT2A 1HTWA 1U3GA 4ID3A 5D6OA 3QMWA 1VGVA 2WM3A 4GKBA 4YYZA 3ND8A 3UMMA 4N5DA 3GLHB 1OLSB 4R8MA 1UJCA 3DW3X 3G6WA 2VRNA 3L7JA 1ZRNA 1EK0A 3OE7D 3WLOA 3FKSA 2H1OA 2F3SA 3IS3A 1DKOA 3BMOB 2IEYA 2BFPA 2YJ4A 1IZ0A 1SHZA 4RU1A 4X7BA 4FN4A 5COAA 2EZTA 5L45A 1LDNA 4BO1A 4INOA 3DT6A 4PZYA 4ABTA 5FPPA 3VSDA 3OCWA 2J0UA 3EZLA 3MBOA 4B44A 1L1FA 4AZTA 3EQ9A 1BHQ1 2ID4A 4QJBA 1TVMA 1QO7A 5THXA 2Y1EA 5L8VA 3AMVA 1YRQA 2P69A 4MVJA 3HDGA 5D3MB 3BERA 2HRRA 3HJRA 4ZVVA 3B89A 3V4VB 3EWSA 3ND5A 3WJAA 3WZ2A 1SHUX 3MQ2A 1S5PA 1T36B 1TEXA 1UKAA 3C3EA 4DYVA 2C1EA 2QVCA 1DIBA 4GMFA 5EAIA 4D92A 3DS8A 1IZZA 4DT1A 3RYCA 4YCNA 3FMOB 2LR0A 2CXRA 2G63A 3MC1A 4UCXA 5LQSA 2DRIA 2N3ZA 1XWFA 4NBSA 1FFEA 2ECQA 1TK3A 2P6OA 3NJ4A 4OFZA 4R68A 1WOMA 1YJBA 2DLDA 4JL8A 5DU2A 4O4LB 3OETA 5K8VA 1BE6A 5TPWA 4BKUA 3U44A 1NLMA 3P5BA 1A27A 2AB0A 1KVRA 2L69A 1MX5A 2OGTA 1PR1A 4FNAA 1T9GR 3N2IA 5EUBA 3B48A 1C1YA 2NQ2C 3GIWA 5C34B 2H5LA 1V7PC 2DKOA 2UYHA 1GRRA 2Y4NA 4KQEA 1MT3A 3NOVA 4YAWA 1ECPA 2WYUA 4P6VF 2ZR0A 1E4EB 2GTPA 2J9ZB 2DBYA 2OAQ1 1X86B 3HO6A 3N2KB 5LYJB 1RZRA 4XPIB 4TUYB 1KJ8A 1P8AA 2O48X 4EKYA 2IWHA 1K6EA 1V3VA 1G16A 3DDSA 2O3JA 4YJDA 1CZLA 1R66A 3HB4X 4CFSA 1RMYA 4I9NA 1JQKA 5IBCA 2AXQA 2Y05A 2Q6KA 4E2FA 1OXBB 5B6IA 1I2AA 4BQFA 1KYXA 2RGRA 4P82A 1QYCA 3UF0A 4V0NA 4OMDA 5BUCA 3F6CA 4X8LA 5CW1A 4QOSA 3L7IA 4ILKA 1XJCA 3SBOA 2XQFA 3HCRA 5AVKA 2YHSA 2QJFA 4QLBA 2BBOA 3H2ZA 4N9WA 5BXQC 5HRCA 1S01A 4PONA 1HNWB 1LV8A 5CX4A 1GQRA 5DCLA 2G4LA 3BHIA 2FX3A 3KPUA 3KOOA 4Z9BA 1UADA 3RTAA 3U6KA 4MP8A 2IRWA 3CKKA 3FZYA 4URXR 3DB2A 2YXNA 1ARZA 3F6YA 3OIVA 4B33A 2OYRA 5JZMA 4MYDA 4DZRA 3EZYA 3KXDA 4YRIA 1ZJ5A 2R62A 4HUQB 1P2GA 2J3EA 3LYUA 3P0RA 3WYFA 4ND3A 3L0ZA 1G9SA 4NNOA 1T2VA 1YQTA 1ISSA 2EZ9A 1YCFA 3HRIA 3QKSA 3UK6A 1MU0A 1V7QA 2RGYA 3IXQA 4KFSA 4XCXA 4DNPA 5B4TA 1LSJA 3CZ5A 3DZHA 4KVFA 3X2FA 5DX1A 4CKCA 3BGVA 1Y1PA 1C2YA 4KIGA 1NP7A 2QLMA 4EZBA 4DG8A 2E4WA 4IWNA 4J75A 1DG1G 3ZDZB 2OYCA 1WXFA 1UM8A 3V4LA 1VXRA 1GDDA 1WQ3A 3E3OA 3K0AB 5EWLA 1SU8A 1QZ3A 2H1LA 3B82A 5IK2D 1BDHA 1ZN8A 1AF4A 3PTZA 4ON9A 3THWA 4EPXA 1ZKMA 4JZYA 1ISMA 3OZXA 3QH4A 4YN3A 3IHTA 5LJLA 1UT5A 3FYUA 3UENA 1DDOA 3HBNA 4NYMR 