5LQKA

Crystal structure of comt in complex with n-[(e)-3-[(2r,3s,4r,5r)-5-(6-aminopurin-9-yl)-3,4-dihydroxyoxolan-2-yl]prop-2-enyl]-2,3-dihydroxy-5-[(4-methylphenyl)methyl]benzamide
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
216
structure length
216
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Crystal Structure of COMT
rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 80
structure length 216
sequence length 216
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5lqkA00
1ZHFA 3TQSA 1YB2A 1UWVA 2PWYA 3EPPA 3KQYA 4HRAA 4RVGA 1NT2A 3QOXA 3AJDA 3BKWA 4GC9A 4PCLA 1JG3A 1SKMA 5CCBA 1YFLA 2Z6UA 3LDGA 2ZCJA 1WS6A 4Z2YA 2I9KA 5E1DA 5FWDA 2PXAA 1M0EA 4HSGA 3FUXA 3G8BA 3HA3A 4DA4A 3KHKA 1DCTA 5GM1A 1PJZA 4E2ZA 4GC5A 4OQEA 1X1DA 2QY6A 4RVDA 2P3QA 2C7QA 2ZBQA 3B89A 1MHTA 1AF7A 2PXXA 4RTOA 3M6WA 4C4AA 4DCMA 2ZZMA 2PVCA 2HV9A 3HVIA 3B3GA 4C03A 4KDCA 4MWZA 3KQTA 1EG2A 5P8WA 3R24A 3UJ6A 3ELWA 3EVEA 2XYRA 1JQDA 3AXSA 4RV9A 4E2XA 4RTMA 3GCZA 3G88A 3DR5A 5JR3A 1YUBA 3GGDA 2AN5A 4PIMA 2IDJA 3C3YA 4C05A 3TKYA 2B3TA 5KS2A 1JSZA 1ZKDA 2PGXA 2FK8A 1P91A 3DXZA 5FA5A 3TM5A 5HFJA 4HTFB 2YXLA 2PXCA 2KW5A 3C6KA 1F3LA 2ZTHA 1KPIA 3CGGA 3NDJA 3M6UA 1JTEA 4O29A 3UJ7A 1IM8A 3MCTA 1NW8A 1BKYA 4RTKA 1NW3A 2ZIGA 2PX8A 3SVZA 1L3IA 5H02A 3KQWA 3BT7A 1VIDA 3DTNA 3BKXA 5LQAA 1T43A 2N47A 2PBFA 2P7HA 3E23A 2YUIA 3FTDA 5EHIA 5C9ZA 10MHA 3R0QA 2OZVA 1P1CA 3MHTA 4P58A 2B2CA 3FRHA 3RW9A 3ELUA 3O4FA 4PWYA 5EMLA 3THRA 3I58A 5HZMA 3ERCA 3FUUA 4CTKA 1NW7A 2PY6A 3GU3A 3AY0A 3JWIA 1L3BA 1M6YA 4JXJA 4GOND 4HH4A 2IBSA 3P9KA 4EMSA 2C7RA 3P9CA 1G60A 1L9KA 5GIOE 4QQNA 4OX9Y 4LECA 3SR4A 4CKBA 3PLAE 1Y8CA 4F84A 3HCCA 3M6VA 1RI3A 4UOEA 2P8JA 3BWBA 2CL5A 4WVLA 3TR6A 4EQZA 2IH4A 4X1OA 1EJ6A 3HCBA 5CD1A 2OB1A 1BOOA 2JH8A 3HCEA 4YV0A 3TFWA 2YXEA 1P39A 2NNWB 3FPGA 1YF3A 4ATNA 1NW5A 5HIIA 1KHHA 4PYKA 1PRYA 2EJUA 1NBHA 1KR5A 4RVHA 3T7TA 2C7PA 4MHTA 1L3CA 3HCFA 4XUDA 4E31A 2GS9A 3SSOA 2AZTA 3K6RA 1VPTA 2NXCA 4MTLA 2AVNA 2IPXA 5EKXA 3A7EA 5D1NA 2P41A 3LCUA 3PX3A 3LCVB 1EJ0A 1D2GA 3PX2A 3T7SA 1RI4A 2B78A 3UJDA 1JQ3A 1NW6A 4RWZA 1M6EX 1QYRA 2GB4A 5BP7A 1WXWA 3B7PA 3O31A 4H0NA 4AZVA 3EEYA 2EFJA 3G5LA 3H2BA 2G70A 3T0IA 4DCGA 2UYCA 3LL7A 3UWPA 5LQJA 4RVFA 2UYOA 3M4XA 5KYGA 3ID6C 1KIAA 2BZGA 4QPPA 5JUWA 2PX4A 2CKDA 1OR8A 3DOUA 5DSXA 2YQZA 4PYJA 5BXYA 4LG1A 5LQUA 2EG5A 3KQSA 3MB5A 5DWQA 5BW5A 3UA4A 5GWXA 3GRUA 4PNEA 3LPMA 3OU6A 4DM3A 3EVGA 5CCXA 3KPUA 1N7IA 5DTRA 5E1MA 1ORHA 2I6GA 2OB2A 4PIPA 2BH2A 4B17A 5LR6A 4ZTBA 4R8RA 5GM2A 1JQEA 2ZWAA 2GLUA 1EAMA 2YR0A 5E2BA 2WA2A 3G2OA 1ZQ9A 4RTLA 3O7WA 1X1BA 2NP6A 3MERA 2PKWA 2QRVB 1RJDA 3C3PA 3SX0A 4C06A 1UIRA 4Y30A 2XYVA 2NYUA 2PV0A 3P71T 4XUCA 1VLMA 3P2EA 3UFBA 4GF5A 9MHTA 2PT9A 1G6Q1 1G8SA 2ZIEA 5CM2Z 3RIEA 5ICEA 3UBTA 3T7RA 3REOA 3Q87B 2P3OA 3JWGA 4X60A 5E2AA 4BLUA 4ISCA 2QM3A 2G71A 4E33A 2IFTA 3GRYA 3I64A 2VZ9A 2Y1WA 5EHGA 4GBED 5U4XA 4YV1A 3HP7A 3UZUA 2HR1A 3P2KA 5K0CA 2Y1XA 4PYQA 1UFKA 3P2IA 4C08A 5K0NA 4X61A 5K8VA 5GINE 3PVCA 1WXXA 3THSA 2VDVE 4FT4A 3GDHA 5HIJA 1RI5A 2ZLBA 3JWJA 3QV2A 4MQ4A 2ZBRA 5HIMA 3RODA 4YUZA 4YUXA 5CIYA 4BY9E 2ADMA 2BR5A 2WA1A 4GQBA 5G02A 3OU7A 4PYMA 4R05A 3OZTA 4PCAA 3B3JA 5EGSA 2Z6QA 4E2WA 2UYQA 3E05A 4E32A 4RTNA 1KYZA 2EX4A 1FBNA 3M6XA 2HMYB 4KDRA 4OBXA 4F86A 3GJYA 4RTQA 3HM2A 3V97A 4ER3A 3TKAA 4RTSA 1P1BA 5C1IA 5GP1A 2C7OA 5LQNA 1R8XA 4RTJA 5DPMA 1AQJA 4PINA 4GOLD 4QTUB 1AV6A 2V7EA 2O57A 4QDKA 4QQKA 