5IUNC

Crystal structure of the desk-desr complex in the phosphatase state
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
131
structure length
131
Chain Sequence
SMISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQPDVCIMDIEMPGKTGLEAAEELKDTGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELMED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor histidine kinase DesK
publication title Regulation of signaling directionality revealed by 3D snapshots of a kinase:regulator complex in action.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase/gene regulation
total genus 44
structure length 131
sequence length 131
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2016-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5iunC00
3GBPA 3EAFA 4MQFB 5KQGA 2KYRA 2F8TA 4N0QA 4MPTA 1EFAA 3HK2A 3OLZA 3LUJA 4Z9AA 3VNBA 1MB3A 1YMVA 5T7BA 2JVIA 4L4UA 1USGA 5TPZD 3UUGA 4TLLB 1P8AA 4E7OA 5JNRA 4YS6A 3FGZA 2BGGA 1XHFA 3P9YA 4KV7A 1VPWA 5JNUA 2L18A 4CBVA 2R25B 2ZAYA 3H1FA 1PEYA 3KSMA 2B4AA 2JK1A 3KLOA 3MM4A 1VRVA 1Z18A 2MYTA 4RKRA 1JLKA 2M1ZA 1YS7A 1YTUA 4KVFA 3HJFA 1MIHA 4KQ9A 2MSLA 3HO1A 2IDMA 3JVDA 5JNVA 2LIVA 4Q6WA 2PE5A 3H5OA 4ZJPA 2M98A 4IILA 3OQMA 2ID9A 3ROFA 3H5IA 2VYCA 4IRXA 2FMHA 2E4WA 2L17A 2MYPA 4G0MA 1XHEA 1BA2A 1QQBA 3I09A 3KCNA 1U0SY 3RVJA 3E61A 3W9SA 1C4WA 1DRKA 2E4XA 1JFVA 1J56A 1ABEA 1VKRA 2B1JA 4XXHA 4F06A 3HDVA 3LKBA 4G0QA 4G86A 2JB9A 4RWEA 1WETA 4RDCA 2FVYA 1FQWA 3RVMA 1JF8A 2P4UA 4RS3A 4FE4A 2YHAA 3EGCA 5FBHA 1YS6A 5KQMA 3GYBA 4F8JA 2FQYA 2IYNA 3RVLA 2QXYA 1ZGZA 4YCSA 3OLYA 3HVRA 2WY2D 3QLTA 2PUAA 5HQJA 2IKSA 2FQWA 2CHEA 1I3CA 4MS1A 3IPCA 1EWTA 1USIA 2CD7A 3DLBA 4Z9BA 5ABPA 3CU5A 1RXEA 1BAPA 2L2QA 3KS9A 4LRQA 2TMYA 3H5LA 4EYGA 2J48A 4H60A 3C6QA 2HQRA 3FFWA 1KGSA 4XFKA 3EQ2A 5IX8A 1QNLA 2Q5CA 1SD5A 5TPWB 5FBKA 5JNSA 5CNJA 2A9RA 1LBIA 3QLVC 3QEMA 3QLVA 5FWYA 2PUEA 2FW0A 1U2QA 1DP4A 4YO7A 3BBLA 3OO0A 5IEBA 3K4HA 2MSKA 3KG2A 3OO1A 4RXUA 3DLHA 2E4YA 5IUJC 5IUNC 2ID7A 5KC9A 4G0YA 4NICA 3S99A 3SG0A 3IP7A 5I4CA 1GCAA 2RDMA 3CFYA 1ZH4A 4RV5A 5TQ2A 4D6XA 1BVHA 1DCKA 2R48A 1P6UA 3RVNA 1AB5A 3H5WA 2FLKA 2L19A 4IGAA 1CEYA 4KMRA 3OM1A 3QELB 1JWLA 1E2BA 3A3KA 2PJUA 2GX6A 6CHYA 2FEKA 3JPWA 3RVKA 1QMPA 4DN6A 4OLBA 4MYRA 1Y1LA 3TX6A 4YRZA 3HSYA 3L49A 4MAAA 4MGEA 4ETIA 4TLMB 3JTEA 3OQNA 4LZLA 1TLFA 3HS3A 5IUKC 2QSJA 3VNAA 3EODA 3E3MA 2NZVG 2XDYA 1FFSA 3O1IC 4WZZA 4D6YA 9ABPA 3N6VA 4EGSA 3R0JA 1W25A 2F8SA 1YVUA 3M9WA 1JL3A 1GCGA 3GL9A 3HDGA 1E6KA 4MLCA 3EDCA 2IPAB 5GQSA 3FDFA 4MQEB 4IMJB 4QPJC 4MR8A 1QQAA 4HNSA 1ISRA 4JB0A 4HNRA 4IMIB 2WRZA 4FB4A 4RXTA 3LFTA 5F64A 1C0EA 3A0RB 3O2QB 1A2OA 1PUXA 4Z0NA 4Q6BA 3KYIB 5C5CA 3EULA 4YLEA 4RK4A 2PUFA 2FEWB 3GWGA 3H5TA 1L5YA 3KLNA 1LK0A 1QP4A 3A0UA 2I6FA 3MA0A 2CWDA 2A9OA 1U04A 3LUGA 1QO0D 1JH9A 1Z2DA 5IEJA 4WXEA 2RJOA 3LTEA 7ABPA 3EJWA 4Z4CA 2QV0A 3N75A 1XWWA 1SRRA 4PE5B 1DZ3A 3QEMB 1BDHA 1D5WA 4YP9A 3C3KA 2E4ZA 3Q15C 4F11A 2OENG 5E3JA 4ZMSA 3H6HA 3RVQA 3CG0A 5TQJA 2FN8A 3N0WA 3QX9A 3DGFC 1Z26A 2HQOA 3LKVA 3GBVA 2FXIA 1Z25A 4NCBA 4MS3A 4RK5A 4MR7A 4WUTA 3DGEC 1SXHA 2YHBA 4XARA 4ZYLA 4RXMA 6ABPA 2HSGA 3KHTA 4DQDA 3CNBA 1ZN2A 1LJUA 2LUOA 4GNRA 5HKOA 4Y9TA 1RPJA 3IP6A 3MYYA 4XLTA 4KZKA 4EUKA 4EVQA 5EWMB 1GLGA 2LPMA 1TVMA 3RVRA 5KQLA 3NHZA 5TE9A 2ZWMA 4OLAA 3D02A 3OMWA 2HJ9A 4JASB 3T95A 5ED4A 1PHRA 1KMIY 2VUHB 4G0PA 1Z2EA 2FKAA 3CZ5A 1PNRA 3F7NA 5TQ0A 1F4VA 1U2PA 1URPA 5EWJA 5IC5A 1NY5A 1K66A 3N8IA 2FN9A 1NATA 3QK7A 4TMYA 2NZUG 1GUBA 3LUAA 5TPZA 3M9XA 1D1PA 5DGCA 1A04A 4KPYA 4YV7A 1H9CA 4NV3A 5BRJA 5FWXA 3C3MA 3OQOA 4PZ0A 1IIBA 4MS1B 3O21A 4RSMA 1QO0A 3SAJA 4G0ZA 3B2NA 4D74A 4RK7A 4ETNA 1ZAYA 5EWJB 4KK3A 3NNSA 1EAYA 4DADA 4ML3A 4N0PA 1FFWA 3BRSA 3CRNA 3H75A 4M88A 2PKXA 3H1GA 3FFXA 4OTZA 4Z4FA 4YGXB 4EYOA 2A9QA 3HXMA 4L85A 2PMCA 3QX8A 1L5ZA 4OG2A 2LBPA 4UHJA 4MRMB 4Z4EA 1ZITA 2JRLA 4NQRA 1ISSA 1CHNA 5KQPA 3SNKA 3I5AA 3T8YA 3M6MD 4KREA 1NXWA 5EWMA 2QVCA 5CNIA 4ZMRA 3H6GA 4Z4IA 2PAFA 4KRFA 4W5QA 3BRQA 1PEAA 1MAVA 4N41A 4G0OA 3HZHA 4KFCA 3Q7RA 1Z15A 1FSPA 1ZY2A 4QYWA 4IF4A 2GKGA 1P6QA 5BQ3A 1TMYA 2IPLA 3N0XA 3F73A 3KTOA 4Z4GA 1YMUA 3H5VA 5BR1A 1JFSA 3O1HB 2FTKE 1AB6A 3JS5A 3TB6A 1UDRA 4RY8A 2V0NA 3Q41A 3O1JC 1DC8A 1LJLA 2MYUA 1TM2A 2WJWA 1LBHA 2QZJA 4MS4A 3FMVA 1RZRD 3GRCA 4G0XA 4OATA 1ZH2A 4XASA 3IP5A 2FLWA 3RQIA 1DBWA 5DCLA 3QLUC 1T34A 3I42A 1EWVA 3QLUA 1M2EA 4YWHA 3SQNA 2N9UA 3JVIA 4LDAA 1M2FA 1D4ZA 5IULC 5IBQA 4WWHA 1JYEA 4LX8A 1EWKA 2A9PA 4RKQA 2NT3A 2QW1A 5TPWA 1BDIA 3HV2A 3FFTA 1DBQA 4LE0A 3CKMA 3IDOA 2LP4Y 3LUCA 4E7PA 3RVOA 1TJYA 1JFTA 4QICA 4Z99A 1M5UA 3MIZA 2PL1A 2IOYA 1CYEA 5FWYB 3URMA 1ABFA 3DBIA 3IP9A 5CNMA 4LE1A 3H1EA 3O74A 3LMKA 2X7XA 4G97A 4JA2A 3A10A 3KYJB 5KC8A 3SY8A 3CS3A 2GWRA 3KJXA 3OMXA 2NUBA 1P2FA 2WJAA 3HEBA 3NBMA 1FFGA 1NXXA 3O75A 1Z16A 4XAQA 3OM0A 5BRAA 2FMKA 2GI4A 4F3TA 4FE7A 5KI6A 1E6MA 2FQXA 1M5TA 3Q9SA 4MRMA 5EWLA 3BILA 3QEKA 2HPHA 4MR9B 3I45A 3HUTA 5DKFA 2E4UA 1A0OA 2OQRA 2AYZA 1SXGA 5C5EA 1NXSA 2H3HA 1E6LA 2NT4A 3OLXA 1YK0A 5JNTA 4N76A 2GBPA 3LUDA 3MF4A 4LDZA 4O5AA 4OBBA 4RK1A 4PEVA 