3U4IA 2OP1A 2RGNA 2V4MA 2GILA 2ZBUA 1EDEA 4ZO8A 5C80A 5AO9A 1GEGA 2WPDD 2GD0A 1NP3A 3VDNB 4D42A 1WSAA 2J8ZA 1Y33E 2FPIB 4IJUA 2C61A 4RPGA 3RG2A 1PKEA 2PMDA 3WDMA 3K71B 3ZBTA 1DZ3A 1K75A 1W0JD 3JASA 3UTCA 5LOVB 4CLHA 2IHYA 2JIBA 1ZLYA 3BK7A 4N0MA 1L4GA 4YJGB 4NENB 5LMUB 1EFDN 1T2NA 3W34A 2PSDA 2VJDA 3B3QA 1B8OA 4LMRA 1HEUA 3CNLA 1ZA1A 4FXPA 1QHSA 2X8LA 1PSWA 2FPIA 3I83A 5EIBC 2HRDA 4RHUA 4U39A 2I3ZA 5AKGA 2VSOA 2CEKA 3M5DA 1CKEA 3DYIA 2G0AA 2DKFA 1KI6B 1W76A 3KQSA 3MLEA 3ONWA 4QBTA 4RKEA 5EHXA 1OA1A 3CE6A 4HY3A 1Y6JA 4K8OA 1ACMA 4L7VA 4EQZA 4GSLA 1Y7LA 2EFGA 3MQ4A 3CLRC 4LE0A 4LZNA 1FA9A 3DBVO 2ZSKA 1UKYA 4C4PA 4G0PA 4YRMA 4O8CA 4GFDA 1FFCA 3ZLJA 4XSHA 4EYEA 1E6UA 5D01A 5EZQA 2X13A 5BOSA 1IVYA 1GZVA 2FR8C 3O8OB 4EA8A 1ZL2A 2PT9A 2W2XA 2FQWA 1N4DA 2OQVA 3WLAA 1JWBB 4EGSA 2G9ZA 1Z8DA 1M34E 2J3LA 3AHCA 4K05A 4M1WA 4RIEA 5CAEB 2QTAA 1I3KA 5KREA 2ORVA 2EZ4A 5CEJA 3WDLA 5AI5A 3OFSA 3QPDA 3NUGA 4M1YA 3WL7A 3GFTA 4QT0A 1N7HA 1FDUA 2GAFA 1VRCA 3PVSA 3GCDA 4GXNA 3WVNA 4AP5A 1W73A 1IEQA 5JDCC 3KB6A 1M74A 4P4LA 5B2FA 1MP0A 2EP5A 1T26A 2PD3A 2NVUB 3GJRA 5AFSA 4TS9A 3CS3A 1O4WA 4L85A 4I3HA 5HCIA 3K4HA 3ZH9B 1A5AB 2O0LA 2IZ5A 2JB9A 5KU1A 1DHTA 2XMRA 3D3WA 3HR4A 2GZ2A 2XUJA 2PTGA 2ZAOA 2ZSJA 1CWUA 1AT1A 3EMKA 3DLHA 4GBMA 1QFXA 4FE4A 5IZ4A 2Y0PA 4GQBA 1PR3A 2D0PB 1ZN9A 2PHZA 4G86A 3CVYA 3GJYA 3AFMA 4IXDA 1V9LA 4ADSG 1VTKA 4DABA 2R4UA 1Z08A 2G17A 1TM7E 2PS0A 3LT1A 3KBOA 5JZ9A 4L8VA 4LYAA 4RCYA 1W36D 4QUGA 4LV5B 4K9PA 3KQQA 3P2MA 4LYHA 5TQ2B 1CQJA 1DDIA 2BAGA 3LY9A 4Y98A 3K5HA 2RI1A 1YQWA 3Q3IA 2Q9AA 4YMLA 1PEKE 1Y1RA 4ZAVA 2UXBB 1G19A 1FTSA 4K9OA 2JRLA 2MSEB 5AH0A 2C95A 4Q3DA 1KORA 3EJ6A 2FPMA 4N5HX 4UXIA 3UG6A 4FBGA 4AYWA 1ECJA 2Q1SA 4GT1A 1H0KA 1BDJA 1C7EA 2QJTA 3FB4A 4WXRA 2X4IA 1RXVA 7MHTA 4TL8A 3T4EA 4XJXA 4IRMA 1P3DA 3IAAA 2H1VA 1U2PA 4UDOA 2DHQA 5CEEA 2DHEA 1I4LD 3MWDB 1STOA 5C4GB 3R5JA 1MJFA 1SXJC 4KO3S 1C0LA 3K2QA 4R8SA 3DAHA 4POAA 4PGFA 1SZDA 1NJSA 4MRPA 4FJ2A 4ZC1A 4D9FA 3KR1A 1HX7A 3OJEA 2YFYA 3OOJA 4ZVOA 4LXQA 1YB4A 1NIJA 3LIPA 3SFVA 3D8UA 4DR7B 3LPNA 1QE3A 1N2IA 4RMJA 1GVHA 1IBSA 1O77A 1YQGA 2AG6A 3LS2A 5DBFA 5E1BA 5CDGA 4NFSA 5J4VA 3U3ZA 3WNZA 1UJ6A