2AS0A 3L8DA 2O07A 4ER5A 3MGGA 2JH9A 4KRGA 3M33A 2OBFA 1XJ5A 3C0KA 5DSTA 3CJQA 4AZWA 3NWEA 2NP7A 3G5TA 1Q0SA 5CVEA 3G8AA 3A25A 3PTAA 4WXHA 1KYWA 3GRRA 5ERGB 4AZTA 5FQOA 4FSDA 4P7KA 1NV9A 3R9XB 1ORIA 1SVUA 4IV8A 2JHPA 4NECA 2AOVA 3DMGA 1EIZA 1XCLA 4QDJA 1WY7A 3DXYA 3KPVA 4G56A 5EG5A 3NW9A 2IP2A 4PYNA 3OZSA 2B9EA 1NV8A 3CJTA 3MAGA 5HEKA 4IWNA 3KQOA 2O06A 2K4MA 4CTJA 4C07A 4ER7A 2IH2A 4M36A 2B25A 4E30A 1X1AA 5F2OA 5ICGA 5LQCA 3E7PA 3HCAA 3OPNA 4OA8A 3UJCA 1VBFA 3P9NA 1HMYA 4P7GA 3MTEA 2PWPA 1NKVA 3HEMA 1XCJA 1NE2A 3LDFA 2OYRA 2IH5A 3MCZA 4FSXA 1MJFA 1ZG3A 3KR9A 3LKDA 2P40A 3AWIA 2Q41A 3KU1A 2GAFA 1U2ZA 2JJQA 2VDUE 4X63A 5DRTA 5EQJB 5EZQA 1KP9A 2IBTA 1XDZA 5DT2A 3FZGA 4EK9A 1YZ3A 3CC8A 3FTFA 3NVMB 1JG2A 5K0FA 3KKZA 3F4KA 3SXJA 2PX2A 3DMHA 3D2LA 5E1OA 5EKUA 3BXOA 1FPQA 3UJAA 2P3LA 1R18A 5EEHA 3SMQA 3DLIA 1DL5A 1QZZA 1D2HA 5LSAA 2PX5A 2AVDA 3A27A 3SSNA 3BGVA 2IGTA 3IYLW 3KQVA 1O9GA 5DRYA 3JWHA 5T64A 2OPBA 3FTEA 1KXZA 3CJRA 3DUWA 4PYIA 3TLJA 4Y2HA 3KPYA 5FULA 4FR0A 1VP9A 1XVAA 3OZRA 5EMMA 3KR2A 4IV0A 5K0BA 1QAOA 2AOUB 1N2XA 1TW3A 1B42A 1RJGA 3SM3A 4MIKA 3NVKI 2G8NA 4L7VA 4M7RA 1Z3CA 2ERCA 1JG1A 3HVHA 3IHTA 2P1DA 3FYDA 3K0BA 3BWYA 5HILA 5K05A 3ER9A 5KQSA 1H1DA 3DULA 2GA9A 3OFKA 1XXLA 4QPNA 4HGZA 3HVJA 5DX1A 4KIFA 5EC8A 5E9JA 1G8AA 3GO4A 5F2KA 3A26A 3G7UA 3GRZA 1R74A 4PGHA 2HNKA 4GOOD 2ZBPA 3HA7A 1D2CA 4CXMA 3FUTA 4LWPA 5E1BA 5B1SA 4YMGA 2I62A 7MHTA 3TRKA 4AUKA 5T6BA 5ICCA 2QYOA 5FUBA 3BWCA 1AQIA 5EIFA 4RTRA 2ZZKA 1O9HA 5DM2A 2DULA 3EVFA 1SUIA 3FYCA 5E9QA 1QAQA 3FPFA 5M5BA 3PFHA 4X41A 5KQRA 2CMGA 1ZGAA 2HWKA 2IDKA 3LBFA 2NXEA 2XYQA 4FT2A 4BLVA 4M37A 4DZRA 5CUQA 1I4WA 4AZSA 5K09A 1BC5A 3KR0A 5FTWA 1JR4A 3OCJA 4IKPA 3MQ2A 4AX8A 3I53A 4M38A 1I1NA 5FADA 3BUSA 2FYTA 1DUSA 1VQ1A 2JHAA 4PYLA 3WSTA 1SQFA 4BP1A 2FPOA 2Z6AA 3EGEA 5DM1A 3GNLA 3OFJA 4E70A 2O0LA 3FPJA 2P35A 4PYOA 3A7DA 2E5WA 3EMDA 3FUVA 5F2NA 4BLWA 3TM4A 3EVBA 3OE5A 1R00A 5EMJA 4FP9A 5CVDA 2BM9A 4YUWA 2A14A 3EMBA 3EVCA 2I7CA 4PGGA 4CWAA 2AR0A 3EVZA 2VP3A 3PB3A 1WG8A 4P7FA 1Q0TA 2G72A 3HA5A 3UA3A 5LQRA 3B3FA 4OBWA 4V0RA 2CMHA 3SSMA 4DKJA 5K0JA 3MTIA 5DM4A 3ER8A 1X1CA 1BHJA 3G89A 2GH1A 4RX1A 2HTEA 4GOMD 4R6XA 3HVKA 1XDUA 4A6DA 1WZNA 2P7IA 3KQQA 3NTVA 4QVKA 2OKCA 2R6ZA 2ZULA 3KPWA 3CVOA 5CVJA 3ORHA 4FS8A 1SQGA 2VDWA 2ZFUA 3HNRA 5D1HA 1R8YA 1R6AA 5K03A 2AOUA 3PT9A 5EVJA 1G55A 2ONYA 3S68A 3P8ZA 3FUWA 2R3SA 5HOQA 5IH3A 2NXNA 2ZWVA 5EPEA 3TOSA 3P9IA 3Q7EA 1G38A 5E8JA 3CBGA 2PT6A 2ZW9A 2WK1A 2XVAA 3LHDA 1RJFA 3LKZA 4V0QA 4XUEA 3R6TA 2XBMA 3ANXA 3EGIA 3HCDA 3M70A 2QE6A 3OE4A 4LWOA 4QTTB 4RSRA 5K01A 1YFJA 2EJTA 2ONZA 3VC1A 3EVDA 2LD4A 4E2YA 3G2QA 2JHCA 5GIPE 1INLA 3A4TA 2H11A 3R3HA 5C0OE 3SGLA 4DMGA 3C6MA 3I5UA 2F8LA 2FCAA 3EGVA 3I9FA 4KWCA 5CVUA 4HG2A 5FA8A 4GEKA 1RI1A 4PONA 3E8SA 5EZSA 4P7JA 3V8VA 4BP3A 1HNNA 1XTPA 3BGDA 3LECA 2V74B 5DX0A 2ZIFA 2H1RA 2PSSA 1VE3A 4YUYA 5FQNA 3LX6A 3ME5A 5CVVA 3NJRA 8MHTA 4OQDA 2OO3A 3ELYA 4GUAA 2O05A 2JG3A 2G1PA 3GIWA 3PS9A 3G2MA 3NDIA 4POOA 2FK7A 3LCCA 2YXDA 3DLCA 4FGZA 4R8SA 3BZBA 3IEIA 3HTXA 5DXAA 2AOTB 2ZVJA 5K0LA 3P97A 5HIKA 4U7TB 2BR3A 4YMHA 5FCDA 5MHTA 3NMUF 2FRXA 2AOTA 3FRIA 4A6EA 4DF3A 4EKGA 4YV2A 2AN4A 4HC4A 5E9WA 1V39A 4FZVA 1VL5A 2H00A 2YTZA 4F85A 5DX8A 3LGAA 1ZGJA 2FHPA 2BR4A 3EVAA 3U81A 5DM0A 2YX1A 4EKIA 3KPJA 1N7JA 3KQPA 1JSXA 4EVIA 1JTFA 1RJEA 5EIWA 1FP2A 4OA5A 3DH0A 3TPZA 4CKEA 1SUSA 3OU2A 2AOWA 2AOXA 3FPHA 1QAMA 5EEGA 5FWAA 5GOZA 1O54A 