5L9AA

L-threonine dehydrogenase from trypanosoma brucei.
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
321
structure length
321
Chain Sequence
HMPRVLVTGALGQIGTDLSLALRDKFGADSVLVSDVVEPGAKHPLAGLKGVEKLDCLDSNGFEKLVKEFKPTWMYHLPAIMSVRGEAEPDLAMDINVNTTRYALELARKYNIRIFIPSTIAAFGDKCGKTMTKDDTIMNPSTVYGVTKVYTELLGTWYRQKYGVDFRSVRLPGIISAATLPGGGATDYAIHMYHSALLQKKCVCPVLPYESLPMMYMPDTLNSLVKIMEAPLEKLTRTVYNITGFSFSPSELRFSIERCTDRTIEVEYVEGPAQKIANSWPDSLDDSNARNDWGHQVKYDIDMMSEDMLRQIPILHGLPSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-threonine 3-dehydrogenase
publication title Structure and function of L-threonine-3-dehydrogenase from the parasitic protozoan Trypanosoma brucei revealed by X-ray crystallography and geometric simulations.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 119
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2016-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5l9aA00
2X6TA 4YJDA 1D1SA 5AXBA 2JFFA 2WYVA 1GV0A 4MP6A 4CV0A 1HDRA 4J9UE 3GZNA 3QLJA 1C14A 2GN8A 5JSFA 2Q4BA 1O89A 3OJ0A 2GN6A 3MCVA 1XU9A 3GPDG 3JQAA 1OBFO 1PU2A 1F14A 4IJVA 4EJ0A 1OZAA 2O3UA 4IGFA 1KVRA 2WSBA 1JA9A 1LLQA 1D7OA 4YDRA 1AN9A 1LLDA 1YXMA 3F46A 4YT2A 4OQZA 4GLOA 4L4SA 2DTDA 1SOVA 1TT5A 4G2NA 1A4UA 1ZK0A 4CODB 3ZHYA 1T2AA 3CUKA 1EUDA 3GG9A 2PY6A 4WNCA 2EJWA 3IJRA 1EFKA 4PZDA 3HE3A 3DBRB 3WYEA 1IHXA 1P74A 2OHXA 4U6SA 2OOSA 3KSDO 4CJXA 4EUFA 1YQGA 3OH8A 3KXDA 2XXBA 2O7SA 3WNQA 1N7HA 1YBVA 4NK4A 2IYPA 4DA9A 1ZMTA 1MB4A 1MC5A 4XGKA 3GNSA 2PTGA 2W2KA 4QO7A 4IINA 3UH1A 3TZHA 1DFGA 4MIOA 1VM6A 4R1UA 4TWRA 1GZ4A 1H2HA 4CMEC 1UP4A 4NMHA 3PYXA 2BGKA 2ZTLA 3W1VA 3D64A 5FI3A 2ZK7A 2NVUB 4CR8A 4IQGA 4DC1A 1HDOA 3EYWA 1ONOA 3IP1A 4WKGA 5L95A 3F6YA 3FPLA 2H6EA 5L4NA 2C5EA 1QYXA 2XOXA 5JXWA 4ZU3A 1N1GA 3DTYA 2F1KA 2HSDA 5T6BA 4BNGA 1ORRA 1K5HA 5I8ZA 1YKFA 2D0IA 2QG4A 3EDMA 5HWSA 1AGNA 3GAZA 5JC1A 4WCFC 5BSHA 1QP8A 4DGSA 4PRKA 2V6BA 4BNKA 1DPGA 3NT2A 4DQUA 2P4HX 1U28A 4E33A 3QVWA 1LBEA 3ZU3A 3RKUA 1E7RA 3EY4A 1OC4A 3W4JA 1IY8A 1KBZA 2JCXA 4QTZA 4BO9A 2B4RO 3JQFA 3K2EA 4F3YA 1U8XX 3G17A 4TVBA 5DT9A 2J8ZA 4OIMA 2GZ1A 1W6UA 3H5RA 1EUCA 4AVYA 4BNZA 5LDHA 3MOIA 4Z9FA 1BHSA 1VSVA 2DU8A 4LISA 3KV3O 5COBA 4BO2A 3QVOA 1J49A 1LRKA 3WX0A 4YXFA 1F06A 3M6IA 3OFSA 3OEYA 4BO6A 1B8PA 5T5QA 4RDHA 5ER6A 1SC6A 3ZNQA 3AM3A 1JW9B 1R0KA 5JCJA 5C7LO 5I9MA 1P77A 4CQLB 3QV1A 4QECA 2AXQA 3K8ZA 2GPTA 1PJ3A 2CY0A 1ZSVA 4RJTA 1P0FA 4G5HA 4OJNA 4AJKA 2DUWA 2CVOA 3P7MA 1H9AA 3EAGA 1CIVA 1NFFA 3M2TA 1VPDA 1GTMA 4DIFA 1FF9A 3ZWPA 3L4SO 1D3AA 1PQPA 1UUFA 2UDPA 3H2ZA 3RI3A 3UXYA 4I5DA 3KSUA 3DZFA 3R0IA 1IUKA 1BDBA 2DQ4A 2X4GA 3BMQA 2VQ3A 1R66A 4L8VA 4HNHA 3TL3A 1GAEO 2FZEA 3S2GA 3FBGA 1NTOA 3M1LA 2VYVD 2PD6A 4JROA 3RJ5A 1R4NB 1KVQA 3CINA 1ZZEA 4XGIA 4Y98A 4DMLA 3GRKA 3RFXA 2B5WA 3BMNA 3L4BC 4JGBA 2QX7A 2HMSA 3WSVA 3ORFA 1Y1PA 5A06A 4MVJP 1GU7A 4ND2A 1ADFA 1NR1A 5DCYA 4C7JA 1KC3A 3K9QO 3KHUA 2J3HA 3DOOA 4FFMA 3RUEA 3L07A 2O2SA 4B8WA 1EEHA 1KY4A 3AUSA 3DEYX 1BGVA 1YDWA 3I1JA 3KUXA 1GR0A 3GGGA 3PGXA 1WAMA 1X7DA 1SB9A 3WWZA 4GGPA 1UZNA 4PCVA 3SJ7A 1U1IA 3E18A 1FK8A 3IKTA 4DWVA 1I2ZA 2ZJ1A 4GSKA 4Z0PA 3TOXA 3CTMA 3PWKA 1YQDA 1F8FA 2IXBA 1PZGA 1QORA 3L0DA 1Y81A 3ZNNA 1DC4A 4BKPA 3A28A 4NBWA 4PLCA 1HE2A 3ZNPA 1RYDA 1PWZA 3RBVA 2CDCA 3BAZA 5HRUA 2P68A 3BTVA 4WLEA 3D1LA 5TSDA 5COAA 4QT0A 2D3TA 3VOSA 4XYGA 2UUPA 4MDHA 2FP4A 2PLAA 5C7OO 1I3LA 4E5KA 2JD0A 3OQ6A 2D5AA 4RV9A 4E5MA 3SBOA 3OP4A 5A4DA 3MJCA 4J90A 5G4LA 2W98A 2DFDA 5DBGA 3EW7A 3HQ4O 3AU8A 1JVBA 1E1NA 1LX6A 2C82A 2LDBA 4H15A 4UUOA 4XZ3A 3HSKA 3ULKA 2C07A 5FYDA 1WLYA 4UVIA 3ZH2A 1E6EA 3C1TA 5JS6A 4UVEA 2NM0A 1Y8RB 3JQ6A 4IUYA 1H6AA 3V2HA 1A4IA 1GD1O 3ZW9A 4W9NC 4ZJUA 2VHVA 3GVHA 4DIOA 3ZWNA 5F21A 5AYVA 3PYLA 4CL3A 5TX7A 4ZHSA 2B4TO 3AUUA 4DIBA 1QKIA 4PN3A 3ZCXA 3S8MA 5EMHA 2HAEA 4XQGA 4EW6A 1ZNQO 2C2YA 3FN4A 4GX0A 4Z0HO 4IXTA 3SLKA 5L45A 4XB2A 3VZQA 2X23A 3PEFA 3DL2A 4BKOA 3FR8A 3D4OA 4WOJA 4I1IA 4D3FA 1KVTA 2A92A 3ANLA 2JCVA 3CEAA 4BB6A 5JW6A 4ALLA 1I01A 3VH2A 2ZQZA 3GMSA 4J7CA 3FNHA 3NJ8A 2ZCVA 1SB8A 4FN4A 5EIOA 4AL4A 3FCOA 1XR3A 1V35A 3U4IA 1GYRA 4YWJA 4L76A 5JAQA 3PFWO 3RUHA 1EQ2A 3QA9A 4G81A 4YRBA 4CLRA 4TRJA 4Q3BA 5A03A 2QQ5A 4A73A 1E1MA 3PHJA 2Y68A 2DT5A 3JQEA 1NBOA 4MVJF 1O6ZA 3C3XA 1MX3A 1VLLA 3TZKA 1MA0A 4PG5A 3UFXA 5FEUA 2GDZA 3I83A 3U0BA 4ZD6A 4IBOA 5KCZA 3ITDA 2X58A 5IDWA 3AM4A 3BMNB 2GYYA 3SC4A 4GH5A 4MKRA 4RPJA 1Z45A 2Y1OA 1YB4A 1E5LA 2G0TA 1VL0A 3E9QA 4JXKA 1WZEA 3EVTA 2ZTMA 4M87A 2A9FA 3RJ9A 1NASA 1FJHA 2QRLA 4NQZA 4F6CA 4GVXA 4GLLA 2W2LA 1V9LA 3GLQA 3ZW8A 2X7HA 4H7PA 4M8SA 2EP7A 3GVXA 4IIVA 2IE0A 4Q39A 1JAXA 3DZJA 3WGGA 4IDCA 1M6WA 3OETA 4XB1A 2P9CA 2ZB4A 4FJ1A 1HT0A 1OC2A 3GPIA 2EP5A 4LRSB 3MWEB 1PL6A 3TF5A 1EBUA 1X1TA 3RC9A 4YJHA 1PZEA 2DM6A 1GCOA 2IZZA 3OHSX 3K73O 2WWRA 5KVVA 4K28A 2X1HA 3ZWOA 5CG1A 4JN6B 4GWKA 3I4FA 3WLEA 2EERA 1EZ4A 1SOWA 2P4QA 3HZZA 1W0CA 4KUHA 4J1NA 1O8CA 2VRBA 2VOJA 3FSRA 4AJ1A 4OOEA 3RROA 1B2LA 1ZFNA 3ON5A 4OGWA 4A2CA 1CEQA 2VWGA 4R41A 4AJIA 3P19A 4GL4A 5ILGA 4Z3DA 5A3JA 1XA0A 1TEHA 1KEVA 4HNGA 2DVMA 1NQAO 1EVZA 1YO6A 2FMUA 3K30A 3QWAA 