4RZSA 2IPMA 3LOPA 1JBEA 1JYFA 3MMNA 3JY6A 3TD9A 3F6CA 3HCWA 1OXKB 2MYNA 1K68A 4MR9A 5FWXB 1KRXA 4KK4A 1APBA 1D2AA 3NNNA 3ILYA 4TN5A 5JS1A 2RJNA 3G1WA 3RH0A 1ZHHA 2O20A 1JX6A 1NXTA 1RXIA 1ZDMA 3LUKA 4MQEA 4WXMA 1RZRA 1NTRA 1NXOA 3KKEA 2VUIB 4RY9A 1QKKA 3C3WA 3ROTA 3UKJA 4F12A 4RU1A 2RGYA 3Q7TA 2W42A 4UHKA 2QR3A 3UK0A 4EYKA 1RNLA 1ZVVA 1KRWA 3SM9A 4H3KB 1ZESA 4MQFA 4ZPJA 2E4VA 1DJMA 4S04A 5HM6A 3ILHA 2WWVD 3OLVA 5PNTA 1YK1A 1VLZA 5DTEA 4EY3A 2R47A 3L6UA 4N03A 2JBAA 1QP0A 2FMIA 1Z13A 3N53A 3HM9A 2WMYA 5GOTA 3JPYA 2IPNA 2JVKA 3DZDA 1JDPA 4P1ZA 5DLEA 1DRJA 3GA5A 3TMYA 1DC7A 4MLDA 4Z4HA 4P98A 2JCGA 4PYRA 2PL9A 3O2JA 4LE2A 3RVSA 2DRIA 2VK2A 4RY0A 1SXIA 2CHFA 2JBAB 5TQ2B 5CHYA 1MB0A 1HEYA 3O2SB 4KNYA 1YIOA 3CZCA 3LUFA 1BDJA 4EVSA 4W5TA 3NNDA 2AYXA 4HNQA 4O1IA 3RVPA 5JNWA 5B3JA 2PLNA 5B3JC 5HSGA 4MS4B 4JP1A 4W5OA 2PUDA 1EHCA 2FEPA 3QELA 5D2CA 5EWLB 4W5RA 4MS3B 1JHZA 4MR7B 4JAVC 4KQCA 1W9HA 4O1HA 1ZGGA 3D8UA 2FSPA 3N0RA 2FMFA 2QU7A 4NCAA 1PNTA 1DCFA 1U8TA 1DCMA 1Z12A 3T38A 1S8NA 1OXBB 3C97A 3GV0A 3LUHA 1B00A 1QP7A 3NHMA 3IPAA 3MQ4A 4PICA 4RK6A 2JVJA 1MVOA 2R4QA 4B09A 3G85A 2QVGA 8ABPA 4S05A 5KWSA 2PUBA 2H0AA 4H3HB 2MSWA 1NXPA 4N47A 2HQBA 4QYMA 1F51E 2WB4A 1NXVA 1QPZA 3CHYA 1USKA 2P9HA 3K9CA 4JOQA 3Q7SA 4W5NA 3EQZA 3GT7A 4MR8B 1D1QA 4EVRA 1GUDA 4HYEA 3TO5A 3T6KA 4GPAA 4RK0A 5TQ0B 4ETMA 4JB2A 3CG4A 3CLKA 1DBPA 1Z17A 1R8JA 3HUUA 3OLWA 1JDNA 2PUCA 5T3YA 2PUGA 3F6PA 3BREA 4Q7EA 4YR7A 5JS2A 1DG9A 4EYQA 3CTPA 5CNKA 4WT7A
chains in the Genus database with same CATH superfamily
4D3DA 1HDYA 1M72A 3EAFA 2RGEA 2F8TA 1G5QA 1RQPA 3PNLA 4N5LA 3BWVA 4WKCA 5GJVC 3ANNA 4BX3A 4F2HA 5KJ6A 4MEBA 4FB5A 4I1UA 3HYRA 4AECA 5JD3A 2VHVA 2AUTA 4GT1A 1XK7A 4CBVA 2SCUB 1EGMB 2VDPB 4MA5A 4C21A 3L41A 1L5GB 1XNGA 4KPEC 1M6WA 5E7JA 3Q88A 5CAEA 4M0MA 1IMJA 4L7QA 4ZALA 1C7QA 4L76A 3IAUA 3H86A 1Z18A 1EXWA 1UC8A 3BK2A 3I8OA 4OO3A 4R1LA 1F0KA 3IA7A 2FZEA 4GF5A 2V8OA 3KOZA 4FMPA 1QB7A 3AHGA 3G9TA 1UBFA 4JC5A 4OREX 2A6PA 4GMFA 2IV3A 3L8MA 4XJXA 1T8YA 3RIXA 2ZB7A 4EPTA 4BMCA 4EMTA 7ADHA 4KR7A 2I2WA 4EMSA 1A96A 2ZIXA 3CX8A 5BOSA 1W36D 3OH8A 4IQ0A 4MUYA 2X6RA 4LQ4A 1EVLA 2ACVA 2VNSA 2ZSFA 3KPVA 2JGEA 4MYSA 4A15A 3FA2A 3IUYA 3RVJA 4D26A 2WG1A 5FOWA 4MROA 5BUZA 2HSWA 3RFVA 3ESXA 1KOJA 2OCPA 5IVHA 2EQ5A 4RA9A 3DTVD 4R8LA 1GNRA 1II8B 1VKRA 4LHSA 1GJRA 2VJCA 3CLHA 2D7CA 3NCHA 4XXHA 5G4LA 5C4MA 3LKBA 2JB9A 3HCPA 1F1JA 2QL9A 1SCJA 4O3MA 3TNLA 1RYFA 4IDGA 3RVMA 1W48A 1LU9A 1B3BA 1QLHA 4YT5A 5HM8A 1M3SA 1JJVA 2VQSA 3IB6A 3W1EA 1O03A 2OILA 3EPLA 5DSZA 3TFQA 1VDZA 2VNKA 2AEFA 1HLFA 5EMLA 5DK6A 4BQRA 1CW2B 4AICA 2WNHA 3QX3A 3IELA 2XKKA 2H00A 2IKSA 4AVYA 1WB5A 2MINB 2PKRA 4MS1A 4EJ2A 4ZOQI 1QHNA 1U0LA 4LSZA 3ENNA 1LX7A 3M1YA 2OB1A 5ENZA 5KNBD 4C43A 5LWQA 2NO7A 3MRSA 4L07A 4WCVA 1FFYA 1YT5A 1Q7CA 2I03A 2ADFA 3O4GA 3PC2A 4J0HA 1GTVA 3ZQKA 1ZRMA 1VHJA 2J48A 4XFKA 3TI9A 3NMUF 1KGSA 4QOJA 1HT2E 2JD0A 5CM2Z 3O8QB 4X1IA 4YDSA 4N6OA 3KVOA 3PNKA 4KTTE 1BMFD 2BHRA 2UUPA 2KE5A 2B35A 3WNDA 2WFAA 5CNJA 3K8QA 3EIXA 5I4KA 4P36A 4HPJB 1B0UA 4K40A 3TLZA 2YJGA 2IH5A 1SCNE 1TJ3A 3IOCA 3I76A 4L5BA 1TJ5A 2XQKA 5DYTA 3CEJA 1COWD 3QVTA 3EG9A 2FW0A 4QE3A 5ALHA 5E1OA 5C51B 3L6EA 5FYQA 5KOYA 3HSSA 3Q1LA 3OO0A 2GFQA 3CF0A 4WADA 3C5WP 5CU7A 1C3EA 3U3XA 4RXUA 4CN9A 2EL9A 4BFYA 1A76A 2JRCA 2WTAA 4LVCA 4BNUA 4N7JA 4TUYB 5B4UA 3ZVLA 3VU9A 3FNIA 4RDHA 3RU3A 5MN4A 1LDBA 1FXWA 3R75A 3UVEA 1NVBA 2OWDA 3BX1A 4HX2A 5D85A 2P41A 1SIUA 3PXXA 5EZYF 2JI6A 1SOWA 3CRMA 1WCIB 4NBSA 1QUFA 2W9XA 2WWHA 4BWVA 1GPYA 2PPLA 2DEUA 1V1RA 4JUCA 1D4FA 2I2DA 4MVJD 1LPSA 1HZZA 2IOFK 3FKJA 3MZ0A 2AJDA 2UZ0A 4FFOA 3K0SA 4LY0A 1NQAO 3KAQA 1L8LA 4MAAA 3DYIA 4P08A 2OYRA 3UWOA 5FQOA 3HHEA 3PNOA 4LGYA 3H87A 2ZYGA 4GOXA 4BZPA 3VNAA 3CZ4A 3KDSE 4GXQA 4JOCA 1Z6PA 4GS5A 3PFBA 4NMMA 4XCXA 4D6YA 3AR8A 3BRWA 5D87A 2NYAA 4EGSA 5JJLA 3FVWA 4H1HA 3AERA 1E2HA 3K9WA 1YA4A 1M2GA 1P1CA 2IPAB 1VG0B 1V71A 1WVMA 4IVNA 1DIOB 1J00A 1UODA 4OU5A 3TIIA 5AI9A 1SC1A 2WPDA 1RQLA 4HF7A 2DR3A 1GXSB 4N1AA 4D44A 3QXCA 5CAEB 4B3XA 3VAZA 3ZX5A 1V8FA 5F64A 3M6XA 3A0RB 1KQOA 1YC5A 2PX8A 5I3CA 1PO7A 4QPNA 1I1OA 4GI7A 2CFTA 1Y3HA 3Q3CA 3V9PA 2W58A 2QL5A 6NULA 4M9XA 4PQYA 5AW2A 1GNSA 1FNNA 2W8BA 4OGGA 3ZGLA 3ZDQA 4EDHA 4LBZA 2CL0X 4Q7JB 3DWEX 4BP8A 4CHGA 1E63A 4FHEA 4PC1A 3DAOA 4D57A 4IW3B 4KFTA 3JQBA 1JAIA 1XEXB 3EISA 3TAHA 5J2TF 4UBKA 3EIFA 3SF0A 4L7VA 2C78A 5JCJD 1B43A 2B92A 2ZSJA 3PXBA 4HJRA 2HAEA 2X40A 4MHOA 2X3FA 4NV1A 4CIBA 2O1EA 2YQ4A 3BB3A 3I4LA 4IX1A 4YRCA 1G2QA 3TVDA 3VHXA 5BV2P 3S81A 2QJWA 3AOEC 2J9FB 2ZWPA 4EPXA 3IRVA 2QUIA 4RE6A 3N75A 1C5KA 2APJA 3T5AA 4LC9A 221PA 4WIAA 4JMLA 4X95A 3EIHA 2WSYB 3F1LA 1L2TA 4YCSA 2IV7A 3Q15C 5CIWA 3H4IA 3NV7A 4MUMA 4OXKA 4Q3EA 1MXFA 4UVDA 2X8AA 4MVJA 2QE6A 3KT0A 4LY3A 1GPWB 3STVA 3E22A 3SHWA 1F8YA 3HJUA 2B99A 5BWMA 1MX9A 5BW5A 3RUDA 3T34A 3VR5A 3I37X 1VE3A 2I71A 2JBWA 1WPQA 2RAVA 3LYAA 5DHQA 5JE8A 3T52A 1G19A 5HUQA 1L6IA 2OV1A 4EF5A 3IOBA 4EHKA 5EJEA 3JALA 3KHTA 2NQ2C 3H9EO 3EVGA 1DAMA 5HKOA 2A86A 1RJ9B 5LQSA 4C6TB 4ECEA 1H1LA 2DH5A 4KXXA 1QLWA 3C2QA 4N0EA 2LPMA 2I3AA 5DISB 