5FHRA 3BGIA 5FHQA 4CKCA 1I9GA 4HTFA 5DLYA 3UJ9A 3LSTA 2XVMA 1FP1D 2NXJA 4HGYA 5ICFA 5K0GA 2ZZNA 1XDSA 1SG9A 1TW2A 1KPHA 1X19A 5DTQA 4ER6A 3FPEA 3BWMA 4RTPA 3GRVA 1IY9A 3DXXA 3LBYA 3AXTA 1L1EA 2QRVA 3DMFA 4KIGA 5DXJA 4YUVA 3TMAA 2GPYA 2UYHA 1YZHA 2DPMA 2ESRA 3NWBA 4K6MA 3KR1A 3UJBA 2YVLA 1EQAA 5IKMA 3UJ8A 2UZ4A 1KPGA 2VS1A 5T67A 4XCXA 5K0EA 4KW7A 4U7PB 4R6WA 3X0DA 5BW4A 3GWZA 2AN3A 4C04A 3FTCA 5LQKA 1IXKA 2IIPA 3LDUA 2ORED 5DTMA 3VYWA 2CWWA 3VSEA 2OXTA 3G2PA 3B5IA 3ELDA 3VC2A 4RYLA 1QANA 3DP7A 4QVGA 2PJDA 5EOVA 2PLWA 3GXOA 3CCFA 1FJXA 1TPYA 4ER0A 3KQMA 1JG4A 3PFGA 4KVZA 4DQ0A 3EEOA 5KVAA 5E8RA 2BM8A 3IV6A 1NBIA 1RI2A 3CKKA 1F38A 3QOWA 5EMKA 2ZSUA 2OY0A 1VP3A
chains in the Genus database with same CATH superfamily
3GJ7A 3V8QA 5JPCA 1TTTA 5U9CA 2GCOA 2ID4A 2A9OA 2YRXA 4C2AA 5FDFA 3EPRA 3BIFA 5JPDA 2Z6UA 2QKYA 4CF3A 3DMYA 4DARA 3OSUA 4KFUA 3QKRB 2ZYRA 1NXOA 4YMLA 3IXMA 1AT1A 1U1FA 3HA3A 3OEYA 1FDTA 2ZCVA 3T3MB 5DCWA 2G9ZA 3VOTA 4F96A 1ZGHA 2BIFA 1K0UA 3D2AA 3LBHA 4HRYA 1VXRA 3P0FA 1C7EA 3PXBA 2ZBQA 3F5DA 4C0JA 2CSXA 1FXWA 3U62A 1LLCA 3LYLA 4MYHA 1PZFA 1UC5B 2A5FA 1QV6A 1MG5A 3RT7A 1NNI1 2LGJA 1X7DA 3DBRB 3R9XA 2HA7A 4BDTA 1P2VA 4Q21A 1Z4JA 2BP7A 3PQFA 4FB5A 1OT5A 4OU5A 4QFDA 3M6MD 3RARA 4AO6A 5MFZA 1UJ4A 2OFPA 1FP7A 2HDWA 4F12A 5KAMA 2Z6VA 4HWGA 1UXOA 2JCBA 2FK8A 1P91A 2NM0A 1KEPA 2R8EA 1HTWA 3A6EA 1SOWA 1F3LA 2ZTHA 2WD9A 3B1JA 1RRFA 1Z06A 5D5PA 4D3ZA 2R7AA 3PSHA 5JD6A 4HLUA 1L7XA 4ZP1A 4LRUA 1AO0A 1C4OA 2GD6A 1QNFA 1Z5VA 4M0PA 4QT0A 1BHSA 1COZA 1WVMA 2PX8A 5MDHA 4MVCA 3FWNA 4ZHQA 4D44A 2WF5A 2XRMA 1HFEL 2PYDA 3DONA 2PRZA 3Q5DA 2DLNA 3MGAA 4DDWA 2J5RA 4YWHA 1WOMA 3T99A 4HFMA 2IHVA 2QLNA 2M6KA 3ZVMA 1X74A 4ZZ0A 1S2MA 2FEAA 4P58A 4E12A 1UL1X 3KE8A 3VBCA 5ESWA 2R5FA 3TD2A 3THRA 4C3ZA 2WTUA 2I7VA 3TS1A 4CIYA 2FSPA 2WDZA 3K20A 4J91A 2PKYX 4QWMA 3C14C 2LTAA 1M5UA 3HSKA 4NTZA 1N3BA 4HDCA 3LUDA 3TSAA 1IBKB 1LWOA 3VNRA 3ZBPA 3DKKA 1WA5A 1VIMA 3FPBA 4JR1A 4QC2A 2C7RA 1PNQA 2ROQA 2QUIA 4IRMA 3ZJVA 4IINA 5IMBA 3S81A 1I2CA 2JLBA 3HCCA 3HUFA 1B1CA 2QRPA 4U8HA 4YN3A 2IH4A 2CL5A 3CW2A 4OFXA 3BXFA 3W34A 3FFBA 1DB3A 1XZFA 3D8SA 1APBA 2BSXA 2YXEA 4FGLA 5F33A 3OIVA 1G5HA 4B33A 4R01A 4L15A 3M6AA 4AQYB 3OTIA 3PG5A 4RD4A 3ZY3A 1X14A 5FJIA 3T8YA 2FSVA 1FMTA 4PSCA 1KI1A 4RIGA 2JI9A 4JELA 1XAHA 1ZN2A 3E70C 5C8ZA 5DNUA 3O8RA 2H5EA 3ANMA 1RI4A 4IL5A 5KOHA 3TI7A 3CLUC 4MUMA 2WHXA 4MYTA 1P44A 1OFHA 1KJYA 1G8MA 1KA9H 3OE7A 2XZLA 1D6NA 2AC2A 4FQ5A 5HCNA 4H16A 5JC8A 1H6DA 3B82A 3LL7A 4ANFA 2IBMA 4F9TA 1JIUA 4YK7A 3EZXA 3LPAA 4LNUB 4WZAB 3I2IA 2DKFA 2Z8YM 3OQJA 4G9BA 2PX4A 5DSXA 3VHXA 3WBKA 1XCPA 3SC2A 1FB5A 4TOIA 1AF4A 1ADJA 1G6OA 1RTKA 1WF6A 3HZHA 4URZR 4PYJA 3K71B 3EG9B 1OSNA 1PJSA 3IMKA 1W30A 6AT1A 4R1QA 1F6DA 3NNDA 1KE2A 5KWEA 1CS0B 1P5HA 2WU1A 4LYFA 4TVKA 2HFJA 1ILEA 3CZPA 3IE2A 4QO8A 2H18A 3CH6A 1DQSA 3WYDA 3CSUA 3DDSA 2G9NA 1NPYA 1OI7A 1X80B 4NZZA 1X1BA 3D8UA 3RU7A 3TGWA 3UT6A 4RTLA 2Y66A 5C46F 5K7SA 1K6EA 3GFSA 4DPLA 3IBSA 5DK6A 4JJKA 4B81A 3L6BA 4C4PA 5KVCA 4G23A 4P5EA 1XVTA 5BYJA 3TW0A 3V6MA 2GQ0A 3OCVA 4XSGA 2GZAA 2WUFA 1S96A 1U7HA 3ULKA 4YRSA 1N5LA 2MTBA 3TJMA 4TWIA 3HCNA 4O4JA 3VR5H 3WWZA 2B98A 2OAP1 2EJBA 2D0OB 3S8EA 1U3DA 1K9SA 5FAKA 4Y3UA 3O2QB 5K0CA 3KETA 2PMWB 3GRPA 4GRDA 4MB6A 2W6IA 3HKBA 4QSHA 2PHZA 1T36A 4BAZA 3B5JA 1WMEA 1YZLA 3CLHA 3E9YA 4MA5A 4BN4A 1AXGA 2EW2A 2ZLBA 3JWJA 1V8OA 2ZBRA 4MQ4A 1X2EA 1L4GA 3TW4A 3U3RA 2NO0A 4DY4A 2P9JA 