3WWYA 1U5AA 1EVIA 4L4RA 4BGEA 3F1KA 4J4TA 2RHRA 3ZHZA 2O3JA 1XSEA 4C4OA 1G1AA 4R1TA 4A7PA 1DLJA 2VWPA 2CNBA 3B20A 4J1TA 1P45A 2WYUA 3GMDA 3C1OA 3QWIA 1NVTA 1NAHA 3I3OA 2DBRA 3R1IA 4Y6PA 3C7CB 1J5PA 5G0UA 1RM4A 2CF6A 1DJQA 4IGEA 4NPCA 3N58A 2POQX 2PH3A 1HDGO 3K92A 2VWQA 1T24A 2C20A 2F00A 3DBHA 4FJ2A 1XLTA 5DULA 5ENDA 3E8XA 1P1RA 1HSOA 1LUAA 1HETA 2VN8A 4FC6A 1QYDA 1Q7GA 1YOVA 2XAAA 3H7AA 1NPYA 4E12A 1PJSA 4II2A 4ALIA 4CLOA 1X1EA 2ZCUA 4Y8VA 5JO0A 2R00C 3DZBA 4O6VA 1T2EA 4GGOA 3E5RA 2Y1DA 1SEPA 4NG5A 4NJMA 3UUWA 4U5QA 3PP8A 4AJ4A 3F5QA 5L4LA 4UUNA 1ARZA 3WGIA 4RGBA 1LTHR 3IAHA 1E92A 3GEGA 2YFQA 1GPDG 4RVHA 3GF4A 2W4QA 3AUTA 1A72A 5EQFA 5KJ1A 1RM5A 2NWQA 2VNAA 2NTJA 3HJAA 1E3JA 1I32A 4BNLA 1MFPA 1PJQA 3X2EA 3GT0A 4D46A 4NU5A 1B8UA 1KY5A 2D2IA 5A1TA 4J2OA 4IDDA 2NVWA 4EZBA 5K6AA 1LDEA 1HLDA 4A27A 1IYZA 1U7TA 2WE7A 4PLVA 3JCZA 5G0WA 3OJLA 1J0XO 4YB8A 3PJDA 1F17A 1EMDA 5JO9A 4H3VA 3KEOA 1JLLA 2AMFA 3PWZA 1I8TA 2VYVA 2NQTA 4WOKA 4FFOA 3DWFA 1PGQA 1ZMOA 4RF3A 3ZWAA 4JJGA 4ZVVA 2BI8A 3A06A 2AEMA 5J23A 3F1LA 3NGXA 4PRLA 5FI5A 4CMGA 4LSWA 1YL5A 3JQ8B 3VDRA 4CMKA 1VL8A 1UAYA 4JP3A 2IODA 1NHGA 4BKQA 3OEWA 4PLGA 1UAGA 3ICCA 1ISJA 1PQUA 2IXAA 3GY0A 3FWNA 4FR5A 3DC2A 2EV9A 2P9EA 1DAOA 3VPFA 3WYBA 3BXXA 1ISIA 5TF4A 4DL9A 1TT7A 5BSEA 1RYEA 3JQGA 4GSLA 1G6KA 5BNIA 1ID1A 3DBRA 2H1SA 1ISFA 4BQRA 4WGGA 3RFVA 3QJ5A 4DXHA 2J3JA 1YWGO 4MVJI 2I66A 4YAKA 3VH1A 4CQMD 3QIVA 2Q99A 1DFHA 4BNYA 4ZICA 2QW8A 4B3JA 1B16A 3L6DA 4HFJA 3KYDB 5JE8A 2VHWA 3KETA 3DO5A 3A9WA 3TZCA 4D44A 4HX5A 2J3IA 3U62A 1I36A 1PGOA 1SBYA 4RLHA 1DBVO 1X14A 3MJVA 3Q2IA 4PIVA 3KSZO 4YBZA 5KJEA 2AE1A 3Q9NA 3QWFA 4CMAA 4YAJA 1VC2A 8ADHA 3OIGA 2NNLD 1NWHA 1CYDA 2XF8A 1DC6A 1O5IA 3O03A 4FS3A 3WQSB 1Z82A 2BFAA 3E1KA 2Y0DA 1K0UA 1R0LA 4GMFA 1S7CA 3ROMA 3IDSA 3KO8A 2CFCA 1KETA 1BXGB 2IEDA 7ADHA 2WDZA 5GZ1A 3CSDA 3Q1LA 1YE3A 3LLVA 2X9NA 4YT4A 1WMBA 2X9GA 3AOGA 1MG0A 3L77A 4NU6A 4ESOA 1CF2O 3RC2A 2GZ2A 4I08A 3BMCB 4FQ8A 1XWFA 4JIGA 1TI7A 4KOAA 3I6IA 5T8KA 4CUZA 2AW5A 4J4BA 3LU1A 5JDCC 4BKRA 4J0EA 3ZV4A 2Z5LA 3NT4A 2E49A 2AQ8A 3TFOA 1WDMA 1T2FA 1SEVA 1VJ1A 3DDNA 4YAEA 4DC0A 1RKXA 1V3TA 2O3RA 1U2DA 3H4VA 4XWYA 4GX2A 1DDOA 1HTBA 1Z75A 1E1KA 3BMQB 1KVUA 4PFJA 4EITA 5B1YA 3HDYA 5ICMA 2BGMA 4WEOA 3WBBA 2EWMA 3DMYA 3K31A 4OM8A 3AOEC 3JD3A 4MIEA 3WG9A 5JY6A 1HDCA 3IC5A 4BO8A 5A5EA 1LRLA 1UH5A 3DTTA 4OXNA 2ZKLA 4ZQFA 1JKJA 1TLTA 1DIBA 4ND4A 3D3WB 3V1YA 1P1HA 3TZQA 6LDHA 5TIIA 5JYDA 3NDIA 3C1AA 1O94A 3STHA 3WGQA 1P9LA 1IULA 3S2EA 2JKVA 4DQXA 1R15A 3KOUA 1GUYA 1SAYA 3HDQA 4WLUA 3VTZA 3SLGA 1CERA 1GZ3A 4J0FA 1B0AA 4XCVA 1PL7A 3WGZA 4ALKA 5H83A 2PKQP 3C24A 4TRMA 3WXBA 3NDRA 3DR3A 3DHNA 2FHSA 1N9GB 1QV6A 1NX6A 3JYLA 4PLTA 2X0NA 4JBIA 3ZWBA 1LRJA 2ZJ0A 3LC2O 3SXPA 3WQRA 3GVPA 3K96A 2RCYA 1E3SA 2GRAA 2UVDA 3VZRA 1LDGA 3ETEA 1MFZA 3FRJA 1Y9EA 3AFMA 4OAQA 4QQRA 4XD2A 3F47A 4E5NA 1K6JA 3AU9A 3NRCA 5COQA 5KJ6A 5KWEA 3JQ7B 3ADPA 3E5MA 1T4BA 3HB5X 5AXDA 3DZKA 4I5GA 4JBGA 2GF2A 3D3EA 3UF0A 1HE4A 3VPSA 4GI2A 4GMGA 5MDHA 1PR3A 2YY7A 4AJJA 2P9GA 4PLHA 3WQQA 3BMOB 1JN0A 2I5PO 3U3XA 4W82A 4BGVA 3KYCA 4NHEA 4BV9A 2GZ3A 4CM9A 4CV1A 2O4UX 3AI1A 1GPJA 3H65A 1PR9A 3V2GA 3JQDA 2JHFA 1FDVA 3PHLA 4CV2A 4AICA 1B7GO 2W2KB 5IZCC 4IJUA 2X5OA 9LDBA 2ZATA 4FSHA 1D8AA 4CMBA 1A7AA 2D59A 2O48X 3AW9A 3EGOA 5KJCA 4ALMA 3TRIA 1HDZA 3JYQA 4PVDA 2DC1A 3BHJA 1DSSG 3M1AA 5F5LA 2DBQA 4O63O 1XG5A 3PWSA 4IMRA 3LZ6A 3JQAD 5B37A 5MGBA 4KP7A 1V8BA 2ZB3A 4UUPA 2BF7A 4R51A 3FD8A 1QG6A 4P4LA 3D3WA 3GHYA 5KVSA 4YPOA 4CM9D 1GQYA 4ZRMA 5K9ZA 2O7QA 4RPKA 3WGHA 1B14A 4OXKA 3Q6IA 4BQPA 4QSMA 1PWXA 1BW9A 1GYPA 3BMCA 1GFSA 3FNFA 3MJEA 5TLSA 3JYNA 3KRTA 4BO4A 4NBVA 4BO0A 4J2HA 1ENOA 4CR6A 1I10A 2EKLA 3A14A 2JD1A 5L3ZA 3VTFA 2FY8A 2GGSA 4CMJA 4O1MA 3DZIA 2FSVA 4PLWA 1E6WA 3TDKA 4UVDA 3I6QA 3W4IA 3QWBA 1QRRA 2WD7B 3U49A 8LDHA 1ISHA 4AG3A 4J9VA 2EJVA 2VT3A 4RQUA 5F1KA 4CM4B 4WCFA 3W8EA 4BNWA 1XKQA 2E48A 4UEJA 4E2XA 2NACA 2C29D 1XU7A 3RBZA 4FFNA 1H6DA 4IQ8A 1JQBA 1EUZA 2WE8A 4U6QA 5THKA 5DNAA 4BS9A 5CFZA 4R54A 2I3AA 2P2SA 4TMFA 4YQYA 1LC3A 1R0SA 5DCWA 3V5NA 4WLNA 3QY9A 4MJLA 1Q7BA 4CM1A 1HYEA 3MWDB 1OMOA 1UXGA 3PHHA 4E2YA 4OXYA 3PHIA 3P2OA 1HYHA 4RVFA 4ND3A 1ZK1A 3UCFA 1UDCA 3GQVA 3W6ZA 4N5LA 3BZUA 3HWRA 3PRJA 1PX0A 5IZCA 1E77A 1BTOA 3RUAA 5JY1A 2VTEA 5EQDA 2HO5A 3SC6A 2X5JO 3F4LA 5CEEA 2E82A 2C54A 1EK5A 2CVQA 2RBEA 4CV3A 1I30A 3NKLA 2GD1O 2FPPA 4CLEA 4WCDA 5JPIA 1DB3A 1Z6ZA 4WE3A 2JHGA 3SVTA 2HUNA 5JC8A 2JCYA 3MZ0A 3VKUA 4UAGA 3G49A 5I7EA 5KKCA 4IDAA 3Q3CA 4IXWA 4IZHA 4R68A 1HLPA 1NQTA 4M89A 2Q4EA 5DBIA 3QE3A 2ZYAA 2OO5A 4PG4A 3WFIA 3JQ7A 4DQVA 1U3WA 5G4KA 4I8XA 4PVCA 4EJMA 4M55A 5IDQA 3RU7A 1E0DA 5TNXA 2JL1A 3V2UA 3GZ4A 1NVMB 4R69A 1M67A 1ISGA 4PLFA 4XIYA 4ZQGA 4BGUA 2PZLA 5TJHA 1PS8A 3B1FA 4F46A 1H94A 1Z7EA 1DFIA 3NEPX 5HA5A 3D5QA 3QP9A 3VH4A 1YL6A 3ZV6A 4TKMA 5TS3A 3RUDA 2JAHA 1R4MB 2TMGA 4FJ0A 5L7TA 4YR9A 2I65A 3PLRA 1GUFA 2DTEA 2QRKA 2HMTA 3DHYA 1PTJA 2EIHA 4TRNA 4BO3A 3LT0A 1T2DA 1AHHA 1Z73A 2NU8A 5FWNA 4YAGA 4RVUA 4HWKA 3ANNA 4CQLA 3HDHA 2CVZA 4CMEA 3PDJA 2OMEA 4LCEA 1I5RA 3JQGB 1PQWA 1TXGA 4J16A 4JX8A 