3NP7A 4RKEA 1IIRA 4M37A 4YACA 5KYWB 1YDWA 5EXDA 3HVHA 4H6XA 4Z9FA 4TMWA 4ICIA 1JDSA 2JAPA 1ACLA 3RWMB 4BUJA 1QH0A 1WW8A 3BB4A 1Z2EA 5AM4A 3UAWA 3B48A 3QVJA 2RSLA 4DKXA 1WDTA 4NBWA 4DLKA 1KP9A 2ILTA 3AI3A 2QN8A 4P7JA 4BFLA 2JJYA 3RGGA 4BUCA 4BP3A 1H6DA 3I4FA 3Q8LA 2KJQA 2WNIA 3PZRA 1I0ZA 4UEKA 4Y2VA 5FUXA 5ADWA 3EGEA 1JKJB 2JJ2A 2B36A 3TW8B 1HWYA 4WA8A 4ISBA 5KWEA 4UZSA 3CF6R 4JGBA 4KK3A 1PJ8A 1WJGA 4BJHB 3RS9A 1F2VA 3FYSA 3Q6MA 1ZW1A 4TRMA 1DZIA 2X19A 3AETA 3C98A 4R7GA 2FUKA 1IG3A 3FFXA 4CKEA 2QYSA 4XUCA 2Q2VA 3E3AA 2HJGA 1SCBA 1KQFA 1GT6A 1G6Q1 1TZCA 3E15A 5DHRA 5DM4A 4XPIB 5M3BA 2HHAA 3S2EA 4HAOA 2O1XA 4KWIA 2AG1A 3E9ZA 3ZHVA 3H2IA 3WTBA 4F2GA 4RTQA 1HR0B 1Q0RA 2ZUFA 1UF9A 1VYVA 4OGKA 4RYLA 1FFCA 1JG7A 2I4IA 1DQSA 5KEIA 1BW9A 2PMKA 3WDKA 4PYOA 4HYTA 3I9MA 1Y1QA 3QWAA 3URKA 1ZGJA 5AJYA 1EHYA 1V8PA 1YOVB 1T0UA 1O5OA 3BYZA 2P1RA 4LZPA 2UXDB 4QPZA 1YQEA 4HX5A 2VEOA 5IBPA 2KLBA 4TYYA 4DLZA 3A14A 4EGFA 1NQXA 4E11A 5EP2A 1CQIA 3ZLVA 4UJ3A 4OXIA 1XLTC 5J63A 3ABIA 1TCVA 3BJZA 4ZP1A 2OZEA 4I1YA 3QXHA 1ZWKA 1LW6E 1ORIA 4ETWA 3D7KA 3CXRA 4OJNA 2I7CA 1ULZA 4ZYVA 1CNEA 5EQDA 2H5EA 4GYYA 2FEOA 3PHJA 1RDFA 4PFKA 1S2LA 3JQ8A 5DRYA 4BWFB 5IN5A 3FPAA 3HO6A 1H5UA 5AUPB 2OV2A 5AI8A 3QUSA 2QZJA 5CH3A 4J7AA 5FBZA 3FMIA 3FMVA 5I7OA 1GTZA 4FM9A 2C2BA 3DMYA 3L40A 4OFXA 1ZBDA 2RI1A 5A9SA 5BYJA 3R5KA 2OUIA 2JPDA 3HQ4O 4M1YA 4Y2TA 4RD4A 1RM5A 1YHYA 2YN2A 4L28A 1T91A 4CL3A 2C92A 3L1VA 1AF7A 1OHHD 4G9EA 3I2KA 4TROA 4NIMA 3O8OB 2ZXUA 2A3RA 3PGA1 1J22A 4CXMA 4EG3A 1WCV1 1GLVA 2L82A 3KR9A 1BDIA 3TR6A 3UWDA 4ZXFA 4BO9A 1EFPA 2NX2A 1F9EA 5THXA 3SE7A 1NT4A 2ZBEA 1OI7A 4NBLA 3WYBA 2Z2XA 1SA0A 2ORIA 4Q18A 2QN7A 3SKXA 3VR4A 3R7BA 1YR1A 3E7XA 4HRXA 4PIVA 1MOSA 4A2WA 4UPEA 3PPYA 4WGGA 1T1IA 2J6CA 4C5CA 1WZUA 4ZN6A 1J9ZA 3KJXA 3UT6A 5TGZA 3PLNA 1FFGA 2WOJA 3LPDA 1JG4A 2IYLD 5ARDA 3QTTA 4JI6B 3ABOB 3TGLA 5JBIA 1DRWA 2GI4A 2HI0A 5KI6A 5HBGA 1XJCA 3GJ5A 4BVAA 4TL8A 4U0KA 4LVOA 3CVOA 1HFWA 1W93A 1X7WA 3U1BA 2OG2A 4ZQGA 4DMRA 1GGHA 4X8OA 3T3EA 5K8IA 4EKYA 2EZ8A 3K1ZA 3DZIA 2RHTA 5DHAA 2NTEA 4Z6KA 2V45A 4M7PA 5C5IA 5D84A 4QT0A 2BFMA 4JP3A 4XE5A 2G9UA 3JARB 1YQWA 3L8DA 3I6BA 5GVRA 3CUWA 4MW0A 1XA4A 2QVLA 3EW7A 2FWMX 1NDQA 3H3JA 4ZWNA 4C4RA 2P2NA 2WJVA 3GEGA 2W2XA 5CCDA 2CZQA 3WBFA 1QQTA 3HM2A 4IJUA 2IZOA 3L04A 4ZO6A 2Y93A 3I8SA 4GMXA 1PGPA 3RU7A 3C0KA 2HXSA 1CF2O 4HMOA 4LMPA 4FXOA 1N1DA 1JQEA 4R2JA 1KDZA 3W1WA 2ZRHA 3EUAA 3IPXA 1PT8A 4NNJA 2H7CA 5AMXA 3SIWA 2AN4A 2B8WA 2PSJA 2DPXA 3DLPX 2I4TA 4GVXA 5ALLA 5DNDA 2FUG1 1LZLA 1IOLA 1QGOA 3G6KA 5ER9A 2QR3A 2KB0A 2V3WA 3A1FA 3UK0A 1B15A 3U39A 3ITKA 3DTVB 3SM9A 4K86A 3HFSA 4MVJG 2XQVA 2AFHE 1ANKA 3LCJA 3UKJA 4EA7A 1Y6RA 5JLAA 3ZTTA 1OH5A 4O4JB 1ZK4A 2NGRA 3KLPX 4EGCB 4FZJA 3ZGOA 1JQBA 1XAGA 2Z2YA 3S8YA 2F1JA 1LEHA 3KD3A 2GFIA 4AQDA 1JEOA 1ZN8A 4O2AF 2BAGA 3WQBA 5MHTA 5A05A 4H4EA 4QUHA 3UNXA 2Z6AA 2GD0A 5AKJA 2PKEA 3PHLA 1EP2B 3PNQA 1DC7A 2C59A 4P98A 1MGOA 2IOHA 1X1BA 1H5QA 5G0VA 4BNDA 3FNHA 4DILA 3OEWA 3IILA 3LPNA 1PR3A 4ZYYA 4Q05A 2OPHA 3F71A 4OQDA 3TX2A 4U0JA 5GVSA 4ENRA 3GN1A 1G21A 1P8JA 1G8MA 1VXOA 1Z73A 1KI4A 2AN5A 3BL6A 4KO4S 3SS7X 5ALXA 3GRVA 2VA9A 4ARBA 3FR8A 4ES6A 2FWJA 2FVXA 1IZZA 3V8QA 3PL1A 3A4VA 1GZSA 2F64A 1QCCA 2EX0A 3GFFA 1ECCA 2C97A 2DPGA 5GONB 2A9FA 3AY0A 2R1VB 3QLJA 4HLNA 1PL6A 1WW3A 2VWHA 3LWZA 3P4XA 1UBRS 4DS3A 1O87A 1HV8A 2NXJA 3C3DA 1W47A 2YZGA 1KH1A 2C1EA 2FMFA 1A71A 2C7BA 2AX4A 3A31A 1DCFA 4GC9A 3VKUA 3W5UA 4ZK2A 4CM8A 1XRNA 2WJ6A 4IUCS 1B00A 3ETGA 3QA3E 1QHSA 2I8LA 3WLNA 5C8YF 3DMHA 4M21A 3ITEA 3N2NA 4LYGA 4OU4A 2JGIA 2UVQA 2Q3CA 1OFGA 3PEYA 3BHJA 3ECSA 3O73A 2WYIA 4BYMA 3U56A 2YJTD 4JBYA 4C0WA 4TRRA 1P39A 1MUUA 1Z5PA 3I12A 2CXTA 3W3AD 4LNHA 1Y98A 3PDCA 3QPCA 2Q7DA 5K6RA 2YV3A 3SQXA 4YYZA 3C8ZA 3PJEA 3EWNA 4M7OA 4R51A 3WLFA 2CXRA 5F52A 1PWZA 2QA5A 2DECA 3CLKA 3LHIA 1DBPA 2F4VB 4ZAFA 3ZLTA 2QTGA 5HKKD 2AJCA 3OETA 1TVCA 1RRMA 1SQ6A 1OT5A 1MC8A 3DC2A 4GRIA 1FCJA 3F6SA 3RC9A 1K7CA 3ZCUA 3L0ZA 2DFVA 1R15A 4GXTA 5DB4A 5GV8A 2CNWA 2O3UA 2JCSA 3AR2A 4BBZA 3V4LA 2KYRA 3FCYA 3VC1A 4ZC1A 5BO5A 2V1XA 3G0BA 4G0NA 4Q9KA 2CDBA 2JATA 3VBEA 3EUWA 5T4EA 5AI5A 4GR5A 5L7YA 3WB2A 2NUTA 4TLLB 5BUCA 1N2EA 1I5RA 1Q7RA 1KWGA 1E1YA 1P0PA 4LCEA 2L18A 3EGVA 4OH1A 1E1QD 3MQ2A 4CT0A 1FNBA 3KUXA 5JNUA 3B5EA 3GARA 4D9MA 1SKYE 1DTEA 1FYFA 1Z7WA 2JK1A 4M1WA 1UT6A 2QYOA 3DE7X 1CUJA 3BJIC 2XB6A 3KT8A 5HILA 4QFDA 5KX5F 3JVDA 2VQDA 4PGAA 4DQUA 4FR0A 4MV0A 4G65A 1YI1A 3K1JA 4BXOA 3UG6A 5CMLA 5AJWA 2BUCA 2QQ0A 2XXBA 3IP8A 4LK3A 2R8EA 2FMHA 1GLNA 2L17A 1A8SA 3T7RA 1BA2A 3T15A 1WZ2A 5AHOA 3I09A 3TQIA 1NVMB 1TEVA 4NG4A 2YKGA 2EVWX 1KY4A 2YC4C 3DH0A 3IP1A 1J70A 2PN1A 3ITNA 3JVUA 4MPDA 3MINB 4YC7A 5DX8A 1OYOA 4Z0TA 5CPFA 3KYCA 1CR1A 4DIDA 4QQ8A 2WC1A 3ANXA 2PK3A 1T1EA 4G0QA 1ZMTA 4RIIA 1FYDA 4OUDB 4P4NA 5LQCA 4P84A 2NIPA 4AF8A 4L8GA 1JF8A 4D5EA 3QPAA 7AT1A 3UK7A 1X1TA 2XYGA 2Z43A 3UV7A 3W79A 2GCGA 2ZW9A 3V1KA 1NQOA 3E58A 4TM8A 3PR2B 5ICSA 2R6AA 4PPQA 3ZEIA 3SVTA 2BGTA 2C7PA 3QYFA 1D0VA 1I3CA 3A1TA 5C46F 1XZKA 3OWHA 1I32A 1NW7A 2OR3A 4JDUA 3EBOA 4Q48A 3U7IA 1Z88A 1D2CA 3DUFB 4EF6A 