3QUQA 4S2UA 3FXAA 2OCIA 3REFA 4D0NA 4EVQA 5SY9A 5JECA 4E2WA 1CUXA 3UAGA 3VAAA 1NC3A 2QJRA 1J2EA 3H9QA 4LC9A 3QYJA 1ZOLA 3H2KA 2BFCB 3LUGA 4G0PA 3WWPA 4ER3A 5KREA 3PT5A 4RTSA 3FLAA 2OCYC 2H4JA 1FNSA 1M1YE 2R7NA 1V7ZA 2PPLA 2X2FA 2Y1KA 2BFWA 1U63A 4IR7A 4OP1A 3THXB 1X38A 3HNPA 1KNQA 3QU5A 3L7NA 4JSYA 1AKEA 1CEYA 2PIAA 3VJMA 4OX9B 4QDKA 4YVFA 1PU2A 1IL0A 4LMAA 3I5YA 3EPKA 5HGJA 3MGGA 1VBMA 1I5EA 3NHLA 1P0FA 3JVDA 1NY6A 3L9WA 1KFCB 4G8DA 3TTUA 2NP7A 1Q0SA 2R6FA 5CVEA 3UUEA 5KNCH 4PAWA 1DKMA 4A73A 1KYWA 4V0LA 5LBUA 2PKRA 4IV8A 4EJSA 2ZAOA 2H7VA 5AI5A 1ZD3A 1J90A 2OZPA 4KWTA 2QJWA 4ALMA 3PNBA 4B76A 1T1JA 1WY7A 2VYNA 1W4CA 4Q7EA 3OWXA 1RRCA 2D7JA 4B31A 3GCDA 3MAGA 3K4PA 1SIBE 1D8TA 2RD2A 1U8CB 5JALA 5I9MA 3O8NA 4FIDA 1W5EA 2D74A 1GZ4A 4GWKA 4OYRA 4WLEA 3IQEA 3F6SA 2FLKA 4HPXB 3AVXA 1UFVA 2QAGB 4YAWA 4KLRA 2ZETA 5TPWB 1QIDA 4G81A 1CP3A 2AFIA 1GT91 2DBRA 2HF8A 4OCZA 2O8DA 1KAQA 5ECWA 5CLJA 4OXQA 1IUPA 1ECFA 1EE2A 4M9QA 4X1KA 2ZM6B 5HNKA 1WQ1R 2ZR0A 4WNCA 3AHIA 2QW8A 4O63O 4WJKB 4C0AC 2BCJQ 4AJEA 4EK9A 1YZ3A 2XXJA 3M9XA 4Q19A 2GZRA 2ZYGA 4LKOA 3KDPA 4KQKA 1FRQA 1E69A 3G0GA 4R8VA 5JFOA 5K0FA 4DYHA 2XHEA 1CRQA 4K6GA 4OQLA 3LS2A 5T4FA 4UHCA 2PU5A 3TSYA 5HKOA 1Z0ZA 2WQ7A 3WLNA 1DL5A 1D2HA 4HWPA 5L3RA 2BTQA 1MV5A 1RZUA 4LBVA 2E37A 3WY9A 3D3WA 1GAQA 3KT3A 2IGTA 2ZBVA 1XHLA 3VH3A 1G6HA 4O4HB 1O94A 2C29D 1HDEA 4CM1A 4D98A 3AM3A 2ZRFA 4H59A 3WWEA 1D4FA 2PL9A 3ZZ1A 2AKEA 3NTUA 4A9AA 3KPYA 4EY5A 4FR0A 4TMYA 2YIVX 5M3BA 4M46A 5GVRA 2AZXA 1M5TA 1GTMA 1PR6A 3I6QA 3GFBA 2Q45A 2WT9A 3AZQA 5AD1A 2Y0BA 4HB3A 2PBLA 4J9VA 4W4TA 3PUHA 4RULA 1TM7E 2JCXA 4YCLA 3U9SA 5FD8A 1E9SA 3CY6A 3U19A 1DKRA 2PWBA 2C5HA 1V4BA 5CEFA 5CK5A 1RCTE 4JVMA 1L4KA 2A9RA 2AH5A 2AX3A 2PEYA 2PG3A 3KO8A 3KOZA 4HVAA 1YZUA 2WWGA 3AB7A 4HGZA 5DX1A 4ZVSA 1EK6A 1UXKA 1II8B 2QORA 1G20B 2XUKA 1VOTA 3DWIA 3HH8A 3HMQA 5J1SB 1AHPA 4UCWA 1WP9A 3F74A 4YRZA 4ZQIA 1F8GA 4LJSA 5EJAA 1LDYA 3G9TA 1BQ3A 3ZI4A 4M55A 5IKPA 1U0RA 2HMAA 3PEWA 4L22A 2J85A 5I4KA 4RKRA 2AC4A 3LQ1A 3NBUA 5EJMA 2Y9MB 4YPFA 1KU0A 1HMPA 1ZK1A 4YA6A 4BFTA 1W52X 5DOZA 2OQIA 1OGIA 2YIJA 1TEZA 3N8NA 2EKLA 2PBZA 2MSDB 1TQ6A 1C9DB 2WYHA 2I34A 3I2FA 4ZC8A 2IYZA 1XXHE 3GFPA 2QNRA 3EQ2A 5AJZA 1QFXA 3IDZA 5C2JB 1NVEA 1V8DA 3IS3A 5F23A 3NWJA 3W5AA 1GNRA 3FDJA 1KRXA 4HDOB 1QF9A 4UM8B 4DE5A 2H1FA 1X86B 4G9EA 4HZGA 4PZCA 1XVUA 4ZDIA 5F2NA 3BWXA 1KWKA 1LRKA 1UOOA 2PAFA 1ID1A 1PVOA 1U9ZA 3V1NA 2OFOA 1BDIA 1KFEB 2Y0EA 1HT2E 2A8YA 1E3EA 2ODNA 3D0OA 3NYWA 4QTYA 4A92A 3DE7X 3RFVA 2YOHA 1YSCA 3AIIA 3HA5A 3HB1A 3UA3A 5C35A 1KK0A 4RE6A 3T5DA 1HBJA 1EUCB 4GX0A 2Q0XA 2HREA 2VDLB 3CZCA 3HVKA 2V96A 4TMXA 2AFVA 3W7VA 5COAA 3ANNA 4FS8A 1NOJA 3O8BA 1GUAA 3BIXA 3WAGA 1IIRA 1R8YA 1SKQA 2A5YB 2ZRNA 3DOOA 2CNDA 4IQ8A 2VJMB 2J9RA 4HAXA 3CUYA 4LBZA 4M1WA 3RRBA 2PE5A 2FG5A 3VR4A 4F4JA 2NXNA 5EZ6B 2OOKA 4FYVA 1AJEA 3PI6A 3H9UA 1L5WA 3RO7A 1SCJA 2QSUA 4MQUA 2PT6A 3PGJA 1AQYA 1OGYA 3H9GA 2JGAA 4NDNE 3STYA 2PS9A 4UARA 3P19A 1FMCA 1KMHB 2ONZA 1HYHA 3OPXA 1PS0A 4LHYA 2QT1A 1BX0A 3N70A 4U2EA 4P54A 3S28A 1NQUA 1P31A 3NHBA 3ZVKA 3M3DA 3RQIA 5C0OE 4JT4A 3IVMA 3C6MA 1R0ZA 4WN3A 5IXJA 2F17A 2FCAA 3V80A 2PXHA 3JR3A 3TZQA 1K4MA 3NH6A 5FA8A 5HF8A 1FF9A 4PONA 3ZVLA 3Q8MA 3AHFA 5IUKC 4DCJA 2WJGA 1VRWA 4ESEA 4TS9A 1GTL1 3ZYZA 4ALKA 4N18A 4YCDA 1WQ3A 3LX6A 3Q88A 4HL6A 5DBGA 3OEWA 5TQVA 3W2IA 4ZK2A 1XG5A 4U7JA 1ZL2A 5KWIA 5LLTA 4DLSA 3EVTA 4FTWA 4S04A 2SKDA 4AXXA 1RPNA 2D06A 3OMLA 4M7WA 