4D41A 5G0VA 5JAMA 3BHIA 1P1KA 4DRYA 2P5YA 1NR7A 1V3VA 2PWZA 1X7HA 2FOIA 3WBFA 1CQIA 1P1JA 3O26A 2CUKA 1KEUA 2Y1EA 1LDYA 3ONEA 5KVCA 5BSFA 3I9MA 3JQ8A 1XELA 4Y6SA 3IS3A 5CDSA 4ND5A 3RAJA 2HLPA 3TPCA 4CR7A 1WMAA 4KMSA 4AJPA 5I9LA 5IF3A 1YBAA 3HFSA 3JD1A 1LQTA 2R6JA 3OICA 4J91A 4YAIA 1F12A 1E7SA 3I52A 3I9KA 4KUGA 3UCEA 3WR5A 5H81A 2GNAA 4MVJG 2FPIA 4R9SA 3PIDA 1P1FA 1YB1A 2O2YA 1IPFA 2CDAA 1YL7A 1QSGA 3GNQA 4D0SA 5HS4A 5TC4A 1EE2A 5L40A 1BVRA 1ZSYA 3DAGA 1IZ9A 2DLDA 4CMIA 4YACA 5AQ1A 3F5SA 1ZK2A 1MXHA 1LSJA 3DMTA 3GN2A 3WSWA 5CPFA 1WZIA 2QZZA 3WGOA 1PGPA 4LGVA 3I9LA 4GX1A 4E4YA 3ZWXA 5L53A 5B4VA 2YYYA 4KWIA 3VVBA 4QEDA 1DHTA 2Y67A 4XKJA 3D5TA 2ZYDA 2AG5A 3UW3A 2EXXA 3DBVO 3H8VA 3NT5A 1EQUA 2Y99A 1P33A 3C85A 3O8QA 3KBOA 4EGFA 2RAFA 5DOZA 1T4DA 2CDBA 3UN1A 3PK0A 4FDAA 3RIHA 3L9WA 4E30A 3GH3A 5IG2A 1GYQA 2IRWA 3FNGA 4YJHB 2O3TA 1E3WB 5JAIA 2OXIA 4E31A 1ONPA 1K2WA 4CUKA 2X0RA 5IXYA 2HRZA 2BHLA 4FOSA 3EMKA 3I9NA 3H9JA 5TT0A 4TSKA 1L1FA 3BYZA 3F4BA 2B35A 1I2BA 1Y8RA 3ZV3A 3L6OO 3HB4X 1T25A 1NQOA 4N7RA 2FR8A 2GASA 4RLSA 2XXJA 5CAEA 1GUZA 3H5NA 4TVOA 2GCGA 1KVSA 3D7LA 1R16A 5CHEA 4DMMA 2YZ7A 1SZJG 3P5SA 1PZFA 3BTOA 4QFDA 1WXDA 1XEAA 2PZKA 4FC7A 1UXIA 3GFBA 4ONEA 2X5KO 1LXCA 3DBLA 4MINA 2RH8A 5CDGA 3JD4A 3R3JA 4BNXA 4GVLA 4A26A 3FTPA 2O3SA 3Q9UA 3BTUA 1CDOA 2PD3A 3KZVA 4L0QA 3U4CA 4Y67A 3GGPA 4HKTA 2PV7A 3HN7A 1U2GA 3E6AA 4MP3A 3RU9A 3UVEA 4LVCA 3O9ZA 2PNFA 5ILOA 1FDWA 4O59O 3RSHA 5KTKA 2ZB7A 2NTVA 3GFGA 1CWUA 1IB6A 3VC7A 1YONA 4K6CA 1U4OA 4L4XA 1PS0A 2OBYA 1RPNA 4ALJA 5H82A 1NPTO 2VUTA 2ET6A 4R1NA 1OI7A 5I7VA 5IXSA 3U5TA 1YQXA 3TL2A 2ZIZA 1U4SA 1ULSA 4BL5A 3ETDA 5A02A 4CM4A 1LJ8A 3AFNA 2JFHA 2I76A 5L51A 4IM7A 3NTRA 3V1UA 3LT4A 1LSSA 3GAFA 3K2BA 2HCTA 3GZNB 4RF4A 3DQPA 4NNJA 4BMSA 1H2BA 4XYEA 3ABIA 2PKRA 3OBBA 1EDOA 3FPCA 2Q3EA 5DN9A 3UKOA 2RH4A 4Q9NA 2X9VA 2YW9A 1LDNA 3AY6A 4Q3NA 4BVAA 4JLWA 1Q0LA 2UYYA 3OSUA 4I5EA 4Y9DA 5EPOA 4NFHA 4CLHA 3RASA 3WJ7A 1SMKA 3ITKA 2HK9A 4BNHA 1DHRA 4BNUA 4N5NA 1JTVA 3IOYA 2Z1NA 3T7EA 3ZU2A 3U4DA 3DZHA 4RL6A 3ZWYA 5G2OA 1E7QA 3NTOA 1R12A 4YEDA 1N8KA 1YGYA 3G0OA 2FR0A 4EJ6A 2J5KA 4F6LA 3GDFA 3C8MA 4Z3KA 1NQ5A 4P22A 1F0YA 4RZHA 1V3UA 4E32A 4A03A 3IQDB 1PJLA 3LF1A 3QQPA 4IZIA 2B0JA 4TZKA 5DF1A 1WVGA 1TB4A 3U09A 4EBFA 2B83A 4XQEA 3H5AA 3OJFA 5TGDA 1VRWA 4CLOB 4HADA 4S1VA 2IZ0A 2GLXA 5ENVA 4FFLA 2OL4A 3IUSA 4U8GA 1I24A 3W8DA 2VZ9A 2W2LD 3GEMA 4WUVA 3AK4A 2CZCA 4J49A 5ES3A 4H16A 2I6TA 4URFA 1RWBA 1DIAA 1Q0QA 5G0SA 1AUPA 4GAEA 1BSVA 4CM7A 2EGHA 5DP2A 3ASVA 2HU2A 3AM5A 2DBVO 5LDGA 1PIWA 2P5UA 2HK7A 3MTGA 4XRGA 4Z6KA 1YJQA 3BA1A 3B1KA 5IFLA 4DBVO 3UOGA 1NPDA 1LSUA 4D43A 1IPEA 1PGNA 1QV7A 2RHCA 3FHLA 4J6FA 1U9JA 2FN7A 2P91A 1QYWA 2Y66A 3KYCB 4J1SA 5JMPA 4DYVA 4FB5A 1Z74A 1N2SA 3ZWCA 4JJFA 2H5LA 2OFPA 2AG8A 1B3BA 2Y1CA 3X2FA 3ST7A 2A4KA 1A5ZA 1KERA 5C3MA 4WASA 5KNLA 5U4QA 1HRDA 2V65A 4IDGA 3JQBC 1C1DB 5DOVA 1R4NA 3PXXA 4TKLA 3L9XA 4HY3A 4ZQBA 3PZBA 1Y6JA 3INGA 3WB9A 3FI9A 5BT9A 1LLCA 3E9NA 4PZEA 3WGTA 1U3TA 2IZ1A 2B37A 2DAPA 5A9TA 2X0IA 1HKUA 3GC6A 2ZTUA 3RWBA 1C0KA 1LDBA 2YV1A 3VPXA 1A9YA 1V0JA 1PS9A 4XJSA 3TZ6A 2C0CA 1H93A 2D5CA 5JNLA 5DBFA 2VTDA 3WMWA 3ADOA 1L7DA 5JDIA 2BMAA 1ULUA 3A4VA 3Q11A 4QUKA 4BNFA 3RUIA 1VL6A 4ZQHA 4GQAA 1LDMA 4OL9A 2HQ1A 4D3DA 1DC3A 3PLNA 3RUFA 3JQ9C 1VKOA 5CPBA 2GN4A 4R16A 4CMIB 5A9SB 3CZRA 3VZPA 4B3IA 1ZO8A 3DBHB 4MVJM 3D4PA 5CDUA 3OQBA 2BI7A 3LYLA 4DLAA 3W4KA 5T57A 4D79A 3ZZNA 1JWBB 3GUYA 4P4GA 3BMOA 3H9EO 4YCAA 4A10A 3DBLB 3H6KA 4UULA 4RZIA 2VCYA 3BTSA 4RVGA 4O5OA 4I9UA 3NAQA 2PZMA 3PHGA 3V8BA 4NBRA 4RVDA 4CM8B 2WD7A 2BH9A 1N7GA 1B26A 3CPSA 4GBJA 4UREA 4R3NA 4ZA2A 1ZEJA 1P31A 2EKPA 3GUCA 3EVNA 3WJAA 1SPXA 3PJEA 1DJNA 4I9NA 4KWHA 3W6UA 1XHLA 5FFFA 1XQ6A 4XDYA 2PH5A 1CQJA 5TRTA 1QLHA 1Y8QA 4IDBA 4NR0A 4EYEA 1DIRA 3GRPA 1MG5A 2QRJA 4MVJA 4A0SA 5ADHA 2VNSA 3H2SA 5CG2A 3N74A 4BNVA 1ZKMA 2LDXA 4RF2A 4XDZA 3I23A 4I9HA 3GNTA 4FBGA 4AJOA 4YT5A 4PLYA 1JKIA 5EL0A 1DEHA 1ZJYA 5ICSA 4J43A 1C0LA 2HJSA 3PFFA 1E3IA 2DUUA 1MP0A 1HF3A 4Y6RA 1ZK4A 1I0ZA 5A04A 1DIHA 5EINA 5BR7A 4DLBA 1ZSNA 1VI2A 3TNLA 5T64A 5FF9A 3UGKA 3U4HA 2WMDA 2XPCA 4DPKA 1UDAA 3B1JA 4UEKA 2JJYA 2AQKA 3WDSA 1U5CA 2OBNA 1HXHA 6ADHA 3MEQA 4W4TA 1Z7BA 4C7KA 4MVJE 4S3MA 2I3GA 3DONA 3CMMA 1YOVB 4II3A 5GZ3A 1GZ6A 4PLPA 5EN4A 3WTCA 1HE3A 1N92A 3A1NA 1LSOA 4LMPA 2IEBA 1L7EA 4XQ9A 3VPGA 1ZJZA 2EF1A 1ZW1A 2YQ5A 3PJFA 1U8FO 5JYEA 3WOHA 1LI4A 1NAIA 3GK3A 4R4JA 4IDEA 4KTTE 1ZH8A 1HEUA 3RD5A 4FPXA 1C1XB 1C0IA 1GY8A 4RCVA 3I4CA 2UV8A 2Y0CA 4ITUA 1C0PA 3LK7A 1BG6A 2PR2A 4OKNA 3TJRA 4J3FA 4XQCA 2D8AA 4TROA 3NGLA 1E7MA 3FBTA 3PGJA 4WLVA 4CQMB 1JU9A 5B4UA 1K6XA 1TA4A 3EC7A 4R3WA 1E6UA 1A9ZA 3O38A 1ONNA 2Q2VA 2BD0A 4IS2A 1CRWG 1P0CA 2C2XA 4BNJA 1RM0A 5JMWA 2X0JA 3GN1A 3NYWA 3QVTA 2GERA 2DPGA 1IOLA 3ZN2A 1XYGA 2H63A 3WNVA 2UUOA 2HMUA 3KYDA 3OA2A 4JQCA 1ENPA 4BUCA 3DFZA 3T4XA 2BFMA 2V6GA 4M49A 1HZJA 5A5FA 4LN1A 1HSZA 4F45A 5GY7A 4IY1A 2YDXA 3HUDA 5LCXA 1YVEI 3S55A 3H3JA 2EEZA 2YFHA 4NI5A 4JCOA 4Q3DA 1N5DA 1W8DA 3INTA 2NUAA 1LEHA 2E4AA 1IL0A 4R5HA 2G1UA 4OOFA 3BIOA 4J7UA 3OM9A 4MVJD 3TQHA 4TZTA 2NU6A 