4IGFA 2GZ1A 1TOAA 3RADC 4X20B 4GOOD 1R5JA 1B26A 2AZXA 1O57A 1P4RA 2ABWA 2FPLA 2CFIA 2UKDA 3FFWA 1AXGA 3FZQA 3MPOA 4K81B 3AVWA 3REOA 4ZIRB 4PO1A 5TPWB 3QHAA 4M7WA 4MW4A 1ZJWA 1PQ4A 2GZDA 2O2HA 1F8GA 1DWQA 1SBTA 3VXKA 3NBFA 3U3DA 2RCYA 2XUPA 5M7EA 4ZOAA 5H80A 3RRZA 4TQGA 1GA6A 4AG6A 1ZOSA 4KXNA 4YMTA 1GT91 1KS2A 2VTDA 2GRUA 4CMAA 1Q2XA 2MSKA 4LYEA 5E4TA 4G1MB 1ATZA 4Z3OA 3A6DA 2EFEB 2D4AA 1RQRA 2X4LA 2X6QA 1Q5PA 4J2HA 4EM6A 2HL6A 2W4QA 4UQOA 3RSSA 1H4QA 3BEOA 2JF0A 2XTNA 1TO2E 1U3WA 2XKAA 3JU3A 4MRPA 4PIMA 2PVCA 4D6XA 5B36A 1W7AA 3BGDA 5IDVA 1EBBA 2KBFA 3MUEA 3WL8A 2JH8A 2QJRA 2A92A 1L9KA 4RSHA 4QUBA 4E5YA 4Q9JA 1TEHA 4KR0A 5HPYB 4A16A 1SCUA 3RSFA 2NO6A 4FPXA 2MWMA 4MGEA 2Y1CA 4PZDA 2PMFA 3U9SA 1T6ZA 3P4UA 4C1BA 1XD2B 1KTIA 4C7OA 4FXPA 1KERA 4X9XA 1NFRA 1BE8A 5IK2A 4MARA 4IDBA 3QVVA 1L5SA 1AKQA 3GZTB 3F1KA 1EPUA 2B8TA 2QLBA 4Y2QA 2NSLA 1FU4A 2ZJ3A 1QHEA 4GBMA 3G0CA 3KPYA 4MLCA 3UENA 5HHTA 4DIFA 1DIGA 1EVJA 5ICGA 3VU0A 1KO7A 2BHLA 1UEIA 3FLBA 3H4TA 2PX2A 1DKLA 2QRPA 1SBHA 4QFBA 4JB0A 4RVOA 4JB8A 2O06A 2IHUA 3OP4A 2QZ4A 2VP6A 2ZPAA 4S2UA 4BHTA 1NBHA 2YJ6A 3BA6A 2YYAA 3IVXA 3JAKB 1A2OA 5HBRA 1MOPA 2VP9A 3PFNA 4BE4A 2LWIA 3CBGA 3L82B 4UM7A 1PJSA 2AOVA 5KO2A 1LNQA 5CB4F 2QUAA 2FEWB 3GWGA 4F86A 2NU8B 2O6LA 5BYAA 5LA6F 2L42A 1I7SB 2ALJA 4AZSA 1RQ2A 1M1XB 4J0IA 3ZWWA 1HT1E 2LKCA 3NHLA 2PZBA 1P0FA 5E6RB 2EU8A 3KKNA 4FBGA 2DPMA 2ZFUA 4QQFA 3QVKA 1RWPA 1BS9A 3PHIA 5EHXA 1U04A 1YRWA 1ZK2A 1U0FA 2JFZA 1R0CA 2P6RA 1IBKB 1QIHA 3A7DA 2AE1A 1QHGA 1O08A 1ZM3A 1RRPA 5T4FA 4HDSB 1XDWA 5JAZA 3WGKA 3FHTA 3RJ5A 1H8HA 3CH7A 4ZGWA 2OAGA 1SRRA 4HLUA 4BZWA 3MTAA 3E9DA 4CF3A 4UNPA 3DE1X 4LJLA 4MI9A 3KM0A 2X5JO 4DR1B 1DQPA 3E81A 4PW0A 5KJEA 1XEAA 2WU1A 3SC2A 2C5EA 2W6PA 2WJPA 4TPKA 4K9MA 1COZA 2H54A 4JEMA 2AUMA 4YRBA 3ILXA 1P5FA 4ZCMA 1A8IA 4JI2B 1B0ZA 1HY3A 2VFAA 4D9HA 5TT0A 4JNKA 1KRHA 2WYOA 4HDMB 2C3UA 4AC9A 3GP8A 2VQ6A 2EHDA 1HE1C 4A5SA 2DOKA 1CUHA 2XMSA 1XAHA 2D8AA 4NCBA 4YCCA 4AXBA 4LWPA 3W2IA 5HIJA 5EZQA 4HZIA 3LO5A 5CCEA 8AT1A 2RD2A 1JG3A 1WXFA 4KQKA 5DM2A 4QOHA 4Y9TA 4MJXA 2B5WA 4EUKA 3G02A 1SXJD 1W5AA 3I2GA 3JZIA 3W8EA 4A2CA 1XMXA 2Q6VA 4LJ8A 3AHHA 3K8ZA 3DZGA 3RVRA 5TE9A 2J5RA 4CM3A 2Q6IA 3LA8A 4AO7A 4WFQA 5SV2A 4KQFA 1L4FA 5AIBA 2VUHB 4I1RA 4L0QA 3AVYA 1E3WA 1CR4A 1GZ7A 3I04M 1LPOA 3GJXC 1FFHA 4O4HB 1CX9B 2DWOA 2BEUA 1TAGA 1U2PA 4KJZA 4MW6A 1SHLA 2OFFA 4DMCA 2WICA 2FR8A 4CODB 4HSEA 4PO3X 2I8CA 5SYMA 2R65A 1B8NA 4EENA 3E2PA 1FSGA 1RJGA 2V9PA 2XODA 3OIUA 4NV3A 5HP4A 3B3FA 1DC4A 1AQLA 3A3OA 3ICVA 4MHSA 5C7YA 1BXGB 1W76A 2G6TA 2JLSA 3B2NA 4R9UC 2CDNA 4HHEA 4FINA 4Z54A 2W6ZA 3TQRA 1QH1A 1OH7A 3PDWA 4N0PA 5JY6A 4QQNA 2WK1A 5DFAA 4CV0A 4Z4FA 1N6NA 5F1KA 2OGUA 2D7DA 2A3NA 4ZTZB 3PEWA 4TZ0A 1XKQA 2VJPA 3L6OO 1UBKS 1V3QE 2BM0A 1M8FA 4URHA 2OA0A 2ZIFA 4Z4EA 1BE6A 4Q03A 3O6VA 2FZCA 3QNWA 4PS1A 5ELLA 5JLJA 4KW7A 3ZXXA 3T8YA 2PCJA 3EDYA 5LLDA 3G9QA 1TM5E 4JI1B 1UBOS 1NYQA 2E7ZA 2ZI5A 3DOFA 2X5KO 2OVFA 3V4FA 2KMLA 3VAYA 3VC3A 1ODTC 1PNQA 3DXFA 3W04A 5B1YA 4A8JA 3J7AC 1N5OX 1K08A 3DULA 4LY6A 4NPCA 5LQAA 3FKQA 3THXB 2IRWA 2FSVA 2DHEA 3A70A 3QSGA 4KC0A 1VYTA 4Q1FA 4F3CA 1IVNA 3MHTA 1TUGA 3C3EA 5DI3B 1JJFA 4KQ1A 2FFBA 4YRFA 4R9VA 1VYHA 5IP5A 1Q2UA 2E5WA 3CZAA 1QVRA 4ZRDA 5BR1A 2V6BA 3VDMA 1VBMA 3L92A 1JHOA 4KX3A 5C9ZA 3IAM6 2R8YA 1V26A 3B9BA 3GC6A 3PTLA 1UDRA 5DBEX 4MWZA 3ZJYA 4K5QA 1FDTA 3KQMA 5DIZA 1UWVA 2OP1A 3CNNA 5EIBC 1C3LA 1EJ6A 1PN3A 4ALLA 4RGBA 3CKLA 4K26A 2PX0A 4PAOA 4WCFC 5E4JA 4BGIA 1CDZA 2CHQA 1XO1A 4QXPA 1CWUA 4TLDA 3RHSA 3ZV6A 4PPGA 4EG8A 4EUSA 2X0RA 3HY4A 3SEZA 4X3PA 5DW3A 1HURA 5L7WA 1EVYA 3I8XA 4NS1A 5ITZA 2ZUUA 4LRTB 1DKRA 3EY4A 3GIWA 3I5MA 3ST7A 4Q4HA 2J7PD 3TD6A 3IGFA 1OLSA 4HLDA 1W0KD 3W2FA 4D8UA 5FOQA 4OQPA 1G291 3SSOA 3TFWA 1MGPA 2IBMA 5ESDA 4ENQA 1G8HA 2IGBA 2YV1A 4I1VA 2ZIWB 4PAWA 3HYNA 4Q47A 5CEEA 4E2ZA 5I51A 3JQAD 1YRLA 1E1RA 1FMJA 1GFSA 1RYBA 3GVXA 4TXJA 2AV6A 4OSOA 3V9AA 4IDEA 5KYYB 3SDBA 3HLTA 2YVKA 3VPGA 1C9YA 4B3TB 1QHIA 3EA4A 4FUTA 1PTJA 4U6NA 3U37A 4NENA 1K3FA 5CDYA 1YTLA 3O4JA 4IFTA 2QD4A 3HKEB 1ESZA 2R1UA 3A4LA 4IQ4A 1XQWA 2PNJA 3W6OA 1PGQA 3ZU4A 4EL0A 4P0PB 1ISGA 1OWLA 3V7UA 1CZNA 3KB6A 4RD1A 4DIOA 1CNMA 3I72A 4JDPA 1G4AE 2H4XA 1M1ZA 1RAHA 3EC2A 4XAQA 2B1IA 4MV6A 2HWKA 2XMPA 1P1BA 3B2QA 3MT9A 1WUKS 3MEQA 3V33A 1ECGA 3KWFA 4QGHA 5EVJA 3EARA 4JJZA 5FPQA 2WAYA 3PD0A 1QK3A 4FMBB 2F1IA 2OAEA 4RJIA 3RFUA 3UATA 3UMVA 1GPUA 1Z4NA 1VG1A 4OSPA 2VP0A 4GQBA 5LXTB 3MF4A 3CKYA 4A0FA 4KDCA 5LOVB 1S3SA 1JLLA 2H18A 3U49A 1CVIA 4OMDA 2JC3A 3JY6A 1V9CA 3OJCA 2N3ZA 4N8EA 5BOVA 4ZEMA 5ITWA 1U9IA 1JIKA 2VYVD 4H3VA 4KK4A 1HDGO 3T3HA 2X0KA 1NL3A 3W8FA 3CWQA 3ELUA 1J5PA 1V6AA 3PPXA 1F6WA 5JS1A 3MAJA 3UMCA 3A6EA 1UDAA 3KQYA 1EUCA 5CX1A 2GPTA 3WL3A 5THKA 1CIVA 4K6HA 4PSUA 1R9NA 4NULA 2P2YA 1E4EB 2W6JA 3RJTA 1M1YE 3H11A 3ZV7A 2VHTA 1KYXA 1AE1A 2XSZA 5LL6P 2XDQB 3VO2A 2W42A 2OYSA 4MO9A 4CM6A 2FGJA 3OC0A 7REQB 2R6R1 3JQAA 2E9SA 3ODPA 3BWDD 1EQUA 2NU7B 2P5YA 3NYIA 5LDGA 2IZ0A 1QDUA 3CO5A 2UAGA 4IJKA 1TKAA 1FTNA 3IB3A 2FRDC 4CMGA 2JCVA 3U7JA 4C0AC 1YK1A 1N0UA 5JTUA 1E8NA 4YRRA 2W37A 4UEQA 