4AC9A 4EG8A 3BRWD 4POOA 2YL2A 3M4ZA 7REQA 4TL7A 2Q28A 1P62B 1Z34A 3FNIA 4QOIA 1P7YA 1B43A 4BX3A 4ZO7A 1XMPA 5G0WA 1F14A 5HIKA 2X5JO 4DQDA 2BOVA 4P86A 2EBHX 3GLTA 3VQTA 4RLFA 3DYIA 2OBMA 3D2CA 1ID8A 4OMUA 2FOLA 2YINC 1ODIA 4EYKA 4JXZA 2C4UA 2V0GA 2OBBA 1NR7A 2Q7XA 1HDOA 2E85A 3C16C 3DFIA 4M86A 2HQRA 1T2FA 2PCJA 4LNUA 4ZCTA 3U6KA 3RAEC 2XQVA 3CB2A 4HI0E 3AYZB 1ZI9A 5CFMA 1N5KA 4BBAA 4QT4A 4CKEA 3OU2A 4Z4EA 4LHSA 4CKCB 2O1SA 4QZVA 2YQ5A 4RXTA 4B7XA 2IQ5A 1IWBB 5CT4A 1YCGA 2HWXA 1GGMA 4U2CA 1UPBA 5FPYA 3NTXA 2J87A 2EZ8A 4BO3A 4PTYA 1SO8A 1THTA 1HQKA 1QKIA 4JDUA 3U4HA 3U4GA 4C0XA 4DG9A 5A5EA 1XEWX 3UGTA 4J16C 1T5DX 2NO6A 1U7OA 5CHYA 2IZZA 2FWIA 3B6EA 2NQTA 1SULA 2GPYA 1K8XB 3DTVB 5KNDA 3KLPX 2DR2A 4N54A 2NMVA 5EVCA 2C2BA 4GL2A 5E4FA 2XKJE 2FW0A 4QXAA 1CZRA 3JARB 4OXYA 4E22A 3KWMA 3IP5A 1NJFA 3F96A 3H65A 5H7XA 2HJRA 4L9SA 4WOJA 2GLXA 1F1BA 2X0NA 3CLSD 1Q7RA 2F9MA 3FTCA 4X7MA 3WP0A 1BAPA 3VSEA 2AD5A 4P3YA 1X1EA 2FE4A 4DLUA 5JAPA 3NM6B 1YO6A 3AG6A 1FMJA 2XF8A 3ZXUB 2APJA 4H1TA 5JZSA 4OOEA 3AOEA 1H8EA 2OD2A 1SQSA 2ZJ3A 4O2RA 1IB6A 2BSAA 2WUGA 2WNHA 3QVLA 5AK4A 3RVPA 5BSFA 3RC7A 3OX4A 1FUKA 2HM7A 3K94A 3WGYA 3Q8WA 1SVOA 4WBNA 1MRZA 3O3NB 1JLMA 3FKSD 4MW0A 4RHFA 3EPPA 3SQLA 1IBLB 1QM5A 3REQB 2JLYA 1XJWA 4ZEWA 1THZA 1CIPA 2Q2NA 4M8NE 5BY2A 4EB8A 1RM5A 3EZGA 5BSVA 5KCZA 1CWUA 1FSFA 3VKWA 3F6EX 3V9PA 1HETA 4PW0A 1ENPA 5ALOA 3NS7A 4EG4A 1QHHA 4NF2A 2QV7A 4L8WB 4F8EA 3VVCA 2NV6A 5FBRB 5HRUA 1FJGB 1I1QB 1POWA 3JD2A 2YHIB 4X62B 1B6RA 2LKDA 1FX0B 2JZCA 4RCYA 1C7ZA 4BO0A 3T1TA 1IZYA 3KV3O 4HBGA 2YHIA 1HDYA 4MI1A 4KDCA 4BNXA 3DE3X 2QJOA 1R5BA 3GUVA 2JB9A 4NCJA 3WIOA 2ECFA 3ETLA 1BD4A 3GCZA 4CF6A 1XFDA 5JZBA 5EZYB 1SVMA 3I1YA 3E4DA 2G83A 4PIMA 5HSGA 1MIOB 2EERA 1E66A 3NO4A 1YRAA 4BWGA 5JCZA 4C05A 3F7NA 2QIOA 3TKYA 4BB5A 4MNTA 3IBTA 2P9FA 1E9VA 1T9KA 1RU3A 1ULBA 2ZE7A 4ESVA 4EGCB 5D84A 4NH0A 2Q2VA 2VQFB 1RQNA 4KIJA 2ABWA 4MMYB 4ZV7A 1ZM7A 1TF5A 2WP0A 4FEGA 4UCXA 1CEEA 1MKYA 3C5VA 2XWSA 4ISBA 4BLRA 3QEMB 4LRXA 1J2TA 2BGTA 1UF9A 1BKYA 1QCZA 3ANLA 3O03A 1DO8A 1DE0A 3RSHA 4IP0A 1XXHB 4ZZ3A 4P0TA 3H4TA 2FLVA 3BKXA 5LQAA 2P65A 5HP4A 5DF1A 3FTDA 2QT0A 3IT3A 4RJJA 5EHIA 4ARZB 4G2NA 3PZRA 4FKZA 2WWYA 1T5TA 1MOQA 2CB0A 2HN9A 2NNLD 1Q1NA 3R0IA 2PM8A 4C5AA 4GAEA 4UVDA 2GVDC 1RQXA 3P45A 2V9PA 2NZ8A 2VSOA 3F9CA 3PXXA 5B1HA 3RYTC 2VAPA 3EPHA 1W85B 2FFAA 2AXEA 1KK2A 1YJBA 2JS7A 2V6GA 1FS5A 3FVTA 2PY6A 4G0QA 5JDIC 4RKWA 1EPUA 3IDAA 1OOEA 2LZ0A 3A1SA 1L3BA 3IAEA 4NP6A 3OPYA 5DWDA 3UJPA 4DTIA 1TUGA 4S2EA 4G5RA 4YJGA 3DCIA 4QQNA 1JSRA 1XF1A 3MJVA 1VPLA 2OSBA 5PNTA 2E4XA 3SR4A 4H3KB 4QJ5A 3L8YA 3O2JA 5BMOA 5AOVA 3RUIA 5KYYB 1KC3A 3ZY6A 3Q7SA 3PC2A 4UM9D 2VHVA 2O5EA 1CJTC 1P39A 2PZLA 1E9DA 2WHRA 2XQJA 2R8YA 4I5DA 4TTJA 4PYKA 3C7TA 3W5VA 5BNTA 2X8WA 4RVHA 3AP1A 5BV1A 5LUBA 3A1FA 1DRVA 1SAYA 2W2LA 3VSCA 1Y8RB 2QZPA 5H3HA 1SA0B 1XCMA 2V3CC 5EKXA 1Y80A 5ICMA 1U1EA 1KF0A 3BGSA 3LCVB 4HUJA 3ZN2A 5LQMA 1DARA 3CGWA 5BYBA 2V6JA 5U1PA 2AQHA 1DTEA 1CUDA 1CUBA 4ND8A 1Z82A 1JHAA 1WTCA 4N7RA 1UT6A 4BYGA 1XPUA 2DH5A 4DIFA 4YCNA 4K6HA 1OV4A 3PJEA 1U6JA 3ZGVA 3TZCA 1Z6AA 5LOVB 1MHPA 1WMFA 1TQ2A 3C7AA 4QXPA 4WNAB 1IHPA 2EG5A 3MNFA 4IVPA 3F6CA 5GWXA 2ORIA 3ZDQA 2W0SA 2YWXA 5B55A 5CDTA 5K0TA 4OFZA 2NO7A 5E4JA 1T4DA 3LSYA 1KXJA 2CFOA 1CV2A 1RLJA 2GZ2A 3V33A 3HLYA 3YASA 1XD2B 5FIUA 1L6IA 3NP9A 3EZ9A 4JNCA 4X9XA 1FFWA 2R9VA 3TDKA 4B2PA 1F51E 1AQNA 2HRRA 1YE5A 4F3YA 1I3NA 5CXXA 1UZNA 1UDCA 