1VJ0A 4WECA 1XDWA 4P8RA 4IPTA 1Y7TA 3HADA 4RO0A 2WTBA 2AHRA 2EW2A 4RQTA 4DYDA 4E2WA 4BIIA 1CJCA 4MP8A 4HP8A 3GA0A 4NBUA 4QFCA 2VUSA 2I9PA 3H9GA 1YS4A 4BNTA 3B70A 4GX5A 3ICPA 5EESA 4TRRA 3MJTA 4ZGWA 2O23A 2NVBA 4IMPA 4XYBA 2FRDA 3EHEA 3NX4A 4QO8A 4XR9A 4Z0TA 2YUTA 4YJGA 4CM8A 4BMNA 4B4WA 1N9GA 2DPHA 3HN2A 2YJZA 4DLLA 3H9QA 4J4HA 4K6FA 1C1XA 3FTNA 4BV8A 2NQ8A 5JFOA 1HZZA 2HDHA 4EEZA 1BVUA 3TSCA 2QZ9A 1H5QA 2EGGA 4YT8A 3OECA 4FOOA 5IDYA 3S2FA 3V1TC 2PA3A 1Q1NA 1WDLA 2VYNA 3EZLA 1I3NA 4E5YA 1XCBA 4BB5A 4N54A 5JDCA 1EE9A 1WDKA 4IS3A 5G0TA 5U9CA 3AJRA 1T1RA 1X13A 2PK3A 1EVYA 2Z1MA 4IDFA 2JAPA 1UDBA 3PQEA 4DPLA 1UZLA 3RKRA 4D42A 1I3KA 5I9NA 4YRDA 2NU7A 5BQFA 3C7AA 4Q3AA 5K6AC 5B4TA 1OAAA 3OQ1A 1PJCA 5IN5A 3RQSA 4YRAA 2YDYA 4CL8A 3WS7A 1NFRA 1HDXA 2BELA 5G4KB 1C1DA 3ONDA 1DXYA 1LQUA 1UJMA 4WJZA 4L74A 3KTDA 1K3TA 2V6MA 3LVFO 1FXSA 1MGOA 1H6CA 4N5MA 5DP1A 2ZQYA 2WEKA 5C5IA 4MOWA 3GDOA 3KYBA 3R3SA 4KQXA 3Q2KA 3VH3A 4Q3CA 4DBZA 3QVSA 2RIRA 3QVXA 1DRUA 3ZI0A 3DAPA 1H9BA 1JDJA 5TQVA 5JAZA 1ADCA 4OKIA 2E37A 4K9DA 1J6UA 4BKUA 3VDQA 3UAGA 3E9MA 2Q1SA 4FFRA 2VYND 4LK3A 1UP7A 3KB6A 1J4AA 4CQMA 2BFPA 4W7IA 4BO1A 3ROPA 2BFOA 1D1TA 4P4NA 4D45A 3NUGA 3Q0EA 1SO8A 2R00A 2ILTA 2OP0A 3DB2A 3FNEA 3KVOA 3NV9A 1BW9B 1FDUA 1T2CA 4XGNA 4PZCA 1WNTA 4HFMA 5IJZA 1MUUA 2Q49A 1YDEA 3I9OA 4GKVA 4WPGA 4W99A 3ROKA 3WMXA 3LF2A 4JK3A 3AUAA 3NDJA 2HJRA 3PPIA 1P3DA 3E48A 2JFGA 1QMGA 3IMFA 4K26A 1M76A 4FD3A 3TFQA 2PD4A 4NJOA 3C7DB 1NWCA 2Y0EA 4OSPA 3AI2A 5F5NA 4CPDA 1NFQA 1E5QA 3F9IA 1HYGA 3SX2A 3ZHBA 2BKAA 1TT5B 1A27A 1HE5A 3H3FA 4ZQEA 1OOEA 1WP4A 3UICA 1QR6A 4DTIA 1ENYA 1KOLA 5ER9A 1GQQA 1ISMA 1UXHA 2VT2A 4NJMB 1E3EA 1X0XA 1DRVA 4R1SA 3DMTC 5U1PA 1VSUA 3PZRA 1NVGA 1AXGA 2AEFA 4MO2A 2EKQA 2V6FA 9LDTA 3AOEA 4YQZA 5DCUA 3O4RA 3K5PA 4ZN6A 2GUGA 2AQHA 3IP3A 1D4FA 2GR9A 3CZMA 2O50A 3KLMX 1E7WA 1S6YA 3LQFA 2Q2WA 3G3EA 4ZRNA 3VKVA 1R6DA 1Q7CA 3CE6A 1PZHA 2UAGA 3G1UA 2ZYGA 3WTBA 3RC1A 2B36A 4DVJA 1W73A 2Q1UA 3HDJA 4EUHA 3SEFA 1X0VA 5L9AA 5F1PA 1V6AA 2PGLA 4YYZA 1DLIA 4K1LA 3IIEA 3WIDA 3ROQA 1YBMA 4M54A 1BXGA 5T8KC 3WGYA 5JCJD 5EJ2A 5KIAA 4NBTA 3GVCA 3G1TA 4L73A 1ML3A 1B8VA 2PGJA 1HDYA 3GG2A 4PG8A 2FPGA 1I3MA 3T4EA 3OF2A 4RPGA 1O95A 3AY3A 3L6EA 4E21A 1U3VA 7MDHA 3GHHA 4NH4A 3JYPA 5K0ZA 1WW8A 5CP8A 1KEWA 2FWMX 3TN7A 5L7WA 2AE2A 4HXYA 2G5CA 1DO8A 1E1LA 2C7GA 2GO1A 5A9SA 4OSOA 1PL8A 1FMCA 2FSSA 1JVSA 3ZU5A 1H0KA 3OJOA 2G17A 3ETGA 1T1SA 3TWOA 2EG9A 3FF4A 3O8QB 4WK6A 4OO3A 4D7AA 5BNFA 1NYTA 1FDSA 5I7SA 3AI3A 3RUCA 4EDFA 5CEFA 4D3SA 1R4MA 2A35A 4D0RA 1UZMA 4PLZA 4Q3EA 2VHYA 3AY7A 4LVUA 4AJLA 1AE1A 4BNIA 2PZJA 3RC7A 1KEPA 1XIVA 3OMLA 4ROSA 1PSDA 2O3QA 1BWSA 3ZHXA 1ZK3A 1O9BA 2YV2A 3GR6A 3I5MA 2BLLA 4ND1A 4O0LA 5JBIA 2GN9A 1ZXLA 3OIDA 5C7IO 3NTQA 2WJPA 1VE9A 1U7HA 2VWHA 1A7KA 2C59A 4YVFA 1Y5MA 2Q50A 1TVEA 3DXFA 3TOZA 4BNNA 2I99A 3GDGA 2Q1WA 3DHEA 4XYMA 3EK2A 5HBRA 4FGSA 1IZ0A 3LSYA 1BDMA 3T7CA 4CM3A 2NV6A 2B4QA 4B4UA 1CETA 1JWAB 1U3UA 2DFVA 2VRCA 3OIFA 4UUMA 4E6PA 3OA0A 1E7YA 3CH6A 3IJPA 4L9RA 3GGOA 4DUPA 4CM6A 3L4BA 3QHAA 2OGUA 2W90A 3P2YA 3JTMA 1M6HA 5KVQA 2TMDA 2O4CA 1N1EA 1YRLA 4EEXA 4U0JA 4LMRA 5ITWA 1H6BA 2OORA 4QX6A 3CMCO 1K89A 4MIYA 2Y93A 2IYOA 4CLDA 4M1QA 2W8ZA 2B69A 2VZ8A 4R5MA 2HRBA 1NP3A 3LDHA 3NJ4A 1P1IA 2WD8A 4AJEA 3ZDFA 2J3KA 3VZSA 3QRWA 5A3VA 4NK5A 1EK6A 3WICA 3EZYA 2PGDA 1KS9A 2C7VA 3OJEA 3PQFA 4JBHA 4PG7A 4OQYA 1A71A 2ZTVA 3FR7A 3ZV5A 2X8LA 3JD0A 3GOHA 4GKBA 1RJWA 1PEDA 3ZNOA 2YHIB 4J1QA 3JQ9A 2Q46A 3ENKA 2NSDA 2Y05A 4YJFA 1IHYA 1MV8A 4NZ9A 4MVJH 4FGWA 4OMUA 1MLDA 2Q2QA 3ENNA 3VPHA 2Q1TA 2ZB8A 3WFJA 2VRCD 3PVZA 5IN4A 3U9LA 4I5FA 3MJSA 4TQGA 3ZWVA 5TJ9A 2X86A 4B7UA 2J6IA 2J5QA 1ENZA 2NVUA 1SNYA 1PJTA 1UXJA 1LU9A 4CUJA 3PIIA 2Y1GA 4XEHA 2EHDA 3MOGA 4UEOA 4HUJA 1MXFA 4FW8A 3HG7A 1P44A 3WLFA 4BHTA 1QXSA 2A94A 4XIJA 2SCUA 3JQBA 4OH1A 4W9NA 4HV4A 3MTJA 1AXEA 1I2CA 1ZXBA 3B6ZA 3WYCA 4NFYA 1C3VA 2OP1A 1ZBQA 2YQ4A 3VHRA 4ALNA 1QLJA 4W7HA 5T67A 2IDZA 2VHXA 5HS6A 4NDNE 2VHZA 3KEQA 3DAFA 5IAAA 2B5VA 4FCCA 2DKNA 4JNKA 3ZU4A 4IQ0A 5F1OA 1T26A 2NU9A 5AXAA 4MKZA 2HMWA 2CMDA 4AJNA 1G0OA 4WLFA 5A05A 4W6ZA 2QYSA 4IJWA 4CLRB 5KOIA 3D4NA 4OYRA 3ONFA 4AJHA 1MC4A 4PGFA 5HTOA 1JKFA 1RM3A 4KTVE 4E13A 4BMVA 4BGIA 1R37A 4B8ZA 5AVOA 3UHAA 1PJ2A 4AJ2A 4KDEA 3DZGA 4GWGA 1QYCA 5C37A 2NLOA 2HK8A 1EFLA 4A5OA 2OZPA 5I7FA 3HHPA 5L4SA 1BRMA 2DBZA 3IUPA 1ADGA 1HWYA 3I9JA 3RBXA 1HL3A 3S1LA 1ZCJA 3GVIA 2NADA 4EI2A 5CEJA 1X7GA 4X54A 1LA2A 1PJ4A 3DOJA 1NNUA 3F3SA 2J5RA 5JDIC 1AHIA 1W4ZA 1UXKA 5IDXA 4ID9A 4MPDA 1G0NA 4B3HA 4WLOA 3ZWWA 4N18A 2G76A 4R01A 2PKQO 1F8GA 3PI7A 3MJ4A 4YJGB 1M2WA 4KUEA 4PG6A 3JQAB 1PGJA 2AEJA 1JAYA 1X15A 4Z9YA 3WIEA 1NXQA 3KLPX 5GZ6A 5AOVA 1E3LA 3JD2A 4P38A 4RPLA 3IL2A 4KZPA 4NFSA 2C5AA 1EVJA 1ZEMA 2YHIA 3COSA 4LCJA 1GEGA 4IJKA 2Y1FA 5F3RA 1M75A 3LT1A 3ZGYA 3LC7O 4XYLA 4LSMA 3N7UA 4HBGA 1YJ8A 3K6JA 1WPQA 2CF5A 4E5PA 5A9RA 4ILKA 1M66A 1WWKA 3JYOA 2WYWA 3KM0A 2WM3A 3LLSA 4HFNA 4LW8A 1IE3A 4RORA 1EDZA 3HNPA 1BXKA 3RCBA 4Z9XA 5I8WA 2AQIA 1FDTA 4B4VA 2NTNA 5B12A 2YV3A 4XR4A 1ZIDA 4WNIA 1K6IA 1EBFA 2D1YA 3JQCA 1E3WA 2Q45A 5DZSA 3H9UA 