3HM9A 1QFXA 5I7VA 4ZT6A 3SQWA 1MC1A 3IDSA 4AP5A 4RQTA 2GM5A 3BXZA 2ZB4A 3DA8A 3HJCA 3D8RA 4CQMA 4J7XA 4ZPXA 1ONOA 1AU9A 3V8MA 1N1EA 2DWPA 2TECE 2YQ5A 3H4MA 5JSQA 5EQJB 3WGZA 1H4SA 1ULBA 2QRLA 1CDDA 3IVRA 3JWGA 5A9TA 4D4IA 4DMGA 1AH2A 3LO8A 2DAPA 4RD2A 2I55A 1BD3A 1NWHA 4FNMA 4HTFA 1Q0LA 4F1JA 3EG5A 2R7LA 2WNSA 3TNYA 2RHJA 1BDJA 3P0HA 3FSGA 4J1TA 3VTFA 5JRJA 4U2KA 4PFJA 1JR3D 1I1HA 2QD1A 3HKCA 1NDHA 1HI9A 2KHZA 1VDMA 5AM3A 3OQPA 1VJ5A 2X0NA 2JW5A 1E2EA 1E5VA 1MAAA 2VP4A 2W48A 2W5UA 2Q9BA 1HYBA 1ULTA 3BJMA 3D8BA 3IJEB 3N59A 4LN1A 4XD7D 1VP9A 2YS6A 4QGFA 4BBJA 5B64A 4AS2A 2REQA 3OE5A 3U4CA 4XYLA 1Z63A 3STWA 2O19A 1Z12A 4B35A 3DTTA 3SFVA 1S8NA 1W5FA 1FFXA 5HEKA 1S4MA 3AQIA 5FBWB 2AUNA 5EHZA 4IJMA 4TVKA 3BFVA 1S8OA 1SCQA 2R4UA 2EKBA 1S2IA 1P2DA 3AL3A 3N0VA 5FJJA 3X43A 1K6MA 3DL7A 8ABPA 3LLMA 4BXOB 3HY6A 4ZJUA 4YJ2B 3OZEA 2P40A 3AT1A 3QKSB 1BWRA 4MWTA 4W5NA 3UFXA 4ZI7B 3SQLA 3I2HA 1C1XA 4YXFA 2NADA 4QATA 3E82A 1I6KA 3BULA 1DG3A 3A2LA 3FNFA 1FBTA 3LWDA 4MX8A 3KQTA 4MW1A 2ZJ6A 1AY0A 2XUQA 4X91A 5BR4A 5AW7A 2PG3A 5KKAA 3U2QA 3BREA 3GNTA 2QNRA 3IAHA 4H16A 5JS2A 3IDFA 1IVYA 1Y4AE 3WRWA 1MD9A 4JU8A 4MUEA 1GG8A 2A84A 2I91A 3AGPA 1BS2A 2V54A 2XOKA 3QI7A 1AQUA 2KBEA 4ZVOA 4J91A 2AN3A 3VNBA 1ISJA 3TSWA 4A8TA 2FJUA 4KMSA 5CVJA 2WJZB 3H2HA 3PX2A 4KV7A 1ZOPA 2IUSA 1H0HA 1KJQA 3L8FA 4NV0A 2WIGA 1PZXA 5FOUA 3ZZUA 4X71A 3WSVA 3ZE7A 3RS0A 1DIHA 2Y77A 3FYUA 4Y1RA 1WRBA 4M87A 4ZCIA 5CBPB 5IVKA 2IH2A 3QE3A 3WGLA 1HKHA 3N2ZB 4OYLA 1C80A 1QAOA 1ZG3A 4IJWA 4RVCA 4KQ9A 1MV8A 1HE3A 3L9XA 1FMFA 4FSXA 3WJAA 5LZ2A 1T6NA 1W4CA 2R3SA 1GNQA 3EEFA 4LJ7A 5I5EA 1S7GA 1NRJB 3KZNA 3HBNA 3W5JA 2OBLA 4E5NA 4GLBA 3MB8A 4UBLA 2X58A 3LH5A 2VK8A 5L3SB 3K0KA 4BGDA 4ZREA 3WRXC 1KQPA 3W9SA 4CLRA 2ZJ5A 5H81A 2ZP1A 1JIQA 1OF1A 2RGBA 3MD9A 2BHSA 2O7QA 2Z8XA 3IYLW 2QL6A 4U7FA 4Z4QA 3W8NA 4P81A 1EEXB 3ZE6A 4A10A 2WVJA 2EC5A 4IHKA 2IXTA 2QSUA 4GM4A 4QXAA 3TEMA 1B2RA 1XEFA 3GJ6A 5H9WA 3CM0A 4J6EA 1YS6A 2Z56A 1IPEA 3IEXA 2H1HA 3Q4GA 5CB8A 3BL8A 1KFKB 2YCLA 3VQTA 1FU7A 2PR2A 2XB8A 1V8ZA 1RD4A 4FFBA 3HN6A 4JJEA 2X7HA 3EXG2 3MWDB 1A88A 1UC4B 1Z0JA 2FQWA 4BYGA 2WIFA 1CUCA 4DUPA 2OCIA 2ADOA 4M0KA 2BZSA 4RTLA 1L5MA 1PJ4A 2YNMD 3HB4X 2Z4TA 1TMOA 5EIFA 2H1FA 2FJPA 1H1DA 2PWZA 3BE8A 3IT0A 4WLEA 4BNFA 5ABPA 3KQLA 2FG6C 2WFLA 1NRWA 4F1KA 1JXOA 1EVQA 3VPHA 1CC1S 2XNCA 4GEKA 3SYRA 3RABA 2HQRA 3IHKA 5CVUA 2CEAA 1MIOB 1Z45A 3P27A 5HS6A 4IPTA 3RFFA 3CNEA 1M1NB 3QEJA 2I6SA 4X7BA 1JV2B 3WQHA 3KE8A 2PSHA 1VB5A 1ILEA 1YJAA 2VRBA 3L4SO 5IWCA 2OCAA 3ZIDA 1IWOA 3C8UA 4ZDKA 3FOBA 2WWGA 2ZYAA 3N8DA 1LZKA 4AJOA 2QJFA 2WJGA 1U2QA 1KARA 1VL6A 3T7SA 3KJGA 1UPFA 3BXHA 1OLUB 3U44B 3WB0A 3ZBUA 4JZYA 4AAYA 4E1VA 4YT8A 2F3QA 3M2TA 1X8XA 4WEQA 5JFOA 3PC3A 1E2JA 1XWFA 5KC9A 1Z34A 4G0YA 1DBIA 2X5XA 4Q39A 3OPYB 5EYPA 3S99A 1KVSA 3N2GA 3SG0A 4HVTA 1S3FA 4WA7A 3NGLA 5F9HA 1N32B 1CEYA 4RF2A 1I14A 3DD5A 3OM1A 4OK5A 3Q11A 2FHPA 4ZQEA 4PZLA 5H7XA 5AW4A 3JWHA 4HWOA 4OLBA 1UP4A 2C5FA 2TRSB 1CUYA 3RB8A 4O0LA 3RYIA 2E4AA 3GUHA 3INRA 3BE5A 3ED5A 1ITZA 1EBUA 3OQNA 2XCTB 4DQ0A 3N39C 3JD2A 3BAFA 3O38A 4ND3A 3GU3A 4JJKA 4QASA 1JHRA 1KQ3A 4KP7A 1XZIA 3ZV4A 1OIVA 2R8ZA 3D2AA 4RCVA 5I9LA 2RHGB 2W2NA 2AMVA 4IFEA 1M0TA 5DCYA 2O8DB 5E9AA 4IMJB 3U7GA 1YRQA 3D3JA 5K9ZA 2GTPA 4IMIB 4NDZA 3VZBA 4Q37A 4FB4A 4R0NA 5KMGA 2J46A 4CEHA 1RAEA 2WHQA 3FAKA 3M3PA 3T9AA 1TM4E 3U4AA 4C08A 1AA9A 2BTOA 4Q00A 5FA8A 1LC3A 5FI0B 2YWFA 2I8AA 2B21A 4NZYA 3P2IA 4WJZA 4DLXA 5C5CA 3R9WA 1NSFA 5EE0A 5TRTA 2HCFA 2ZTUA 3THSA 1F9AA 3HEMA 1EXVA 4KQ6A 3TW6A 3A6GA 5GM2A 3Q6NA 3V2HA 1E69A 3P32A 4PSKA 2B2CA 3Q8KA 4FI3C 2QDXA 1GARA 5JZVA 2CKDA 3GCXA 1V37A 3CLRC 2FP4A 3U17A 5B58C 3THYA 3EEOA 1M6VA 2GHQA 5IEJA 3KZOA 3PU6A 5J5CA 4WXHA 5LU9A 3TLGA 3NTVA 1FW8A 2FPOA 1HLPA 3R0QA 2QUBA 1KI6B 4I55F 4DSUA 5JU6A 4F1WA 5E0KB 3TPCA 5AVYA 1DZ3A 3QEMB 2IP1A 3SHQA 3QMPA 1XZBA 2JIDA 3KOXA 4HY3A 1BXGA 3LRXA 4HNUA 3LXUX 1TGVA 3BZUA 2WTUA 3DZ8A 1EFCA 3UUWA 3KTAB 2AX3A 1QLJA 3EXHC 3I6YA 4EO7A 3B7PA 4MKGA 1GFZA 4ZVUA 2RFLA 3ZZNA 1P74A 2BKLA 1GSOA 2OKGA 2YZNA 3GJZA 3LDGA 3THWB 1Z25A 4F5WA 1JHYA 1RYEA 3A27A 3TSCA 2LNDA 3DGEC 3BMQA 4YRGA 2C7OA 1I4WA 3EDMA 4JKIA 4QYIB 1AK2A 1BXRA 3EE6A 1QCYA 1JEQA 4OYHA 1G2OA 3FGPA 4XSHA 1HSOA 1A5BB 4ZU1X 4IICA 4MW7A 4OGFA 3VJLA 1RI2A 1CJBA 1HYQA 1Z7EA 1GKKA 4BO6A 1TUEA 1N5KA 2Z5LA 3BS4A 2WFMA 4DBLC 1A82A 5LP6C 1CPYA 4K7JA 4DXAA 5DLQC 2W22A 1OBCA 4B6EA 2V5UA 1MOZA 5BXYA 2CNWD 4L5YA 5SICE 3TYXA 4P53A 3PPVA 3QVGB 5AKEA 3WKCA 1UWKA 1URPA 4JP8A 4PS0A 3VTKA 2R9VA 2ZTLA 3E5NA 4Q15A 5LKRA 1WU8A 3IP3A 3QK7A 3DAYA 1WMFA 1ESDA 5DHFA 5TPZA 1RE1A 4IH9A 4X44A 3H9UA 2Y0PA 4RFVA 1Y0BA 2PNFA 1F4PA 3VYSB 1I24A 2QMYA 1PCXA 4P9NA 3COSA 3OU6A 1IY8A 1PV2A 3OTHA 5FT9A 2MCFA 4P7GA 3ZIAD 4AF6A 1T2FA 4I5DA 4KFSA 2XE6A 4L73A 2FYTA 4AQYB 1PVVA 3VMMA 4NCJA 4X6LA 5JANA 1OZ0A 4KVGA 2IS4A 3IT3A 1A7KA 2Q5LA 2PS3A 2WUFA 1FFWA 4TTVA 2R86A 2IX3A 3GZNA 5JWRA 1F8XA 2I9KA 4EW1A 3UBTA 3L1IA 1K0FA 2DZDA 2ZRGA 4R0VA 4UNSA 4XLLA 2GDZA 1OFIA 1JE0A 4QO8A 1FUKA 2AFHA 3T9CA 4YV0A 1J0AA 1N2OA 2XBUA 4GSYA 1JHQA 1K5PA 3WLHA 1LF0A 1CHNA 1J5XA 