5A4MS 3L0YA 1MN6A 4XGNA 2QRVB 3GP3A 4I6EA 5CB6A 1TQHA 2GEJA 3H9JA 1CJKC 4KSYA 4LZLA 4TMWA 3QF7A 3RTEA 3EF3A 5L9AA 1WRBA 5CM2Z 5B7QA 4IHAA 2WSBA 2HK9A 2V3VA 3DBLA 2F6RA 2JFFA 2PQMA 1OFUA 4JGBA 3WYAA 1GOTA 2OXRA 3UT0A 3CZAA 3HFGA 1H05A 1IZ9A 3LXXA 3DBIA 2G71A 1NYQA 3FE2A 3WOVA 4Y6SA 1RWPA 1W5SA 3ZDRA 1IOVA 1X1SA 1JAIA 3Q98A 5LM3A 4LCJA 3FCOA 2QX8A 2JRCA 4RZUA 3G8DA 3W2FA 4DLKA 4DRYA 2GUGA 2IYPA 2W48A 3QEOA 4UDXX 2PSEA 5F77A 2B4KA 1OKKD 1OTHA 5ELMA 4BWVA 1NZFA 3II6X 4Y6LA 3WK9A 1VSBA 4ZK6A 5LYJF 5COBA 1B8NA 1X8KA 3BA6A 5EXSA 1S0UA 1LSOA 2VSYA 1JFRA 5AM0A 2IS1A 2IJGX 3GA0A 3ETCA 1BVUA 3K9NA 2D8AA 3TNLA 4NOJA 4EMBA 4FLEA 3QHPA 4OMCA 3CEPB 1BQ4A 1N1DA 2B8JA 3M49A 4AUEA 2I55A 3V97A 3DPSA 5C1IA 2GCIA 2RK3A 2ODBA 3LUBA 3FH0A 3IQZA 2QYHA 1SQ6A 4GNKA 4Q9JA 5IBPA 4FQ7A 4M88A 4QTZA 4XA8A 2PMEA 1CTQA 1WMSA 4AG5A 2OBYA 1RWOA 2AMYA 3IPAA 2PMCA 4ZCPA 2UU9B 5IJAA 2FQYA 5FLEX 2D1QA 2J09A 2ZUUA 4MMXB 4DLAA 1RHQA 4MULA 3D3QA 2RBKA 3TQFA 4TV8B 3WK4A 1HKHA 5KYXA 2FW6A 3EYWA 4DLBA 1P0QA 5B36A 2RHJA 1SVUA 1TQ4A 3WTBA 1EVYA 4KQJA 3DMGA 1XCLA 2OXIA 1LPNA 5L7TA 2ZBFA 1P61B 2Y1LA 5JDCC 5EG5A 3LC2O 1UBNA 2JF0A 1M34B 1R6UA 1RC1A 3EW9A 2B6NA 5IJ9A 2IIVA 1NOIA 3NI2A 3Q5EA 4K0KB 1TM2A 3KQOA 5H82A 5JRDS 3DZHA 3NCHA 4HEQA 4E30A 3OT5A 5C18A 4FFRA 1VE5A 2BCEA 5F2OA 1GZ6A 1O6BA 1T1RA 1WCIA 2CXTA 5A4FS 5JZVA 5IYZF 1HMYA 2BONA 3FYSA 4KN9S 1U6KA 1QGED 3WFZA 1BCRA 1S1MA 5JYEA 1XSEA 3MCZA 1D9XA 3I61A 1IN1A 4RKQA 1NQ5A 2QTVA 2WHYA 3AB3A 4BZWA 1P0MA 3CF0A 2I78A 4OGGA 4D9KA 3I73A 2GN6A 2ZJ0A 4FDTA 2IX9A 2Z5VA 5JNLA 1ZH4A 4C14A 5LQSA 4R7ZA 1AUVA 1DXQA 4AQ7A 3VDMA 3ZIUA 4XGIA 3HHEA 3HLTA 4LY9A 3L01A 5E1OA 1QBKC 3KX2A 4DV5B 4B2LA 4H4EA 1AVTA 4DC0A 2RGNA 4YTEA 2HK8A 2KJQA 3RE1A 5IT0A 3O1HB 2YVKA 3IP8A 4EUKA 2Z8YA 2QLFA 2WTEA 3A4YA 3K1TA 1BJKA 2F90A 1QGZA 3ONVA 4WKBA 4DMCA 5IMSA 1QVRA 3GFRA 3A70A 1ECLA 2A5GA 4J75A 2XE7A 2G7MC 1J5XA 4N3AA 3JQAB 3DZIA 4RZQA 4ZPJA 5E95A 4CQMD 4EFDA 4YDSA 1PGNA 1W87A 3WGJA 1EQ2A 4U6SA 5H9WA 3KR2A 4J6EA 4IV0A 5DYTA 3SG0A 2A9QA 1DGQA 3BMXA 2P2SA 2V98A 2ATVA 4IDCA 4EY7A 3C3EA 4BO6A 4CLEA 4B3CA 4GMGA 1K2VN 4URXR 2H4XA 1V1MA 5CYPA 3UATA 1FFBA 2SKCA 3VNAA 4CF4A 2M1ZA 4D9IA 3S27A 1UDAA 2AW5A 1Z5NA 1JG1A 3ECSA 4PXAA 4D4MA 1HNZB 5EMHA 5FOUA 4C0HA 4HYTA 4UNQA 2VDJA 2GZHA 1XF9A 2O7VA 2BYTA 4ILEA 2I65A 3CN9A 5TE9A 5LFAA 1VE1A 4E7PA 3RVQA 1SVNA 4TN1A 2JCYA 3FOWA 1NQVA 4TXNA 1T2DA 1ZNQO 3IHKA 4H7KA 2RBGA 4B3XA 3NANA 1D2CA 2E4UA 2QN7A 3AV3A 3PLNA 3RIXA 3D43A 3T1OA 3QSYA 1DQPA 2CWDA 4UEKA 2I62A 1ISMA 3LT4A 3OWOA 4XFJA 5E4YA 4D99A 4NEHB 4DCNA 4JGIA 5CG1A 1IK4A 4J90A 1MJGA 4JLKA 4JLJA 4RTRA 1Z75A 3BAZA 1IXRC 1HSZA 1NBEA 4KKVA 2GA8A 1Z4KA 2V65A 3OFSA 1G8FA 2O7NA 2RCYA 4JJZA 1C1YA 1W46A 4BLVA 2G82A 1XRNA 4IKPA 1TO1E 3NRBA 4RMJA 1ZNWA 1ZWLA 1QV9A 1QVVA 2O6HA 2XJ9A 3U1VA 2A7XA 1ZM9A 1OAKA 1YOVA 1DHRA 3TGLA 3C8UA 4NNJA 1Y6GA 2Y68A 4ON9A 1QRUA 1ISSA 1RAEA 3VI4B 2HWUA 3LZ6A 3MMXA 4EAQA 1KBQA 1V96A 1ZH8A 3EMDA 2HSEA 1VIAA 3OE5A 2YFQA 4DV4B 5FTMA 3C3JA 4LUCA 3S99A 4H3SA 1QYIA 2X3YA 3HYTA 3HO8A 4LJ4A 2FVXA 3UUWA 4YUWA 5BN3A 5DEOA 2KSQA 1A4RA 1JMYA 3KFLA 3QA3E 4Q1DA 5K8CA 4FE3A 2IXTA 2JFYA 2W22A 2IHJA 4JAVC 1WG8A 1XV5A 2WP8J 2X58A 3E3OA 4QE3A 4K9RA 4F1KA 2B2NA 3MTIA 5DM4A 2ZYDA 3UK1A 3UFXB 4TM7A 3QYFA 2HTEA 4EOGA 3CEMA 2ET6A 4QVKA 1WU7A 4BFCA 5BMVF 2R6ZA 4GPZA 2JFWA 3H17A 4JVOA 3CVOA 4ZAYA 3L2OB 2C2OA 3H5VA 1RACA 2V9ZA 1L7OA 1Y48E 3OCZA 2RGRA 5K03A 4YS6A 2XCUA 5U4QA 1JT9A 