3QWHA 1UP6A 1SCUA 2FR1A 4BOYA 4XX0A 1VKNA 1KC1A 4J7XA 4BNMA 3VVCA 1Y5RA 4B79A 4M86A 4B7CA 2G82A 1KIFA 3CXRA 4CMHA 1KYQA 1GV1A 1Q2XA 1YB5A 4QXMA 1O0SA 3RFTA 1GCUA 1ADBA 1DIGA 2VOEA 3CKYA 2BRUA 3G79A 3GEDA 1Y8QB 2VZ0A 4JJIA 4NIMA 2AA3A 1BXZA 4GPD1 4FFPA 1LC0A 4L75A 3QW2A 1B15A 3LC1O 5ITVA 2YHUA 2QYTA 4CMCA 1DRWA 1DOHA 4XA8A 1PJBA 2V7PA 4INAA 2PFGA 3PTZA 1GEEA 5CDTA 3PQDA 5GMOA 5HM8A 1YH3A 1OFGA 4DREA 4BO5A 2BGLA 5KKAA 3JQFC 4WEQA 5IZ4A 5JLAA 5JCXA 1QYVA 2GSDA 3EUWA 4KDFA 5THQA 4CLXA 4U7WA 2DTXA 3HFGA 5TT1A 4E0BA 5BNTA 2E6UX 2H9IA 5L7YA 4XRRA 3UCXA 3VAZA 5BSGA 1NM5A 3CIFA 3ASUA 1XGKA 1DC5A 3R6DA 4IIUA 1ZUD1 4LRTB 1GADO 4CM5A 1BMDA 1ZVMA 4YJFB 2OUIA 2HMVA 1Q0HA 2EW8A 3INRA 3W8FA 4KQWA 4EUEA 1DAPA 1LNQA 3JV7A 3QSGA 5DDIP 4AFNA 1I33A 2R2GA 4BO7A 4YA6A 3AWDA 2VUUA 1GL3A 3DOCA 4OHUA 4E3ZA 3D0OA 2Z95A 4JP2A 3JSAA 3S2IA 5KJFA 2D4AA 2FZWA 3IKVA 2QIOA 3FWZA 3PYMA 4RDIA 1XQ1A 3RVDA 3PDUA 4FIZA 4YTEA 4XJTA 4B4OA 1VJTA 3PJGA 4HFRA 5AXCA 3SJUA 1NHWA 4RF5A 1B3RA 5EERA 1LLUA 2QHXA 4UVGA 3E03A 4R9RA 1GDHA 4RPHA 2CSUA 4RVSA 4B7XA 4DPMA 3E82A 3ANMA 4UVHA 1GQ2A 2I67A 5CDYA 4E2ZA 4MKXA 3BHMA 1Y9AA 5LC1A 3M2PA 4U0KA 4WCFB 2CD9A 3DFUA 2JD2A 2X22A 4G65A 3LT2A 2HKIA 1UR5A 3ZWMA
chains in the Genus database with same CATH superfamily
2VSXA 3Q7TA 5CH8A 5BVHB 1HDRA 3G5UA 4X0EA 3QLJA 3VSCA 4QXAA 3HABA 3CA8A 5DTJA 3VKWA 2JGRA 1LW6E 2QE7D 2F9LA 3B13B 5I5GA 3ZZ1A 1SG0A 2ZUUA 1KAEA 3R24A 3PCRB 4KK4A 5TY0A 4QU5A 1X38A 2GN0A 4O2LA 2HA0A 4K1XA 5EIHA 5D00A 4EJ0A 4ADSG 1K75A 3KEFA 4RLFA 2W4IA 3CEHA 4X7PA 2KJQA 3FW1A 3VO9A 4BAGA 1OZAA 2Y76A 4IHJF 2XBUA 3OI7A 3OPYB 3MJHA 3BICA 3M5PA 4TS9A 2WTEA 1KXJA 4B84A 4YDRA 1AN9A 3OE7A 1OI2A 1COZA 4KXMA 1K97A 2DTDA 1HG0A 1SOVA 3MUOA 4N8SA 3T41A 5C5CA 2OCIA 1ZK0A 1FFAA 3ZHYA 5BV0A 5M04A 3CUKA 1MJGM 1JALA 1EUDA 4ZV9A 1VSBA 1W88B 1WHSA 3TLKA 3ZY5A 2Z9CA 3CBGA 2OUKA 4WZBA 5KYXA 1KEKA 3ZLJA 4U2CA 4KVAA 4PZDA 2QN3A 1FFCA 1CQPA 3QVVA 3WYEA 1IHXA 2N1MA 2OHXA 1VXOA 4IIEA 4U6SA 2XB2A 3K9GA 2RDMA 1AIPA 4BNDA 1EGQA 1Y89A 3KSDO 1YQ9A 3KXDA 4WL0A 2VDWB 4YAFA 1OSNA 4Z53A 4X3OA 1XPJA 3AG5A 3L06A 4OBXA 2YIVX 4XGKA 1K7YA 3HCOA 2CCJA 4QO7A 2WHPA 1J1ZA 4IINA 2HRQA 1Z15A 1C1HA 1HFWA 4OI1A 4Y9UA 3E81A 3M5DA 5WRFA 4R1UA 1OTHA 5KOHB 1GPWB 2G3YA 1AB6A 1UP4A 3BD7A 4C20A 2ZTLA 1D9ZA 3OCCA 4G4GA 4OSEA 5FI3A 2NVUB 2ZR9A 1AUOA 1YCFA 2AR9A 4C01A 4I19A 1RWNA 1VL1A 2QPLA 2QQEA 4WKGA 4RULA 2R9VA 4BCDA 3F6YA 5L95A 5AJUA 1L4KA 4NOJA 1ZMRA 4QDTA 1WXQA 3AIOA 3HWSA 4Q00A 2HNKA 1UC5B 1MA3A 4MR9A 3I0ZA 3MQ4A 3C97A 4RZ3A 3H11A 2HLHA 2D0IA 2J59A 3EDMA 3RS3A 5HWSA 4ENRA 3AR9A 8MHTA 5BSHA 3NHMA 1JZTA 1EX9A 2MSDB 4PRKA 4UCWA 4BNKA 2LCIA 1SC1A 3PGMA 1O95C 3EQ9A 4MR7B 1O57A 3DE0X 3T52A 3CB2A 3BZWA 4R6WA 1U7OA 1KKMA 2CE7A 4FQ5A 1P6XA 4JT2A 1LBEA 3NMUF 4HWSA 3RKUA 3EY4A 4TYQA 3W4JA 4Q9KA 1ZIYA 2B4RO 3NC0C 1TQHA 1EXMA 1I1HA 2OE2A 3G17A 4TVBA 1CQIB 1SGWA 1EUCA 4FYVA 1T91A 3BWBA 1QE0A 4IUCS 1VSVA 4M7WA 2V6JA 1I4TD 4XUCA 1CC1S 1Z68A 1D03A 1KJJA 1ZD4A 2O0JA 3KV3O 5COBA 4ZEWA 1WLSA 2PUJA 3DFFA 3EGWA 3NR2A 2V9ZA 3NHAA 1PW7A 3TW8A 4HAOA 2I80A 4YXFA 1IWPB 2I2XB 1W36C 5T5QA 3FFAA 4RJ2A 5ER6A 3CVYA 1XCGB 3AM3A 5C7LO 1R0KA 4PTZA 4NV3A 5I9MA 2GEUA 3QV1A 4QECA 5K4AA 3N53A 3G13A 1QAOA 4TTSA 5EYPA 4B82A 4UU8A 2E0IA 2E4VA 4LNHA 1CIVA 4KFRA 3D3NA 4BLRA 1VPDA 1Q19A 3C4JA 4AIIA 1TKCA 2X2EA 1U0GA 1UPAA 4R2WA 2VA8A 1FQOA 3FCEA 4GYJA 2DY0A 3V6LA 1CR6A 2WD9A 3L4SO 3QNMA 1D3AA 3H2GA 4YIKA 3VGJA 5KQGA 2JGDA 1WS6A 4LRUA 4Q34A 3W78A 3H2ZA 4Q1VA 3TVYA 4IFEA 1UPXA 1SXJE 1CFZA 1IUKA 3KQSA 1LS1A 3R0IA 1AO0A 4TS1A 3BMQA 1A5AB 2VQ3A 1TLLA 5KNBD 1R66A 4L8VA 2PLNA 1NVVQ 2AMVA 4DMHA 4W1SA 1GZHB 2VL7A 3EFOA 1FIUA 4TLCA 4JVSB 3M1LA 2VYVD 4KBFA 5MFZA 2VK2A 1P29A 4DJJA 2G77B 4J7AA 5JSKA 2GAOA 2OC9A 4N3CA 4XGIA 1RBMA 4LMAA 1OAOC 5SZHB 3GL9A 3B38A 4KLZA 4TZ6A 1CEEA 1ZH4A 1WSAA 2O8FB 4JGBA 3L4BC 4XJVA 3CIOA 3QUQA 2ZSJA 3ORFA 1Y1PA 5EIFA 3QKIA 2IPAB 4OHKA 4Q9JA 1KI3A 5DV9A 1X9HA 3H87A 3M1YA 1KC3A 3MTAA 3KHUA 4FFMA 2ZI3A 1WW2A 1J0AA 3L0BA 3E9YA 2OCPA 3KSMA 1G64A 3M1IA 3QITA 4PGAA 1ZM9A 4RK6A 1XE3A 3DEYX 1L9KA 3NM6B 4WRRA 4B87A 2PEYA 4E5DA 1BGVA 3I1JA 3KUXA 2XTNA 1L7QA 2AIRA 1WAMA 1MZPA 1EVQA 2AMJA 1FRFS 1M1YA 1GDTA 2IK8A 3NIGB 2O20A 1Y4SA 4P33A 4HYTA 4DDWA 2JJ1D 4PINA 3EWSA 2E1PA 2QTAA 5TXGA 1I2ZA 3FETA 1A5SB 3GELA 3R4VA 2ZJ1A 4GSKA 5ERGB 1NUTA 5EKUA 5H5JA 5JVDA 1U98A 4GPZA 1TF2A 3W2IA 5IJ0B 1A9QA 3UNXA 3PTLA 2IXBA 1QORA 1IHUA 2V96A 3AHGA 4BASA 1DC4A 1WJGA 2X6RA 3BJEA 3T38A 1F2TA 3ZNPA 5K01A 4A2PA 1PWZA 1ZY2A 3DVRX 2XMRA 1WKBA 2F1OA 5HRUA 1BYUA 1J42A 2P68A 3NHJA 2Q5CA 2I4IA 3D1LA 3CNLA 5COAA 2PL5A 2D3TA 3VOSA 3A6KA 4XYGA 4AXXA 1USWA 4NZPA 4O1IA 4DYHA 5K3OA 2N9UA 3EZXA 2HWXA 1YJ5A 2OCBA 3IQWA 1KAHA 4U6NA 5THXA 5AUNB 4UTNA 5EE1A 1ZHOA 3QPCA 4KQ1A 4RV9A 3S1SA 3SBOA 3LP6A 2OHHA 4GLBA 5CJ2A 1JFTA 1OFTA 4TKUA 5A62A 4BMPB 4LI0A 4RFSB 3AVYA 1S89A 1NR5A 2DFDA 2ZVJA 5TARA 1Q7TA 2CUZA 2NW6A 4ZJYA 2JLUA 4H15A 2O1SA 4WZ6A 3ULKA 1MH1A 2NV2B 2RGGA 4EWLA 5BMVF 2QP4A 4RELA 1KORA 3E1SA 3RB8A 3THYB 2H54A 1XTKA 4TT8A 4EHFA 4Z2AA 1JECA 2B21A 5H4HA 4BN0A 3FHOA 1Z4NA 1A4IA 2G5TA 1Y5LA 2QLMA 