3IPRA 1HK7A 1LVUA 1T4BA 2HUNA 2WU4A 3A25A 2EZ4A 1LTHR 1M34E 2PAFA 3C4QA 4HT3B 4I1OA 4IWNA 5CB6A 2ISQA 2BISA 3Q7RA 3K70D 4MV3A 1FTYA 2VATA 3UAVA 3RF6A 3AW9A 4GP9A 2ODEA 2QD3A 5ICMA 2YBEA 1P6QA 2ETVA 3WZ2A 1JFFA 3K8YA 4DSAA 1ZGBA 4Q7LA 2CHVA 1KI9A 3G9XA 4N39A 3AGQA 2J45A 2YICA 3DE4X 3P45A 3ADPA 1HOTA 1XI2A 3BCSA 4NXNB 1JFSA 1OBOA 1CY4A 1W1WA 3U61B 4YCBA 1N7IA 3IXQA 1RJEA 2CJWB 2V6FA 2ZGVA 2FPMA 3LU1A 5CFLA 2JEYA 4Q19A 1ZVMA 2ZT8A 5CYPA 4ONEA 1K6XA 2MYUA 3OT1A 2X8JA 2PLFA 2CL5A 4I9NA 2WJWA 4LYDA 5DYGA 2Z9DA 1Y33E 4HXYA 4AK9A 4TKUA 1YF3A 3M6WA 1OA0A 1YB2A 4NK5A 5AKGA 2QENA 3Q0IA 4XASA 5IJAA 3R3YA 4DCGA 3LT4A 3QXSA 3H99A 3D6VA 2BEVA 3AHIA 3KXIA 3WRYA 3I42A 5K03A 2FPWA 4Q3NA 2VBCA 4AKSA 3WIBA 2ZAIA 3FB4A 3FDXA 4N0MA 2ZRQA 1SOUA 3D4LA 4JUDX 4PBRA 4HPXB 1M2FA 2ONYA 3OICA 2WP8J 4RPJA 4Y2SA 4AZTA 1UFQA 2GBLC 4II3A 4AWBA 1X7YB 3QF7A 4II7A 5EMNA 1C0IA 3WOHA 2O2ZA 1KI1A 3OMLA 4OUKX 2BVNA 1VJ1A 4IXDA 1WBBA 3LUCA 4JI4B 2HJWA 1X7GA 2BT4A 1UKVY 3CNLA 5J2UF 1U7WA 3S8EA 3MSCA 1DINA 1PK7A 2PL1A 3DO6A 3DV9A 1YJ8A 1QFMA 2HEGA 1E8MA 1IN8A 2VDUE 2XYPA 4LE1A 1T9AA 3LAWA 1SUAA 3MWEA 2OEPA 3SP1A 2AOTB 3Q7IA 2QLTA 3L8HA 1JHPA 4IH4A 3V46A 3MN1A 2GWRA 3U4IA 4Y98A 4UARA 1BE1A 2Y67A 5BVGB 4UDNA 1SU7A 4JYCA 4BNYA 4BNZA 1ZONA 2XVZA 4CT4B 5BN3B 3CVWA 3VO1A 3PE6A 2ZIGA 3PWKA 5HKBA 2XRZA 1M5TA 1TU4A 1FFBA 1WV1A 4CG1A 3BILA 2I1QA 1GTMA 2FZWA 1H4VB 1WL8A 3C15C 1FUEA 4INOA 3FDJA 4TKVB 4S1VA 4HFMA 3FF1A 1KDOA 3VV3A 4RHUA 3ZQJA 5JCOC 5CT9A 3ADBA 1O96B 4F97A 3IKTA 1K0UA 2FKNA 3K6JA 4B9AA 2KX7A 1UFKA 4FFSA 4Z1MA 1RXWA 4UHEA 2Q0XA 4AXXA 1J5EB 2QTWB 4RCZA 1NMXA 2XA2A 3I9JA 5GZ1A 2R62A 4C29A 3O8CA 3HACA 3DEKA 2VTVA 1NF3A 3B89A 2QKYA 1XZPA 4MGIR 3R7WA 3L01A 3TB4A 5HQTA 1YFJA 1NQUA 1LBEA 2PX4A 1DBVO 2PGNA 1HDRA 4MH0R 1ODIA 4K0KB 1F2TA 1M2VB 3LZ6A 2H1LA 4LZWA 1SBCA 1IWPB 1QYIA 4TXMA 2XE8A 4G4SP 1UBTS 2IK8A 4BLWA 4TYWA 3GRFA 4RHXA 5DGIA 5JXIA 1ECFA 1DKOA 4NZNA 5ILQA 2J3JA 3KTDA 1WA5A 3BG5A 3DL0A 3LX5A 4O63O 3X2EA 1CKEA 5K3CA 6GPBA 1LVHA 2EKPA 4MITA 1GGFA 3ROTA 3UUFA 3W5CA 2QTVB 2EV9A 4YMSA 2UUOA 4F12A 3MK31 2NXNA 2WYVA 1NI4A 3AK4A 1JTVA 3FCXA 1NMYA 3KEGA 3PSHA 4G2TA 3RS2A 3TSYA 5BWLA 4J0EA 5KPDA 4E2XA 4RUKA 4DDHA 2AJTA 4KYUA 3QW4B 2H1VA 2GARA 2IYYA 4HAXA 4F92B 4NJMA 2IYFA 1H2FA 1W6RA 3MBIA 3BKWA 1Z83A 1J8QA 3ILHA 5DIFA 4LX0A 5B1SA 5PNTA 1LLDA 3UWSA 3FKSA 2ZDQA 2F00A 1Z13A 4J0DA 5EIBD 1I5OA 1C3XA 1QRAA 5G0WA 4B0OA 1ZUHA 4BV8A 1P1KA 5F73A 1XZJA 4I50A 5BSUA 1Y1RA 3B6ZA 2Y1KA 4C2AA 1A27A 2H0RA 2C03A 2O7NA 5DEOA 4LOAA 5IH7A 4Y6QA 1NXQA 4LE2A 1DWUA 4RTPA 2GLTA 4FFWA 5CLGA 5TQ2B 5CHYA 3GPDG 1DAIA 1R9MA 1TF7A 1D6MA 2HFJA 3AEQB 4HMQA 5AKZA 5P8WA 5BV0A 1N78A 4BB0A 1J7KA 3D0QA 1O0CA 4HNQA 4K28A 5DPMA 2CMDA 4DQKA 1QGZA 1R6AA 4MAMA 4JWKA 5KYUA 2BD0A 1NLUA 1ZEMA 3QUQA 1C0KA 3ZGVA 4P80A 1CUSA 1Z6AA 3ETNA 2QGNA 3ILSA 3IDZA 4LJ9A 2NO5A 3K0CC 5JIBA 3KP1A 3LBYA 1U0JA 3TMKA 1XOIA 3MT0A 3B1VA 3SI7A 4DGQA 5A9RA 1GPJA 4HXEB 4A2PA 2JKZA 1PNTA 3IALA 4MGHA 1OXBB 2A9VA 3AEYA 3C6XA 3C97A 3CMCO 1RJFA 3EG9B 3EVFA 2E2WA 1N2CB 3C48A 3TD2A 3VR3A 3NHMA 2ODAA 2ZM5A 5K2OA 1RC0A 1T8PA 2DFLA 4MPPA 1K4YA 5E3IA 4AJPA 3TZQA 1QJCA 4S05A 1ODSA 4TVSA 4JYZA 3TNJA 2GF9A 2B5OA 4DV1B 1QVAA 3R9XB 1PWHA 4MRVA 1NVGA 2EZTA 2I3BA 2O7SA 4L02A 1Z74A 1YZTA 3HFGA 4ERXA 1NBMA 2PUTA 1FP4A 4GDMA 5EE5B 3VYWA 2VBIA 1MC5A 2ATEA 1RBYA 4REOA 3M3DA 4Q02A 1T4MA 1ZNWA 1LS1A 5LBUA 5TB5A 3RYFB 5BMVB 2DETA 2DU8A 4GPEA 1KFCB 2Z08A 1OY1A 4R2LA 1ACJA 4AIIA 2O57A 3JATA 4Q7EA 1E5TA 2HA3A 3PYLA 2R7AA 3S1AB 4F3KA 1WHTA 3RYCB 5G3ZA 3IV9A 4NYMQ 1Q3TA 5HS4A 5T41A 4O8CA 3GO4A 4MZXA 1Z08A 3NQ41 4N0QA 2IZ6A 1JEYA 2BFDB 3RM3A 1YMVA 4QC2A 1PBNA 4R2KA 3BWYA 3K09C 4AKGA 4JVNA 1T2DA 3DYVA 4GX5A 2XTAA 3L4EA 3ZWMA 1WP4A 1PUJA 3JYHA 5B7PA 1PEYA 3TIVA 2AD1A 1UBJS 2UYOA 2VPZA 3FHLA 5CVTA 4UKDA 4GH5A 1IY0A 3G2IA 1J0DA 4ND8B 3FF4A 1VRVA 4FN4A 5KBYA 4ZHQF 1UM8A 1RLJA 1G59A 1K27A 4KMOA 3HO1A 1QKJA 1XZLA 1MQ8B 5LBTA 5CT8A 3DVSX 5FKJA 3ZWNA 3OJFA 4W8GA 1BN7A 1EHIA 1YS4A 5SY9A 3ROFA 3W5SA 3H5IA 5CH8A 4I8DA 4BQFA 3KAJA 2GXAA 4FT2A 4BNKA 2PT7A 5J47A 2RK3A 3BMCA 1HDCA 1ZRNA 3MGGA 4HDAA 5A1JA 5JZBA 1WQ3A 1S8AA 5EJAA 1CP3A 3DHYA 2X0IA 4QNNA 5G4KB 1NNEA 2JIRA 2EFHB 4MUXA 1M9NA 1NYTA 2FV8A 2HD4A 4HH3C 3A04A 5F3DA 5JMWA 1GSIA 1NJ6A 2XMRA 3GIDA 3L8YA 4B5KA 4DOMA 5ITSA 4KQEA 3P9IA 3RYTC 1JR2A 5PGMA 4EKNB 3F7OA 3GJ0A 1NJSA 2QN6A 5IJZA 3U19A 5HA5A 2FPSA 2YFYA 4PLHA 3UFBA 4FE4A 2YHAA 2BWJA 4ZI7F 1OA1A 2JAOA 4QHTA 5KQMA 2DBZA 3JQFA 3IUQA 1GZUA 3O3MB 4LC0A 1P29A 2QBYB 1X38A 3OWXA 1EQAA 3C5CA 3P4YA 5HG0A 1CU1A 1JKIA 3KYCB 1LNSA 3DV0B 4AUMA 2POQX 1P9WA 2XQJA 1LPPA 4FLFA 4DYDA 2P9CA 4ND4A 1ZMRA 2IV2X 3JQ9C 3OFNA 1KO5A 5ILGA 3HYLA 3RTBA 2HH9A 4C7KA 4F9FA 2P4HX 4Q4AA 1MO4A 1SXJB 1ZUD1 2NUPA 2PZGA 3PJDA 3R0IA 1C9NA 1HETA 3U1TA 4ZI3A 2GK7A 5J2TA 1V5WA 1YZNA 2MU1A 1LBQA 3F5DA 1X1RA 3HEAA 2I2AA 2W0SA 4KVAA 2R5FA 2VPWA 2VSXA 3BERA 4R1PA 3LE8A 4HO1X 2WD7A 4ER0A 3IEUA 1CYDA 5CCXA 4JJ4A 3T3OA 3N28A 1ZD3A 5C1DA 2ZI6A 5FWYA 1RLMA 1F0PA 4B71A 3WIVA 4JNCA 1U1CA 1Y89A 1EK2A 2HREA 2JGDB 3HGMA 5TJHA 4EW3A 3FYTA 2ZYDA 3BGOS 1J2YA 3BICA 2QX8A 