4B34A 5AHKA 3L7BA 2AN9A 1HDCA 1RXWA 1ESCA 1M6HA 1NI4B 1RXIA 4IDPA 4N8EA 3R7AA 2B92A 2KHZA 3TOSA 1PIWA 2CXQA 1PGOA 2LPMA 3BE4A 3EDOA 3AW8A 3QWBA 4HQKA 1RJFA 2ZT8A 5EP3A 2X6QA 3FROA 4QTTB 2O20A 4RSRA 2L2QA 2GRUA 4BFSA 2HMTA 3OT4A 3KYJB 2AEMA 2YRFA 5EIAA 3RNOA 4NFHA 5CCDA 1IYZA 3IC5A 3UXEA 1Z2NX 1Z6ZA 5AWFC 3B3AA 4QPDA 3UF0A 1ISRA 4CDGA 1I80A 4BQRA 4C29A 4JV5B 3WWDA 3AI7A 5DI3B 1QHGA 4LCEA 3I9FA 4J9UE 1MC8A 2I4NA 1CY7A 2FFHA 1ELOA 1JKFA 1IFXA 1DEXA 1RWKA 1WXHA 4K6KA 3UOAB 1A5BB 4M8IA 3VYTB 3NAQA 3FHLA 2HEGA 1RIIA 3BXGA 4Q7JB 4I5IA 4KXXA 3SXPA 4Q4JB 1KAHA 3GEIA 1H1TA 5T57A 5AW0A 3UYLA 2JG3A 1OTXA 3LHFA 5KVVA 2AEFA 4ZVQA 2ZI9A 4KSBA 4B85A 5BRJA 3TLBA 3AHDA 5HM8A 3Q7TA 3GLFB 3CTPA 4JY7A 3BK2A 1YE3A 4CL8A 2PA3A 4L95C 3CNQS 4X1KB 4LPSA 1NQOA 1E9CA 1S7GA 1LPOA 2CDNA 3BXXA 4NG4A 5DX8A 4N4AA 5EWLB 3N2KB 4D0LB 3U81A 4KUGA 4EECA 4FC7A 4IIDA 4X8OA 3VU0A 3BF7A 2ECOA 4DA8A 1B2RA 4I3HA 4OATA 1UINA 3EY4A 3QVGB 4JBIA 4ZQGA 1IBMB 3I28A 2M9MA 3IOMA 2NTJA 3ORYA 2IUYA 2O23A 1U1IA 4OA5A 4V24A 1U9IC 1N5IA 3IH5A 4B4UA 2R6JA 1E4YA 4DSNA 3OQOA 1PR3A 1TT5A 1QR6A 2HIGA 1ENYA 4YNBA 4Z9BA 1O54A 2NGRA 2Q29A 2XA1A 1I9GA 3DE6X 5B1EA 3LSTA 3O6VA 2NXJA 2X9LA 4HWSA 3V9AA 4QEZA 4M49A 4ER6A 4WLUA 2H16A 4RXMA 4YP1A 3S1SA 3HCPA 1QGUB 2WG1A 3DQQA 4PO8A 5BWBA 5T4EA 3H2JA 4A23A 5JVDF 4KQXA 4UC0A 4JLPA 3EAQA 1MH1A 1DEAA 3L6EA 4I1SA 2CFSA 1DXHA 1VCMA 1Z25A 1HYQA 3I9V6 1C8VB 3PUXA 4HUQB 2UZ4A 1E4OA 1T6BY 4PSUA 4R6WA 1ISGA 3GEBA 5BT9A 3B38A 4W9NA 3VNQA 3ROGA 1N0WA 5LQKA 2K6GA 1BZYA 4WXMA 1LW6E 3R6WA 4JA2A 2PQ6A 1YXMA 4J2TA 3WGIA 3KYIB 1L8LA 2WB4A 4HYQA 1N6HA 3GZ4A 2I33A 4BMCA 2REQA 5CNMA 1PDOA 2P69A 3WFIA 4L5IA 4TV8A 2V1XA 4GGMX 4UBJA 1AQUA 1H5NA 1IAVA 2L19A 3T9DA 3NEJA 2Q21A 4IIGA 4R2WA 2RHTA 4Q9DA 16PKA 2D62A 4G4SO 4K0RA 1LSJA 4D6YA 1H2XA 4UAGA 1PV1A 4MK4A 2I4OA 5T6MA 2A33A 2BBSA 3TTSA 2J67A 3MMZA 3N1UA 1XD8A 3BDVA 3ETHA 3BKWA 3ZCTA 1J42A 3VH1A 3ZWNA 1JG3A 5ECDA 1ULHA 1ZHHA 4EHBA 2DFPA 5F5XA 3T5MA 1U1CA 1RSZA 3BL8A 3MG9A 3PE3A 3H5AA 1W4LA 1VZ2A 5MFPA 4EHDA 2PBRA 1AUQA 2YS7A 3KL4A 1EX9A 5BSTA 3KHSA 4R16A 1JH8A 3ABRB 1BA2A 1W93A 1FFXB 5LMNB 1F2UA 3B89A 3K1AA 4DGQA 1QJ4A 3L93A 5CGZA 3DVLA 4L5BA 3ZH9B 3KUUA 5I3CA 1A8UA 2BFOA 3ESDA 3H2GA 3K09A 3QPAA 3KQTA 1EG2A 1U0BB 4JI1B 1A82A 5IAGA 4E2XA 3NXKA 3QMPA 4LHEA 1DPGA 2HF9A 1DPFA 1NVBA 4ZQBA 2IYQA 4QLOA 3TAHA 3F6RA 3AUTA 1UMBA 2FEOA 4MP3A 1NU8A 3IAUA 1Q0LA 2BP7B 4HDRB 3RVLA 1U2PA 3EG9A 5G1NA 5IJ0A 1HEYA 2DG2A 2BKLA 3BF8A 1F60A 2FEKA 3FGOA 2YWCA 3R7FA 4EFKA 5CB4B 1DO2A 1EHYA 1P4GA 1XEXA 3AUSA 1ACJA 2IKSA 5B7GA 3IBFA 5C32A 2QN3A 4XB2A 1JMKC 3RYIB 1NUSA 1YGYA 2ZIGA 4QULA 5TB5A 2W5UA 2EFCB 1VYVA 2NU7A 1L3IA 3DT6A 4BLTA 3D6TB 1CNEA 1CDOA 1K75A 4R9RA 3KJQA 2P68A 2QDXA 1GPH1 4FYPA 1GRVA 1Y3FE 3U48A 3LY8A 2GHTA 4HCJA 5DN6D 2ZR8A 1B2LA 1JJAA 2BV3A 1R0SA 1XZKA 2NUPA 4YGXB 4MQMA 4L5JA 1HTBA 4QOJA 2WSSA 1GZ5A 4IDFA 1Y3IA 2BEKA 4A0QA 5KIAA 2Q6KA 2WHQA 4YONB 2IVFA 1ZY2A 2ADFA 2C9DA 4NBWA 4QKQA 3ROXA 1DXOA 2JD0A 3MILA 4H31A 3ILXA 3OQ6A 5EIBC 1YVPA 4A2QA 1CDEA 1SHLA 3IEPA 4S24A 4EJ2A 4DJDC 5JSUA 1L2TA 3GFVA 3WIEA 1ZH6A 2ZROA 5A3SA 3THWA 4C0WA 1G9TA 1NPDA 1AB5A 2X8JB 4RBNA 1ZM3A 4CN9A 4KPEC 3GMTA 2G07A 1S8NA 3AVVA 1TLLA 3HCBA 4QUGA 4AZ3A 5JTUA 3JQ9C 4ZTUB 2VBGA 2IVZA 3FPGA 5B3JC 5L7YA 2P0YA 3DCNA 3MOSA 4ATNA 2QXTA 3GLIA 2RMKA 5TR9A 2VYVD 3GXBA 3HCFA 4JB8A 3GFGA 5AKIA 4BMPB 4R71A 1TVKA 1Q6ZA 3E9RA 1L8QA 2NXCA 3JY6A 4JKIA 1SBZA 1YVRA 1ZLXA 1XA3A 