2I29A 2D00A 1JEDA 3ZWNA 4GM0A 3L4JA 5AYVA 1OQAA 3PYLA 4B35A 1OA0A 1D09A 3Q4GA 4RM3A 2OD2A 2QNRA 3I4LA 1JXAA 4PO8A 5J40A 5LOVF 1KI6B 4ES6A 1TNDA 3VQTA 1ZLXA 1ODTC 3ORRA 4BGDA 1G3UA 2DSNA 4MMYB 1I1NA 5A2GA 4IXTA 1XO1A 1VMKA 2ZZMA 4MNTA 4O4JB 3T3GA 4H77A 3F5DA 3BXEA 4DDTA 5FBLB 3M34A 1ODJA 3QENA 5TE9A 4WOJA 5J2UF 4QUHA 1ECBA 4OF4A 2JCVA 3CEAA 3SLRA 2QAGB 4BB6A 4IJQA 5G41A 3KKLA 4HQKA 1PHPA 3RVNA 4DCGA 5C1DA 1V45E 4HLCA 5F33A 3NVKI 4JLVA 5FA8A 3B7GA 3NJ8A 1WE2A 5EIOA 3J81A 2C9OA 1SUDA 2QU7A 2JFPA 1V35A 3AEKB 1IHDA 1CF9A 2X6QA 2XA9A 3U4IA 5E2BA 4RL4A 5DYGA 4YWJA 1WD5A 1CUJA 2P9BA 5JAQA 1EQ2A 3NASA 1THZA 2JFBA 2KS6A 2CFIA 2WKSA 2ZXEA 5HRAA 4Y2YA 4CLRA 4LYGA 3A6FA 3D1VA 1IOVA 1E1MA 1G55A 4L6CA 4HVAA 4FFVA 2DT5A 2ZRNA 3JQEA 4R8MA 2XA1A 4UAUA 2R6FA 4V0NA 4NE9A 1UBUS 4PC1A 4X1OA 1A7UA 2R1VA 2J7PA 4M0EA 3C3XA 4GICA 3E61A 1MX3A 3P4UA 1BEEA 3H0CA 3N2KA 2J0SA 1NZFA 1V11A 1KQ3A 5K5EA 3B53X 1NJGA 3HN6A 3DAOA 3FYTA 2XYRA 2VPXA 3IO5A 3MAAC 4F56A 5KCZA 1ZXXA 4D4LA 1EJBA 5KO2A 2VBFA 2Q2OA 4JT9A 4MGEA 4MKRA 4RPJA 3RFCA 4HR7A 1Z0UA 1G8MA 4HG2A 1LBHA 5LQCA 4CTJA 2IU3A 3A1VA 1ZH6A 3KJIA 4JR0A 3VSDA 4F6RA 1OF1A 2JIZA 5BSKA 4E7OA 3HJFA 1FJHA 2QRLA 3ENWA 2WPDA 3V8MA 2JAWA 4PYJA 2PX2A 4JEUA 2W2LA 4B6EA 1T6BY 5KQLA 3GLQA 4QYTA 1ZONA 1VJDA 2PO7A 3OESA 1T5OA 4F71A 1AXRA 2XWQA 3NIDB 1D2AA 3RK1A 1YI8A 4BV2A 5K6RA 5J4YA 4LXGA 3KX2A 4OUKX 1L8QA 1DJMA 4RU1A 1FNBA 4D1YA 2ZB4A 3HVJA 1NX9A 3HU2A 4FJ1A 1HT0A 4C76A 4JLJA 3GPIA 4JUBA 1F6DA 1XC7A 3MWEB 3TF5A 1F48A 5CYPA 4YMTA 1IBCA 3RC9A 1TYDE 4Q5IA 4B44A 3GLFA 5H8WA 2OG1A 4OMDA 2NXWA 1K92A 2IZZA 2W6ZA 5C35A 2YICA 1WVMA 3O8NA 3THOA 4JN6B 4D8WA 5CG1A 4WDRA 3PRKE 1M34B 1URPA 1ZHHA 4JC8A 4CCAA 1G4HA 2B1IA 2HF8A 2HHAA 2VJBA 2P4QA 1SOWA 3ZE6A 2QSUA 1G8YA 5B57C 5HSGA 1BXRB 1EZZA 1W0CA 3D6TB 4IDNA 4TYNA 5K20A 1ZQ1A 2IYYA 2VRBA 4HDKA 1QVAA 3QEMB 2PLFA 2PQ0A 3MT0A 3ON5A 1K1EA 4QEKA 1MAWA 2HR1A 2QR2A 1CEQA 3NIWA 3I6ZA 1IC6A 1HFEL 4BQIA 1KHHA 4OHPA 1TEHA 4OM7A 5A7FA 2DVMA 3F6PA 3SIRA 2FWAA 4AIRA 5C5IA 5FOVA 1V43A 2R7NA 3A3KA 4Q66C 2CLOB 1EVIA 3IR5A 2KHZA 5AVZA 1JDVA 3F1KA 2GETA 1NRWA 1U1FA 1UINA 3K53A 3ZHZA 1QGZA 1RWKA 4OFZA 3HXPA 4AZ3A 1FFXB 1OTXA 5LA6A 2CFTA 1IG3A 1SCIA 3N87A 1F2VA 4OI0A 1U8AA 3EGIA 1EFPA 4HH3C 5EZSA 3B1VA 2NUAB 2QBYA 1PT8A 1TC2A 3C1OA 3MWJA 1FQWA 3QOYA 1QHXA 2DBRA 3R1IA 4GOXA 4NU8X 4Y6PA 5G0UA 1J5PA 2WKWA 3ZW7A 4AMGA 4D9EA 1JR2A 3V34A 2VDOB 2XUQA 3B6JA 2QYHA 3FRHA 5CGZA 3VDNB 3VKFA 1BJKA 1G2QA 1HDGO 2Q4OA 1ZD3A 1ODKA 1JI0A 2QUJA 4H7KA 2NXNA 3DBHA 1XLTA 2KYRA 4FJ2A 1IJEA 1K3FA 5ENDA 3E8XA 3O2JA 1HSOA 2JLQA 5AKJA 2KQUA 3ZE2B 1HGXA 2VN8A 821PA 1LPNA 1U1DA 2CNWA 2XAAA 2WSMA 3H7AA 3WYDA 4E12A 1FQKA 1ZCFA 4LDNA 2PSJA 3EB9A 5JO0A 1L7OA 2R00C 2ZWMA 4O6VA 1NJ8A 3FPEA 2MT9A 5IW8A 2NSLA 3E5RA 1WHTB 4L8GA 5HM6A 3GBVA 3O94A 4NJMA 4DNQA 5TEVA 1TA9A 3L46A 1AS2A 3F5QA 4AJ4A 2Q6OA 2GJAA 4I46A 3WGIA 4RGBA 2A7XA 2AJBA 2VLBA 1GPDG 2YFQA 3K09C 3R5SA 4X8MA 2PE5A 2W4QA 1J8MF 3AUTA 1J22A 2BGTA 3HKCA 3SS9X 1RHKA 1WW3A 3KP1A 1H2EA 5FI0B 3PFNA 5JS7A 2V9PA 2NTJA 5CFLA 2FJPA 1VYVA 4FUTA 3BA6A 1H0HA 3EASA 2PUBA 1JHDA 2VDRB 3U44B 1NMXA 2GJKA 2NO7A 5A1TA 3DXZA 4B1FA 4EZBA 1RYMA 5K6AA 4A27A 3EEYA 4GM4A 2A5FA 1CVIA 3TX2A 1JJVA 2IY9A 2B8NA 1Y1QA 3OJLA 5A4AA 1LVGA 4CIVA 1S8OA 3KWLA 5DVZA 3PJDA 1F17A 4L08A 5JO9A 4MGYR 1A97A 3SSNA 5GIPE 1DGQA 2NZWA 1JLLA 1C4KA 4Q03A 2KPOA 2NQTA 2QQGA 1H2ZA 2CBZA 3MRVA 2PRYA 5AKZA 2EQAA 2YIDA 3N2KB 3PIRA 4LOAA 4RF3A 4EQ6A 3FHTA 4ZVVA 1DT5A 2BI8A 3Q2OA 3NFYA 4US2R 5EE5B 1MIHA 2AEMA 3KAJA 4HQLA 4US0R 4AC9A 3U37A 3I5UA 4JELA 2I91A 4CMGA 1ZX1A 4LJKA 2CBGA 4LSWA 4YMUA 1YL5A 3KTAB 4JJZA 3QNWA 4JP3A 2A3RA 1NHGA 3CVJA 4KC0A 4BKQA 3ILVA 3G68A 1PR6A 1PQUA 2ZI5A 1KDOA 1AKMA 1GTG1 3JPWA 1A9PA 3CO0S 4BE7B 3ZBQA 2NO0A 3DC2A 1K5PA 2EV9A 2PIDA 2YN2A 4L95C 1M5TA 3VPFA 3BCSA 1O9GA 1WCIB 2F48A 1DAFA 1V1RA 4DL9A 4PZUA 4TLMB 1TT7A 2J9GA 2Q9BA 4HVCA 2Q6KA 3DBRA 2GFIA 3N2ZB 1ISFA 3T9CA 2OO7A 4BQRA 4RK0A 1II8B 2I4MA 2JLXA 1KYYA 3WBJA 1N8TA 1IN1A 1DFHA 1UKCA 4NICA 2SBTA 5B1DA 3C45A 4JU9A 4P5DA 4TN5A 3X1WA 4ZICA 5BMVB 2A9PA 2QMHA 3KYDB 2YXBA 1YOBA 2HGSA 2NTEA 1WY7A 1J2UA 1QOZA 2VHWA 3ENZA 2PZBA 3OKPA 4M0LA 1NIPA 3LCMA 1NC3A 3AH8A 1JQKA 1ZVQA 3PGKA 1DBWA 3WGVA 1AGYA 1J23A 4RLHA 3OZVA 4PIVA 5KJEA 4IF4A 3QPUA 1AUXA 2A5DA 2RH9B 3FCYA 2VAMA 3QWFA 1ZRHA 3DAHA 4OFXA 2IZ6A 1YZNA 2Q5OA 1PYGA 4CDNA 4US1R 1ZOIA 3O03A 5CVDA 4OG2A 2ZM5A 4JA0A 5BO5A 1S7CA 1VGVA 3CS3A 3NNNA 4X8HA 5I9TA 1V2HE 3ZDEA 3CY6A 5HJ5A 2WDZA 4HBZA 4MV7A 1YE3A 4KPUB 3S7ZA 3WDKA 2WQ6A 1BN7A 4RFSA 3WWDA 4YT4A 2X9GA 3ESZA 2JBAA 2QP9X 1ZN8A 3HV2A 1NLFA 2ECFA 5BSTA 4ESOA 2K7FA 2JLZA 1DTEA 1G20B 1JEJA 4ML3A 1HTTA 1BU8A 1TI7A 4KOAA 4L5JA 2PSFA 3I6IA 5INTA 3AFIA 1AHNA 3D7SA 4G5RA 5ALNA 2AW5A 3ZCTA 4M1WA 5DTMA 3GFRA 1ZA1A 4TT3A 4WMLA 3WL5A 4FHGA 3E3MA 3KKZA 1NF2A 4G36A 1CU1A 3WV4A 5JALA 4UE2A 4HRYA 2FXVA 3NT4A 4ARZA 1NP7A 3T3EA 1EP9A 4W5RA 4QBGB 4WH0A 4AMZA 4MUIA 3TFOA 4I1VA 4LXUA 4QDKA 4YAEA 1SN7A 1RKXA 2O3RA 4CHTA 3ZPXA 1U2DA 4HF7A 4I1UA 3CLTC 5HF8A 4ZCQA 5E7MA 3SQLA 3WLJA 2OHJA 1XRQA 3Q7QA 4OP2A 4EITA 4QTYA 4ITVA 3N2NA 3WBBA 1PR0A 