3DP9A 4GGMX 4K9NA 4XSGA 5LYJA 5KTMA 5AKLA 1GKUB 1I30A 3DEYX 5ALDA 1H85A 3KPJA 2D1SA 4EOGA 3U6BA 4BLSA 4CGZA 4EL5A 1K5HA 3EDRA 4DDUA 1SUBA 2AN1A 4KN6A 1BYUA 2JGKA 3CNOA 2R6DA 3HI6A 3GGPA 3GA0A 4PWZA 1OT3A 1IDN1 4D0SA 4Y9UA 1LPAB 4HVLA 2D74A 1YI8A 1Y3FE 3D7SA 3LBFA 5EQFA 3JTEA 3O91A 4EEKA 4BS9A 1TLFA 3HS3A 4XYBA 1P31A 3BMNB 3DOEA 2UYCA 3HVJA 3FOFC 3Q3JB 2P9YA 1XCLA 1CUEA 4UQLA 2P78A 3GL9A 4JKYA 1I33A 1V48A 1V7PC 4HEA1 3EDOA 1PVOA 1EXMA 2C95A 2IXDA 3N2IA 4K0RA 2FUEA 4X1KB 4ZO4A 5AVRA 4H0CA 1SZPA 3RT9A 2X9GA 4LJ4A 1H6CA 1IWBB 3B1WA 2BR4A 4GG1A 1FUYB 4QJ5A 5HTKA 3ZIUA 1JILA 2P3SA 4XGKA 1BXRB 3ZXUB 4UE3S 1OU0A 1RABA 3MJSA 1DARA 1PIWA 4OK6A 3FPJA 2J0EA 3ORSA 3CRRA 5DP1A 4EFDA 4KWHA 2Z6UA 1WD7A 1UXJA 2J41A 4ARZA 4E1AA 4ZYWA 2VR1A 1KAOA 1RXYA 1USVA 3A0UA 5KSWB 4B4VA 4MDYA 2GD6A 4HGYA 2QRVB 3ND6A 3TLCA 2AI1A 3VH2A 4C05A 2P4QA 2A9OA 1DMRA 3DJYA 2BC9A 4P5DA 1MA0A 4E33A 2ORWA 1JEAA 2HHCA 1FUUA 5L3ZA 3KB1A 1TJNA 3ZDEA 1WM1A 4WKGA 5EZ5A 7ABPA 2WUWE 5U1PA 3LRTA 3UOAB 5A3VA 3RFXA 1MC4A 1EEHA 4G1VA 2D62A 4HXGA 4PYLA 4L27A 3H2ZA 3P9XA 4J2TA 3VBCA 1D5WA 4HCJA 2E4ZA 3VFDA 1Q1BA 2XRMA 3Q7QA 3EZXA 1K8QA 1YZ3A 2JFHA 1CRZA 1A9SA 1SGWA 1L3CA 4RHTA 1VBKA 2D1FA 5DBHX 3U5TA 2KWIA 1C8LA 4YMVA 4GOJA 3TTWA 5DCUA 2PR7A 5LB2A 3PUZA 4ZYLA 4Q3OA 3G9UA 4RXMA 1YMQA 5AW6A 4XVRA 3R20A 2QGZA 1FJGB 1FB5A 1VCIA 5JTTA 3M6LA 4BGVA 4WZAB 2DULA 3T4EA 1K89A 1MN6A 3FPCA 1UPCA 2GUGA 3KELA 3L1JA 4DPLA 1B6GA 2A1UA 1RQ7A 1YCFA 3NHZA 2BELA 4JBGA 1Z29A 4IV8A 3IQFA 2CV2A 1X77A 4JOBA 4PGHA 3S5UA 1NR1A 4MWEA 1DAGA 1G20A 4X3OA 3RSOA 5BT8A 5LQJA 3IA2A 4RFSA 4I5IA 1KSGA 4DRYA 5KVSA 4A36A 3HNOA 3DOIA 4GMDA 2HU5A 3UAYA 4B4OA 3RKSA 2OOKA 2GKOA 2B78A 1JB1A 3PXGA 1AQJA 5SY4A 1OC4A 1LVGA 2J3EA 4IZIA 4X90A 5EP3A 4ZVSA 4AZ3B 4OHYA 3NZEA 4RPHA 1DEXA 1ODJA 3DZBA 4KODA 3MWGA 4PYMA 3NW9A 2QJOA 1H9CA 3UV3A 2J0UB 2JZOA 3ICPA 4KDFA 2NO0A 3SQOA 3AKCA 1QSGA 3MRVA 4OMUA 1SWVA 1SN7A 1XTVA 1FZTA 5G0UA 3WV5A 2IGTA 3EZYA 3NC0C 4NU5A 5A6VA 2DCMA 3NNSA 3P26A 2DPLA 4FOLA 4LA4A 3DBRB 4ML3A 2YIDA 3GDWA 4DADA 4DCSA 4DA6A 1HRDA 1XKLA 3CRNA 2R5WA 3NB0A 2OFOA 4S1OA 1Y3IA 4ZQBA 4ZEOA 1AGXA 1U8XX 2A9QA 4J9UE 5D5PA 5FPPA 2G8NA 4D82A 5HIAA 4O2RA 4GICA 2RGGA 4A0QA 2X2FA 2LBPA 2BFAA 4R6WA 1Z0ZA 1TKBA 1DBRA 3R09A 2Q62A 2ZVDA 3DNPA 4PM4A 4RO0A 4GP7A 4CL8A 5AVTA 1Z6YA 3ZPXA 1N9KA 1YR3A 2RGDA 3I5AA 4TWJA 2JCXA 1VRCA 1YBVA 3IUPA 3QW2A 4KREA 1W0CA 2EYQA 4YNBA 2VZLA 1EB8A 4AJHA 4L2IB 4QDKA 5FI1B 5HDBB 3CO0S 3MOIA 1XUOA 2XVYA 4LXYA 3D4BA 1S9DA 3OQIB 3NBKA 1O6GA 4NESA 1BGVA 1P2BA 4XIFA 5DT9A 3E03A 4D9FA 3S2GA 2H85A 3IVAA 1UBMS 4K03A 1XMJA 4C4XA 3MRTA 4GI5A 2QSZA 2VSOA 2RG7A 3U26A 2FK7A 4HNHA 2CB0A 4PLFA 3LDHA 4X41A 3RU2A 4C2BA 5K0ZA 5KJFA 2VYFA 2JNWA 3B36A 2B9EA 2IHKA 4P4GA 4ZICA 4I8XA 1VRWA 1Y8QB 1HG1A 2K2WA 1WQ4A 2EXXA 1FSZA 4XR4A 2O1SA 4U2DA 1MW8X 1A4XA 4GPIB 4HS9A 4K9DA 3ZW8A 1I5EA 4OA8A 4B3SB 4OATA 4EZEA 4BP9A 3FHOA 3PFCA 5BYKA 3ZZTA 1AKRA 1HH4A 1WE2A 2Q9CA 4URYR 5JS7A 3QITA 4KIGA 2NMVA 2HK8A 1U0RA 2DTXA 3QLUA 2C2HA 3UH0A 1X13A 2RBKA 2PEZA 1A5SB 1QZUA 4PONA 4E4YA 5BSGA 2GD1O 2P9JA 4GEGA 2G3YA 4LDAA 2WQZA 3WYGA 4P4SB 3KKLA 1LKZA 4JI5B 2IEGA 5IULC 1CDEA 1T2NA 5IBQA 2P6UA 4HQLA 5KYVA 2GN2A 5FTLA 5B58T 3A26A 1UMDB 3FFTA 4CKBA 1E59A 4UJ5A 3CX4A 3KEFA 3TCNA 3BTVA 1CCWA 2QTMA 4BRSA 3W7VA 2VCEA 3VR2D 3MWJA 2GDJA 3GCZA 3MIZA 4OFWA 4OQZA 4DABA 2DFPA 1XRRA 5LMCA 4F21A 1EFHA 1UJ6A 2ONZA 3DDWA 5CR9A 5GMOA 4F7DA 1GEGA 4RTNA 5K0NA 3ZDCA 4N54A 5DU2A 2G0TA 2ZRFA 1DEAA 3NVDA 4ZU6X 3EZLA 2CNKA 1GP2A 1QZ3A 1K06A 8GPBA 1JHAA 2XCIA 3W4KA 1QWSA 3VHXB 2HNKA 2FK8A 2PFKA 4D02A 4KXLA 3N2YA 1MAWA 1P45A 4KSYA 5CDSA 1RWWA 3ESRA 3M33A 5G1PA 1QHHB 3MLAA 3ET5A 3P2EA 2R6FA 2NU9B 1DTSA 3ANSA 5JYCA 1EWYA 1QHYA 2XMDA 1ZR4A 3AJ9A 5E8JA 2YDYA 1SU8A 4JX8A 2RC6A 4FYYA 1TM7E 3S5JA 1E6LA 1ZMOA 2FX5A 2OHVA 5J4HA 1H65A 4O5AA 5ANRB 4KQ2A 4UM8B 4EHLA 4LMBA 3N07A 5H0IA 1JH8A 4UZEA 5H68A 1HMYA 1U80A 2IPMA 2OO5C 1W1UA 3LOPA 1J2EA 1M67A 3FPFA 2YHUA 3EZ2A 1CHDA 3FNRA 1CUGA 3QXXA 4FS3A 4P5PA 2WABA 1CB0A 4G84A 2WMOB 3LX8A 3U7QB 1XCBA 3EFHA 4I08A 4JSTA 1HE8B 1SUCA 2DHCA 3JRXA 4V0SA 4CEIB 2XF8A 1JX6A 4GSKA 2GZ3A 2W2LD 1LFDB 4IINA 3WLIA 4HTAA 2WYWA 3DBRA 4D0LB 2QZSA 3ORRA 4DR6B 1DAOA 5E9JA 4R5MA 5MDHA 3TZEA 3G8CA 2D3WA 1F20A 1NV9A 3GAMA 3N8GA 3KLBA 4EJ0A 1WCXA 1PG2A 4HEA6 1PR6A 1QXSA 1YBAA 3BFPA 1EXDA 4OV6B 1RNLA 4BMXA 3CC8A 5FI3A 4ZYXA 3EXFA 2N42A 3V34A 5LZ7A 3H97A 4YTEA 4RZQA 4PC3A 2QU8A 4TOIA 2H1IA 3GLKA 3OF2A 2IXFA 2VF4X 4OJTA 2WWVD 4PG4A 1IG0A 1RPNA 1JQLB 2BLLA 5B3AA 4LOKA 2FMIA 2PFSA 4MRNA 4GECA 3U9TA 1E1DA 3JWJA 2FP3A 2V6JA 4J4HA 3RG8A 4KITB 2GO7A 1I10A 1R0WA 1UJ2A 2JVKA 1R8YA 4P1ZA 1UZLA 2P65A 2OCYC 4F5ZA 4IOKA 1UK6A 3KUDA 5TT1A 2Q0QA 2R84A 1E3LA 1EFPB 3HCFA 4RH3A 3WMEA 1XDDA 3WQQA 1F7VA 2FJ0A 4N0DA 3WFZA 4XGNA 3UUEA 5J23A 2EIHA 4LYHA 2QB5A 3NJ8A 4N65A 1WHSB 5ESWA 1ELOA 5COAA 5GJBA 3OZBA 4BU0A 2BFFB 1YR6A 3HCCA 4LDQA 1SWWA 2DHQA 3TDMA 3RVPA 4W5TA 4X5OA 2WWYA 5ALIA 3NAMA 4D80A 3VKHA 3A4NA 4BIIA 1MQSA 2ZI7A 3V7WA 1H93A 1GUFA 1BRMA 4KX5A 4KXYA 3AUUA 2QI9C 4D8VA 5D00A 5DI9A 2ZWAA 4X8MA 4YI5A 5C5DA 2BHNA 4FCTA 