3FWYA 3ZGNA 1X7YB 2O0LA 3DMYA 3DYVA 4GG1A 3U81A 2ZS9A 3VV2A 4UHBA 1N8NA 3HVIA 4FX5A 3C3AA 2BFBB 5CTJA 1G9SA 2RI1A 3K2IA 3OKFA 4NE2A 2I3DA 4OXNA 4D3YA 4ZQFA 1MABA 3EGXA 2OPBA 3HP7A 1DIBA 2Y8EA 3D3WB 1P1HA 1GSAA 1R74A 3CSUA 3LVQE 3AR4A 1C8BA 4JI1B 2WF8A 4D9BA 5JYDA 1AU9A 2Q7XA 3STHA 2P35A 5FFMA 1P9LA 3A3PA 1U2EA 3CX4A 3D2BA 1HNWB 4DQXA 4EFMA 4YRPA 3KUKA 3DDSA 1KI2A 1Q21A 3FOAA 1SAYA 3VTZA 1N3BA 3L7MA 5JXJA 1AKRA 4B34A 4ER6A 1T9GS 3UHFA 4RK7A 2QSYA 2YZMA 1A9OA 1QZXA 3H5IA 1CUAA 4XCVA 2FZ4A 3Q12A 2FHPA 2OSBA 3GLFE 5NLLA 1UXOA 3NDRA 5E2AA 3DR3A 5CA1F 3LW8A 2VP5A 4B76A 1N9GB 1RLMA 3ZG6A 2CNOA 3JYLA 5JEDA 3WAGA 4B8YA 1CZLA 4ZAXA 4RK4A 3L79A 1GRVA 4KYVA 5LDDC 4REOA 3H6HA 1C30A 1Q1GA 1GA1A 4TWAA 1X1CA 1I4EB 3DW1X 3K96A 1NUUA 3ZWQA 4ZDIA 3BMXA 4JHLA 1QUEA 2C95A 3ETEA 1U8EA 4K9LA 2WWVD 4DBLC 4EH1A 3V3KA 2HWYA 4HDNB 2WAAA 3HR4A 1KWGA 3B3QA 4YJ2A 1QP4A 5COQA 3QUTA 4L6IA 1M5RA 5ITZA 1L5FA 3ADPA 3ROZA 1XVIA 3LTEA 4O2BF 3OO1A 1A9SA 1T4BA 3DTVA 5AXDA 4JV5B 2NT4A 3ESYA 4I5GA 3UF0A 4HQ6A 3VPSA 3EEFA 4GI2A 1GKUB 2REBA 1CIPA 4KEAA 5D8DA 4EP1A 2P2LA 3AF2A 3M4ZA 1PR3A 1E9EA 1M1NA 2TECE 3EQZA 2P40A 4HNTA 5LKRA 2FE4A 3CCCA 4PC2A 2VUIB 4PLHA 4AJJA 3W6NA 2M6KA 4MQUA 1JN0A 3U3XA 5IU6A 3S99A 1AMUA 3TUJC 1OXXK 4NHEA 4BV9A 2JBAB 5IAGA 3DTVB 1LNSA 1UIMA 2P9HA 4PSKA 2O4UX 5DNCA 1Y3BE 1I4DD 3EX7C 3U61B 2JGKA 4QGFA 1KAOA 4QL3A 1ZJWA 4OBEA 2QTVB 2XR1A 4M0CA 4GYKA 3VYVA 2EX4A 2XSZD 1FDVA 2P0AA 2AK2A 2HREA 2R47A 3DE7X 4MI6A 2W2KB 1YZQA 2VSQA 1U0SY 4HQ0A 3LNTA 4I8DA 5D1NA 2Q8NA 1MC1A 2OCDA 3P32A 2XDQA 4EY5A 3G5MA 2F7SA 2OGZA 1N32B 4FSHA 5B64A 4CMBA 3GH1A 1KO5A 1Z5GA 5LQSA 2AD5A 4N48A 3CNEA 2P41A 4K5QA 1S8AA 3RYTC 3FFBA 4KREA 1KQOA 3IVCA 2O14A 3E2IA 3BHJA 4PVDA 5FXMA 5K8VA 5LIRA 4Q05A 3R7WB 3MXOA 3KQWA 4I6JA 5F5LA 4YCSA 4E11A 4BLWA 1THMA 2WWYA 1XG5A 1V8PA 4YP9A 3LZ6A 3UHOA 1OBHA 3ETJA 3QXCA 3USZA 2PL9A 3FUUA 1HMYA 1E2NA 4Q1AA 4E70A 3FD8A 2FFBA 3KKOA 3D3WA 4RZSA 4FR0A 4BMZA 2V7VA 1OH7A 3OQIA 1NMYA 1GQYA 5K9ZA 4G4SO 5B1SA 4BP9A 2NO9A 4MYTA 4RPKA 4BFWA 4ZYVA 4CXMA 1B14A 4K3UA 1VCHA 1ESMA 2RMKA 1Y98A 2Q3JA 2FZLA 1KI9A 2QTMA 1UC8A 2OB2A 3FNFA 3MJEA 3OZFA 3PVSA 4GWLA 3J7AC 4LKOA 5CLHA 4RADA 1IBMB 2IBTA 1TGYA 2GBGA 5EZ5A 1X7XB 2BFCA 4V2UA 1KFCB 5ED4A 1KP3A 3EFEA 4ZMSA 2A57A 3CXUA 1X1BA 3LP8A 1ZJ4A 3EEBA 3NNSA 5FOQA 2QJOA 5DSXA 4EG0A 1OWMA 3DZIA 1L5OA 4IIJB 4OB6A 1G7RA 3M4XA 4PLWA 1E79D 1IY1A 1XOIA 2F9MA 4N0MA 4W1QA 3W4IA 2XQKA 1ISHA 4GM1A 2XGGA 2EJVA 2QZSA 5F1KA 4EIWA 3MRSA 4MYRA 4M1KA 3VSBA 5JATA 2C8VA 5BN5B 5G3ZA 2IYSA 1XKQA 2EEPA 4UEJA 5IT0A 4ZTZB 1Y8ZA 4DR4B 4BNDB 4EX7A 1BROA 1C1YA 4B75A 3DVAA 3WRVA 4PZ0A 4ZI3A 5FV4A 1XD9A 2K5UA 1YMVA 4OQQA 4BCBA 1I7QB 1N7JA 2W6NA 4A6EA 3HXOA 1ZESA 4N8DA 1E59A 4QPNA 4P92A 5THKA 2PMEA 3T8YA 3EVFA 4TMFA 2I3AA 1YS2X 4AUMA 5CFZA 4KLNA 1L7BA 1LC3A 3VUEA 3DMPA 3DM5A 2VTKA 4V1CA 5JTTA 2HRRA 2BE7A 3NGMA 5FUYA 1Q7BA 2PH1A 5EXSA 3HCDA 1OMOA 4BWYA 1JI3A 2B3TA 3WAKA 3ZD7A 1XJWA 2IPLA 1QRAA 2CV1A 4OV6B 3LBHA 2J41A 2CWWA 2KLHA 3AXSA 1HYHA 1RRMA 2R6AA 3FMPB 3OPYA 4H17A 4J0CA 4RVFA 3I39X 5FQOA 2FK7A 4FLFA 4HH0A 4C0HA 3W6ZA 5IULC 5CLQA 3N6XA 1WA5A 3FUXA 1PX0A 3RG8A 2CMGA 3I45A 1E77A 5IZCA 1BTOA 2VTEA 2YXEA 3FKSD 1QGAA 4XXHA 3SC6A 3HJBA 4Q37A 1UFKA 4PEVA 4EMTA 4UKDA 2X5JO 4B6RA 5K3EA 1FVHA 2E82A 2RBEA 3NHZA 4CV3A 1E18A 1RLJA 4WKBA 4EABA 4BEJA 4F8YA 1Z26A 2PTHA 5GJBA 3X3HA 1UPCA 1T9CA 1DB3A 1QAMA 3K0CA 3P0FA 4CGZA 2NZ2A 4WE3A 2YMPA 2V0CA 4E5UA 2XVZA 1IWBB 3JVIA 4MA4A 3BIWA 3LUHA 4RMNA 2CHVA 3G49A 4JJ6A 1ELOA 1NN5A 2NZUG 2Y4OA 3PGLA 4IXWA 5BP7A 3HCPA 1LBSA 1F9EA 1T5DX 1HLPA 1NQTA 1IY2A 1SKUA 3MYRA 1EFVA 1RZUA 3AR5A 3CUEF 4YONB 4HRAA 1P7WA 1TL7C 1MAHA 4R6XA 1VIYA 5EHQA 3WFIA 3JQ7A 3T3DA 4H59A 4PVCA 3UENA 4M55A 1MNAA 4P32A 1E0DA 2XD4A 1I4WA 1GCGA 2JL1A 2VDJA 3BH6A 1UK9A 3TQFA 3GZ4A 2GEVA 4FHEA 1SHUX 4NZZA 4G5GA 2I1WA 3O5AA 1DINA 3IEIA 3WK8A 2OV1A 1UPBA 1XHFA 4F46A 2VEDA 1JB1A 3V4ZA 2P75A 1NW9B 5LD2B 3VH4A 4WNAA 4TKMA 2VP6A 3S44A 3ZK7A 2HYDA 3QY0A 3VX4A 4D25A 1I1QB 5DPMA 4X62B 3PC2A 2DGDA 4HAZA 5BR1A 5HQTA 1RZRD 4MS1A 4C04A 4K6GA 3ER9A 4ZVLA 2H1LA 4MCAA 2HMTA 1QAQA 1C2TA 2ZYUX 3AGQA 4L5YA 2ISQA 2BCEA 2ORVA 4YV0A 1GGKA 5A4IS 4P7JA 3LT0A 4JJ8A 4LE2A 1Z73A 4FTWA 1DMSA 3GGJA 4PYNA 4YAGA 2WKQA 4HWKA 1SCJA 3HDGA 3VR6A 4E4TA 2OMEA 2W37A 3ET4A 1W52X 3B1ZA 4DBLE 4O4HB 1O0CA 5KTRA 3FZYA 4LCEA 4NLLA 4UCFA 1QHHA 3QKSA 3JQGB 1NDUA 2K2QB 4WKCA 5AK6A 1HOTA 3FRIA 4J16A 4FGJA 4IEIA 2BUCA 3BHIA 5G0VA 5A0FA 3W2HA 3PUKA 5YASA 2I6SA 1M2EA 4AKSA 3TTTA 4TTTS 2VNKA 5DHUA 3M9LA 2G8LA 5IVPA 2XVXA 1P1JA 3WL7A 3O1LA 2FLKA 2CUKA 2GTIA 4URWR 1Z13A 5KVCA 5BUCA 1RPZA 5F9MA 4IEFB 5IKOA 5HNKA 2N1BA 3CZ5A 3BF7A 1Y63A 3ZCPA 3GV0A 2X3UA 3PNVA 1EAMA 1TFRA 1UFOA 3NUQA 1DT3A 2JVKA 3NC4A 1J2EA 1WMAA 5HIMA 3IUMA 2IX9A 1QK5A 1N5IA 5IF3A 5DYIA 5EUCA 3FA2A 2PBFA 2Y3IA 3HFSA 3REGA 1MQAA 4AWBA 5B6PA 1F12A 1E7SA 1LPMA 1W96A 4KUGA 2EBFX 3UCEA 3QLUA 3UJ7A 1LPPA 2HXGA 3TNDA 4MVJG 4LDPA 1KE2A 2EJCA 4DMFA 2XB8A 3FYUB 4MIKA 4MV4A 5JPCA 2Y0PA 2PX6A 3JATB 1XJQA 2NO6A 4PBTA 1YK1A 3BXOA 1IPFA 1QGDA 2AH5A 5M7EA 1X8LA 2O9JA 1QYIA 3LNCA 3JAWB 1QSGA 5AKIA 5C4IA 2V4ZA 2Z6AA 2BKEA 4DLBA 3LX4A 1RQXA 2LP4Y 3ZGLA 2DLDA 1FFHA 3GQBB 5AQ1A 1W9MA 1EGAA 4ZMBA 1JQAA 4Q9DA 4R05A 4RXUA 4C07A 5KBYA 3DMTA 2WA2A 1QS0A 1B2RA 3GN2A 3WSWA 3VR4A 3RS8A 2ERXA 1ZICA 1OROA 2B7CA 3DGEC 1APBA 3CN9A 1PGPA 4X7BA 1O8BA 1R4AA 3THXA 1GLVA 2PN1A 2PX8A 4GX1A 4CN8A 3O3MB 3FOFC 4KXLA 3ZBTA 5KSPA 4QODA 3RWOA 3N1UA 4WCVA 5GAJA 1FDOA 2QD5A 4Q9HA 2Y67A 1BIFA 2FEOA 4BWFB 2QU8A 5FPTA 4M0KA 1EQUA 2Y99A 1E2UA 1KMHB 4EHLA 3CGGA 2GPSA 3S8YA 3KBOA 2XD9A 2ACKA 1M2VA 3MHTA 1WCXA 3KVVA 3JWJA 3O84A 3RIHA 2IRWA 3G9ZA 3DLAA 4JP5A 3U0VA 3DO6A 4QUEA 4IJ5A 3PNLA 2HQRA 4NARA 3IV9A 1QLWA 2V7BA 4YS6A 5C1OA 1G21B 2OXIA 2QENA 3K1TA 4CNQA 4TKLA 2OVFA 1K2WA 1DKNA 1Q3HA 1XJCA 4QXRA 3SI7A 4CUKA 4DM7A 1L5RA 6AT1A 5IXYA 5KYWB 2F67A 5EKXA 5F4ZA 1C8VB 3EMKA 2HI0A 3PVCA 3SYKA 1P8JA 2VUHB 3DE2X 3RVRA 1G20A 4PO9A 5B58C 4TSKA 1SG6A 3ZVNA 5A0VA 4X1KA 3R9XB 3SHOA 3QTBA 1NYQA 4DCMA 4EF4A 1OTYA 1E8MA 1C81A 3I8XA 3SBEA 2YWGA 5D5HA 4MQ4A 1DAKA 4RLSA 5AJZA 2YJ4A 4Q21A 3HU3A 2WAYA 1R1DA 1Q14A 4D8TA 6PFKA 3EJWA 2GCGA 3UPUA 2I4LA 1KVSA 2QUAA 4BX2A 4MLDA 1L5WA 1UANA 3DG9A 3P5SA 3BTOA 3KQOA 5GM1A 3B82A 4CKZA 2ZVDA 2WWGA 4BTVA 3BXPA 1U6JA 2HLDA 2VJNA 3AYXB 3CUSA 3DBLA 3VC1A 1ISRA 2RH8A 4FZ3A 3JD4A 2GJSA 2TYSB 3GRYA 4A26A 3ACCA 3Q9UA 1MAVA 2PD3A 1WF6A 4M8KA 2Z43A 3M82A 4Y67A 1GHTA 4M9QA 2PJUA 1NBIA 1M6YA 3K0FA 3HN7A 4A0QA 2F17A 3NOXA 3HGMA 3O9ZA 2XYGA 3O83A 5AJWA 2GZSA 4BJ1A 4RV5A 2QRGA 3M3DA 1UT6A 3U7RA 3C5HA 1IJBA 5FOWA 3HXKA 3VC7A 4C5AA 1U2QA 3GX1A 4S0ZA 2QGFA 2E85A 4L4XA 4RLQA 3IOBA 1F0KA 3HRIA 1JLSA 2RHMA 3PXGA 3L8MA 3IT3A 4UM8B 2VUTA 1STOA 3EXFB 4OB8A 4XB6B 5EWLA 4DQ0A 3K6SA 4GPBA 3LT5A 4IOKA 1EHYA 1JJFA 2PT5A 3BD6A 4EDHA 1KYZA 2L18A 4HZGA 5LU9A 1IVSA 1DO0A 2GPBA 2JFHA 2JJMA 3AFNA 4IQFA 3R8FA 4V0ME 4IM7A 3V1UA 3F4KA 2VPIA 4CVNA 1QC5B 5IASA 1PBNA 4OA8A 4MW4A 3DE3X 1OJ7A 4X20B 3ZS8A 2I7DA 3VC3A 4BFTA 1KHTA 1NV9A 2QZJA 3BWCA 3E3NA 4BMSA 1JDBB 1P7ZA 4XYEA 2PKRA 5DN9A 2GH1A 3W2GA 3WC4A 4Q9NA 2GLTA 4EO9A 4FGLA 3AY6A 4O1HA 1VJGA 2I4OA 4JLWA 1Q0LA 2B5OA 4I5EA 3DH0A 4Z4CA 4Y9DA 4QDOA 4NFHA 5EPOA 4CLHA 4L50A 3HA7A 3WJ7A 4GP6A 1HFJA 3PLAE 3JWIA 3ME5A 5CU7A 1WPXA 4EGJA 621PA 3UGJA 1GQOA 2PQ2A 2Z6VA 2OYSA 5EY5B 1RC8A 4KSYA 4RL6A 2DLNA 3ZWYA 2ZSUA 5C9ZA 2V98A 3W8NA 1TUEA 1Q57A 1LWOA 3DZDA 3E22B 3NEJA 3NTOA 1W1UA 5D85A 4E5VA 3N28A 3SHVA 3CNQS 1KZ6A 3GJ5A 2QIPA 3KS9A 4MB6A 1PR5A 4U00A 3EFOB 3WRYA 4JI3B 3SXUB 1NQ5A 5CB0A 3C6XA 2J9ZB 4QULA 3VU3A 3ELWA 1OWPA 3VFDA 4X41A 1W75A 2C77A 2HQBA 3UC5A 4YXWA 4DG5A 3ZCUA 4IZIA 2WK1A 4AO7A 5HOQA 4WXYB 2GN1A 1PUJA 4J29A 5TGDA 3CUUA 4P3KA 4Y9TA 1NN3A 1N0UA 3OJXA 2JPDA 1Z56C 4S1VA 2CJPA 5ENVA 1SXGA 5BXQC 4HYYA 2OL4A 1GM5A 2FU5C 6REQA 2WHXA 1IDOA 4MB0A 3OTGA 3A0RB 2RK6A 5L3RA 1FPQA 1OBOA 3W8DA 2XB4A 1QG4A 1FTSA 4BYMA 1OVGA 2W2LD 3GEMA 4JLAA 3A1TA 4GQBA 4ZODA 3KZOA 4B32A 4OVKA 3B36A 4WACA 4D9FA 4KJZA 1T0BA 1DIAA 2GHTA 1CJUC 3BFVA 1NGSA 1TUIA 2B8WA 1BSVA 2XAUA 2ZTHA 1YK0A 1AZLA 2A5LA 2DBVO 3FJYA 1RYBA 4IVRA 1SXJD 4X3PA 5LDGA 1FS5A 4MS3A 1PJZA 3KQKA 1F8YA 3D2CA 4NPAA 1TVMA 4Y7DA 2BTOA 4WA7A 2HK7A 1NURA 1Z6QA 3DV0A 1XNGA 1BE1A 5EZYB 2HT1A 4Z6KA 4Z7NB 1QS0B 3SBXA 1NF8A 3RARA 2C9DA 1NF3A 3L04A 1LSUA 4D43A 4S04A 4GZ6A 3LHKA 3LRTA 2MSEB 3AJEA 4PHTA 5IVHA 1JPNA 5A71A 2RAPA 3K8QA 3OTQA 1LBIA 3T7SA 1U9JA 2HCJB 3BIFA 3EFHA 3OOSA 2Y66A 1QYWA 2PKYX 4DYVA 4FB5A 4DV6B 3H2BA 1X7ZB 2W6MA 3PL5A 1C9YA 2GBFA 3EARA 3PUYA 5DHPA 4M7PA 2H5LA 1G3MA 5AW3A 5AVSA 1M6NA 4DUZB 4EAAA 3U3ZA 3URKA 5KNCD 1A5ZA 1U7DA 3R6LA 4HQNA 2Y1WA 2HF2A 1DX9A 2EAUA 4PGGA 1I7NA 1XZJA 4AYWA 3KU1A 2Q07A 5DOVA 1J0CA 1HQYE 1RR6A 3O8DA 4RD4A 1UJ6A 3L9XA 1YSCA 1C4XA 2H4ZA 2H7CA 2NN3C 4PYKA 2OESA 3FSEA 4BFLA 2WILA 4LC9A 1RJ9B 3INGA 1M2FA 1XV5A 4I55F 3SHWA 1N3YA 3E9NA 4ATNA 1H85A 4HLNA 4MYHA 1C5KA 3JALA 2H59A 2X0IA 1HKUA 3DMFA 3KHKA 4MS4A 5IP5A 5LQRA 2FQYA 3NBFA 2IT1A 2B2XA 1PSZA 1U9IC 1V0JA 4OYLA 4ERNA 3GARA 3EPPA 5TEWA 4H9GA 5CURA 2OGSA 3N59A 4DIDA 1ULBA 2XUIA 4ME6A 5JNLA 1CUBA 2BP7B 2FJ0A 1RAGA 2WY2D 3COVA 1F4PA 1ULUA 2BMAA 3PU6A 3Q11A 1J2JA 4LJ7A 3RUIA 3ZE9A 5A4FS 1XL0A 2HQ1A 4DADA 1SCKA 1DC3A 2J3EA 3U4AA 2B34A 2HPAA 2P27A 1P4RA 2XDWA 4Y9RA 3TIGA 4TMVA 4H7JA 4IGAA 4CMIB 2OENG 3VZPA 4MWBA 2PYIA 3IERA 3RRBA 2JK1A 3DDWA 3IAUA 4MVJM 3DHVA 4R0MA 3PC3A 5CDUA 3OQBA 1CUYA 3A3NA 3W4KA 2RARA 4D79A 1VHDA 3ZZNA 1JWBB 3GUYA 4P4GA 4PYLA 5HIAA 3BMOA 3H9EO 4YCAA 5BSWA 3QEAZ 4A10A 1ABEA 1V39A 4P4SA 3I5AA 2IYLD 3U26A 1BX3A 3H6KA 4UULA 2JFOA 4RZIA 2VCYA 3BTSA 1K8RA 4X9XA 4B33A 1AKWA 1B6TA 1KJ9A 2PZMA 4CM8B 3I42A 2NXCA 3DDZX 1E6KA 1VMIA 3JXEA 5HKKD 2J6BA 3SM3A 3H1EA 4A92A 2P65A 4UREA 3OPVA 3ZTTA 1MGPA 1KJYA 3VU1A 2E7ZA 3KJGA 3T12A 2FTKE 4C30A 4O33A 2RG1A 5E3JA 1E1YA 1LPAB 3PJEA 5GOTA 1DBRA 1D6MA 3W6UA 1T2VA 1XHLA 4BB0A 5M29A 1CQJA 4BN4A 4QOEA 5B6JA 4NYJQ 1QLHA 2VSNA 4EYEA 1LBQA 1JU3A 4IDBA 4JQZA 4NR0A 1MG5A 2QRJA 1NT4A 3N3AC 3VPBA 2O2EA 5T4BA 3H2SA 3U9SA 3D7NA 3N74A 4QNNA 4TV9B 4V0MA 2QLFA 5CB4A 3NORA 4RF2A 4LEIA 5K8TA 1K8ZB 1U1GA 4I9HA 4OFWA 1T15A 4U2BA 1U0TA 5CJJA 5CXXA 3TCXB 5LUAA 4YT5A 4PLYA 3RT9A 4AP6A 1DEHA 4IILA 5L3VA 1UJNA 1PDOA 4XCXA 3WZ2A 5ICSA 3JAKA 1C0LA