4W5RA 2CWWA 4MS3B 5K6AC 1VIYA 5F23A 1K88A 3ENQA 3GJTA 3GPBA 4IEEA 3SHOA 4A26A 1GQFA 1OX4B 3M8KA 1BJRE 1YOVA 4C4ZA 4NCAA 1QV7A 4MKFA 1GNVA 4MEJA 3UGTA 2R8PA 3U48A 3LVQE 2FSFA 4PZCA 2Y4NA 2HRZA 4IH1A 3AY7A 2QQEA 2E82A 1E2IA 3ELYA 4QTXA 2QP3A 2IEAA 2YBDA 3IE0A 2O8VA 4LZZA 1GD1O 4GVPA 1P1IA 5ELMA 1QS0B 1F51E 1NXVA 2FLVA 4KWTA 3U13A 2EGUA 1FMLA 1AG9A 3HRIA 2C8JA 2QAGA 2R85A 3PCXA 3Q7SA 2O3SA 2YFKA 4P82A 1MABB 2C96A 4MR8B 4Q4JA 1CXZA 2WJHA 3KIPA 4UE2A 4V0LA 2XT6A 3BH6A 1FIUA 3ENWA 4EG0A 2H4HA 3DJFA 4M49A 1DQNA 4EH1A 1CJUC 2XLCA 1E4VA 4L78A 4X60A 4IIJB 4TRNA 1JLHA 2ZI4A 3HLKA 3INYA 4TS4A 4PZYA 3DFKA 3FJOA 3RUHA 1NV8A 1OZGA 1EU1A 1MJGA 3JVEA 3GNQA 5JXJA 1KAHA 4QUAA 2DWUA 4F84A 4WT7A 1YB7A 3AKYA 5A6SA 3NDRA 4CUZA 4DRZA 2D5IA 3AUFA 4ANFA 1A95A 4G01B 4D9KA 1EFAA 4AKIA 4CQMD 1YUBA 2OHFA 4HGOA 5B1DA 1Z3IX 4IDQA 3KEMA 5F33A 3WB1A 3UUGA 3B8EA 4KWCA 4MQBA 3V5NA 3VZRA 6YASA 4YS6A 4D0NA 4DT1B 2BGGA 1XHFA 3P9YA 5ULLA 2C99A 3L7YA 2R25B 4I6JA 1L5FA 2W2PA 3K05A 3L84A 3OI7A 3WKAA 4QU9A 4IQGA 1P5HA 3N2KA 2AD5A 5AW1A 1JA0A 3N3AC 3LLCA 4KXUA 3AEUA 3K0HA 1CNFA 3F4KA 3JV7A 2YRXA 3G88A 1AA6A 3WJ2A 3QXJA 4M99A 5UKDA 5JVDF 3Q3EA 2AC2A 5JC1A 2H16A 1GL7A 3FMFA 4NU6A 1E0KA 5KCMA 4QHYA 5CT5A 4LWQA 5ERGB 1EH5A 3R24A 1H0RA 4CHTA 1Y1SA 1IHOA 5E6RA 4ZEWA 1N77A 2IYTA 3FTDA 3D8HA 5A2QA 5BNFA 4CMEA 4KO1S 1ULUA 2JHCA 2O4CA 1IHUA 2V1UA 2ZJYA 3EWIA 1QQ5A 4JJ6A 2VUSA 1PR2A 4MUKA 3RF7A 2QDKA 2Q46A 4U7JA 1Z0IA 3HDQA 4LVNA 2G25A 3K2BA 4X54A 5GONA 3WMGA 1AV7A 5F2NA 5EZYB 1ORTA 1OWOA 4KLCA 4V39A 4ZJZA 3OKPA 4HADA 1IE3A 4S0ZA 1DKPA 1KC1A 1YBHA 3LCMA 1JAYA 1FE8A 3K53A 3RE1A 3VR6H 3DT6A 1PWXA 3RIGA 1CR6A 2J3IA 1GYQA 1SC3A 1SKAA 2YVLA 1M66A 1J07A 3HPRA 2WI8A 4HEJA 1HQYE 4MTLA 1SD2A 3ZV5A 3EMBA 1JLSA 3HU1A 3BCRA 4MMXB 3PFFA 1SUSA 2VJMB 2GH1A 3C43A 3IQDB 3FNQA 1DAKA 5C8YB 2KPOA 3IQEA 1AGRA 1QANA 2BFFA 5ALSA 2X8WA 4RKFA 3QBVA 4H7FA 2OSVA 1U3GA 3KS9A 2P2SA 2K2QB 2Y3IA 1QGDA 1ZIXA 4YJGB 1OUMA 3ZY4A 4BASA 2V7VA 2WM8A 1JN0A 1NP6A 1GPAA 2G17A 1DU4A 3PPWA 1KYWA 5CK5A 1XVLA 2G4VA 1C9MA 2BI8A 4PCVA 4QODA 4RLQA 5BUSA 3SM3A 3JX9A 1G4UR 4RV9A 4DJTA 1QJ4A 1RTTA 4WLOA 3E9RA 1RKQA 4JT9A 4S24A 4YAGA 4G9BA 4OI2A 1H23A 2J1LA 1ZNYA 1VCMA 3RSGA 4Z1MD 2I3DA 3TI7A 3SVLA 2GNAA 4MVJP 2R11A 1I80A 2R97A 4KSBA 2WHPA 2DR0A 4ARZB 4ZVNA 4GD3Q 4N3NA 1KI8A 3K94A 5EIOA 1KEKA 3WAJA 3QI2A 3SX2A 4KXMA 1X87A 3E2MA 3TJZA 4BRUA 1T4CA 2RDMA 3CFYA 1XR3A 1DCKA 1Q95A 4U7PB 4F0JA 3GVPA 3HYCA 1JWLA 4JJFA 2C1XA 4FONA 1PFQA 3Q72A 4TTRA 3VGJA 1UPTA 4UNNA 3H7AA 1NVXQ 4L8LA 1SNYA 2CVQA 4V03A 1NR7A 2ECQA 2D54A 2CUKA 1X74A 1LV8A 4FR2A 5KOHA 3KSAC 1A8UA 1YASA 2A0FA 2FWBA 2P79A 2VP5A 2XDYA 3CLUC 5C4GB 3W9UA 3ZUPA 5FOVA 3T5BA 4MP6A 3NI2A 1OIXA 4DQLA 5G3YA 1W19A 2W2KA 3EOBI 3I4CA 3OCJA 5KOJB 3I9OA 4RHCA 2D0PB 5JSZA 4DDKA 3ZCTA 4OHBA 3KSUA 4WZBB 1T9GR 2ZKLA 3PQ8A 4L9RA 2FOXA 2A4MA 2GQ0A 2VZ0A 3PVSA 2PZEA 2WRZA 4ID3A 1V11A 2HHLA 2ZOSA 3V00A 4F4UA 2IZ1A 4MYUA 1A4UA 1D2RA 4ZCTA 4FMDB 2J59A 4RVNA 4NMWA 1WIWA 3Q87B 4PZUA 3IDAA 3FUUA 4N6NA 4O02B 4BO1A 5AP9A 2ASEA 3WGUA 1K5DA 1EE9A 1LK0A 3GN2A 1M76A 3TUJC 4C88A 2F67A 3ZKAA 2QRGA 2PS0A 2FG7C 1L7RA 1J7JA 1NF2A 1XTTA 1Z4MA 2V74B 4GBGA 4L9WA 4F4JA 3VPCA 3U4QB 4QTTB 1JECA 1TA0A 3L8GA 4NOLA 2IS2A 2B69A 3AUSA 3N74A 1JH9A 2V9ZA 1LV7A 3W4IA 3AYZB 1Y6JA 2NNLD 4KRGA 4YAIA 3ADCA 1UKAA 2RGUA 4O59O 3X1ZA 1WXQA 5HZKA 5JY1A 2PA3A 2XWJI 4QPCA 1VJRA 1D6SA 1DRUA 4BBAA 3GP3A 4BCDA 4LF4B 4YP9A 2G06A 5EI5A 4GLFA 3IIMA 2NPIA 4GOND 3OCCA 4TTIA 2P67A 4Y9SA 1EFTA 3K5IA 1XVVA 1J2TA 1FP6A 2AEEA 2GVNA 4HC4A 4A23A 4ARUA 2HQOA 1IC6A 3OZFA 1XP5A 2QXUA 4W8OA 3LHDA 5FEMA 2VZ8A 2HT1A 2FXIA 3V7FA 1H3NA 4Y6LA 1RLUA 1TFUA 4F9TA 3G5LA 2FE1A 2JAUA 2GEUA 2JBHA 2JHAA 2Q5OA 1QPBA 3QY0A 4GKAA 4MR7A 4RK5A 3RBZA 3DNMA 4XPIA 3SK0A 821PA 5GTDA 4XH9B 3REQB 2VAPA 3ZTYA 1ZN2A 2G88A 2IYXA 5FFMA 1HYHA 1U7HA 3RUPA 3STHA 3SX0A 3L0SA 3MYYA 1GNPA 2D1RA 5E3HA 4D3YA 3OPVA 4WSOA 2AI3A 4UTOA 4B7XA 5IM4A 3KJQA 3HE3A 1KO8A 3PYMA 4MKIA 4RZHA 4LGVA 1U0GA 3J81k 5I9MA 3HMQA 4O0MA 3UJ6A 2Q99A 1N1MA 2POCA 4B47A 2YOFA 4AG5A 5ED4A 3I5YA 1T5BA 2IXBA 2HA7A 4INJA 1O54A 4P4UA 4J49A 4RY2A 1ZRHA 1FVOA 1YBMA 2QTBA 1AIPA 1H4TA 3L05A 2GPWA 4N49A 4YMHA 5EGSA 1K66A 1MQ9A 2A78A 2X8BA 2GHIA 3N86A 2ZJ8A 4P6VF 4DDVA 3U5ZB 2DWCA 3PKIA 3OX3A 4FGJA 4KBFA 4CLDA 5JS6A 3CRZA 3UIEA 1E3SA 4PRKA 2R8BA 4YCNA 4KIWA 4NAHA 3K1AB 3NIBA 2CYCA 1Z4IA 1UC5B 2F1OA 3G5MA 3WYNA 1J8MF 3C3MA 4UXIA 4ZVVA 1GDDA 3BWEA 3PUKA 4QBKA 4UD6A 4R7TA 3JQ6A 1ZAYA 3BFJA 4DREA 2GM4A 1G64A 2C4KA 1R12A 5JJKA 4K87A 4HZUA 1EAYA 4PGGA 1SBNE 1VZ2A 2GESA 3CWZA 3HCNA 3AF2A 721PA 4G25A 1AO0A 3KQHA 4DLSA 3TBFA 4EYOA 2VO1A 4WCDA 3FPEA 3Q12A 1L5ZA 5DEIA 4ZIRA 2MSEB 1KSJA 3PR1A 2PO5A 2F48A 3L7NA 1GL9B 2OORA 3OFSA 2JRLA 3H3XA 3L4BA 2RH9B 1S2NA 1S3IA 4NQRA 4DHWA 1MZPA 3V32A 2F55A 4XRRA 1O9HA 2VYVA 2DLNA 2FUNB 4IRUB 4P3YA 1YO6A 5EWMA 3H6GA 3TRIA 4TX1A 2O0MA 1MAVA 3EIQA 4WN3A 1T24A 3GQVA 1UJ5A 4Q34A 2O2JA 2RB5A 4IS3A 5IM5A 5I7HA 5MGBA 1QMGA 2V97A 5L8VA 6AT1A 3WO1A 3DAPA 3GT4A 2NVUB 3MAAC 1AZWA 1WB6A 3FOWA 3T3IA 5GZ3A 1VSQA 3ZLUA 4DQVA 1XTBA 4LJSA 1YKGA 5KNDA</