5G2OA 3V42A 3PTLA 1C9MA 2W43A 2P6NA 1G19A 3OLXA 1E5QA 1MAWA 2QVLA 1BRMA 3DL2A 1MUUA 1OVMA 2QR3A 1A8SA 2WINI 3MIIA 5A3JA 3GAFA 3R7WA 2WJVA 1QIJA 2Q9CA 3PJFA 2OWDA 5EUMA 5LYJB 1V11B 2A7QA 5AHXA 1JWLA 1VHQA 4WE3A 4BX9A 4TLLB 2VAVA 4DCGA 3BSWA 2HGZA 2AIRA 2YV5A 3HRIA 4P4UA 4X95A 1IONA 1S3IA 4DIMA 4QGSA 5B7PA 2P2CA 2H2GA 3SF8A 3A3KA 2J45A 5IBRA 3W1EA 4CPDA 2DE0X 1YT5A 2IOHA 2O59A 1AGYA 3PYLA 3PFIA 1ZITA 5TVKA 2JVKA 4U7DA 1I24A 2ERYA 3PFKA 4C20A 1TL7C 5K6AC 4CV3A 3NPMA 3C1AA 3AF2A 4UZEA 2ZWAA 2P75A 1Z4IA 1GAJA 2P27A 3EXEA 4F5WA 4WGGA 2OLJA 3ABQB 2B7CA 3NC0C 4BTEA 2NP6A 3EB9A 4H7EA 4FN5A 1YOVB 3L8CA 4Q7KA 4GI1A 4J7UA 2OFWA 2PZ8A 5DZSA 3MM4A 3UPTA 4JLBA 4ZO4A 4BNJA 4US1R 1JIVA 1FJHA 1YA8A 1NIPA 4FFNA 1QMGA 1O03A 1VRCA 1XKQA 3REOA 3RF7A 4CDNA 4YAIA 5LN1A 2BEJA 2K7ZA 4HGPA 1X6VA 2HHLA 2I4IA 4OHZA 1AH2A 3T7DA 3CWQA 1ST3A 1EA7A 4GZ3A 5HQJA 4F3TA 4HEA1 2V6FA 2VF7A 2QRHA 2ZBDA 4FJ0A 4IIUA 2W7TA 2CUKA 4YRBA 1ECGA 2EHJA 3FX2A 3MT8A 2ZWMA 3E9QA 4EW3A 3JATB 3Q3IA 4MJLA 2WJAA 5TQ2A 4JA0A 4N49A 5F21A 2UV8A 3THSA 4EI8A 4U7HA 3ZKWB 1UBTS 4JC0A 1KKLA 3UMYA 3EG5A 3ZD9A 1FTSA 1KYIA 4Q24A 4XM1A 5AJYA 2P6MA 4EABA 2WV7A 2VHYA 1H2AS 2J0QA 4KFSA 3FWYA 3T3DA 4BB9A 4F9FA 3FFTA 2EX4A 1F06A 1GCAA 3GJYA 4ESOA 1BVRA 5JNVA 4KBGA 2F9LA 2QVYX 4XW2A 3GLFE 2PX0A 4NMLA 2RI6A 4Q9LA 4A5OA 4HO1X 4U0KA 1QGAA 4WACA 3C1TA 4D5EA 1P2FA 1KY4A 2CXOA 1ZK2A 1L5RA 1ORVA 4P36A 4RY8A 4ER5A 5IDWA 1LV7A 2VTKA 3F8TA 3M33A 1W9HA 5LKRA 2NU8B 1XC7A 4RF5A 1SURA 2BM0A 4IVQA 3PRHA 4YP0A 5ERGB 4AZTA 1EYZA 2PUEA 2FJ0A 3AM4A 1FY2A 3UVEA 1P77A 4IH9A 4IRXA 1MX5A 3V4PB 1FX1A 3A11A 1XJ0A 4L73A 1O97D 1DJQA 1ZD9A 4UNRA 2IELA 3TRDA 2Z57A 2ILTA 4ZYXA 4DDKA 2P3SA 3DZ8A 4MEJA 4NEQA 3Q85A 2JFOA 3OSZA 4OI2A 5C7YA 4CTJA 4LC1A 1XD2A 5LXTA 2BKEA 1P8AA 3L84A 3NXSA 2B25A 1FXSA 1GRCA 3A4NA 3BGOS 4ZCSA 3O0DA 1U3FA 2IWHA 5A5FA 4C4TA 2XKKA 2XXAB 4GPAA 5F1PA 2VFAA 3P9NA 4YRRA 4DSZA 3FJYA 2CNLA 3EXAA 3UCFA 3AERB 3PHBE 1GP2A 1TQDA 3BH7A 4JD5A 4V0KA 3SJAA 3CEHA 5EZQA 4I0WB 2BCGY 5DRTA 1EVIA 1UBCA 1MO3A 1UWCA 2EYUA 2GKSA 3CLTD 3R0ZA 3DKPA 3EF0A 3C6QA 3FVWA 4JBHA 2PTHA 1EUZA 4EG6A 3U17A 3G7NA 1BKDR 2PX2A 2WG2A 4JBXA 2X0JA 2FN3A 4OIMA 2QBYA 2G9QA 4KUHA 3SSAA 1VCIA 1QZZA 2PLAA 1ZW6A 3GT7A 2QMYA 4AJ2A 4YRIA 4KMOA 3ET4A 3NZEA 4P34A 1KVRA 3OM8A 1P1IA 2OC9A 1X7ZA 3HKCA 2AFHB 4V02A 1GTZA 1Z38A 2DHDA 3FETA 2JFNA 1O9GA 4QPCA 3KYBA 3TOXA 2OO7A 2QWXA 3M5DA 3HKCB 4KG7A 1HG1A 2OPBA 4Z9AA 4Z0TA 1N4AA 1LZKA 2GJ4A 1YZYA 1QC5B 3E22B 4L4YA 1XQWA 1P2TA 4RV5A 4QEDA 4CG3A 3H18A 1J0XO 4RDIA 1SOVA 3O2NA 4TV9B 3V1TC 3DOJA 4BATA 4P80A 2D5AA 4XWWA 3KJGA 3IEVA 4CFZA 4B75A 2ETVA 2PUCA 4L7VA 2C4NA 5JG7A 3W8NA 2JHGA 1I4OA 4OYYA 4M8LA 1NF2A 3BRWA 5ESDA 5KEIA 2ZSIA 3JQBA 1H2YA 1JRLA 2BFPA 1JXMA 1QDUA 2P11A 4WZBE 5FJJA 2ICAA 5CLGA 5HJ7A 2H1IA 3GT3A 2DQ4A 1P7PA 4FOPA 4JP3A 4KH0A 3AINA 3VOAA 4CIXA 1W35A 3KQUA 1OFIA 4CM9A 1D03A 3GRZA 1BMTA 1NVAA 2Z43A 3A9SA 3TTXA 1WW2A 3MRVA 2VHQA 4ARIA 4YMGA 4PO9A 1C2TA 5C7IO 3LX8A 1JNXX 1CP2A 5I7AA 2XMBA 4W7IA 1QPZA 3GROA 4G0VA 4R51A 4PLYA 2R2AA 4MQFA 1M83A 3QP9A 1CE8A 3R7BA 4KQMA 2RC6A 1WDTA 4GP9A 1J7KA 3PQ8A 3SX4A 1UPCA 1ZGAA 3T61A 2G6TA 1PWEA 2D5IA 1OY1A 4O4IB 5CDSA 4FCVA 4X85A 1I2ZA 3T7KA 1OVGA 3GJ3A 2X1MA 4JEMA 2HKIA 1DIAA 4GI5A 5AUNB 4MUIA 3EFOB 1MAAA 3OIFA 1MGPA 2PKQP 1Z8HA 4MZXA 4XVHA 1IM2A 2FPOA 2ID8A 3DM5A 3QWFA 1PBNA 2YZGA 1SK8A 3TO5A 1W4RA 4RJTA 2LWIA 4O5OA 5JSHA 4L74A 2QRQA 1MO5A 1IMJA 2QU8A 1BGWA 4I55A 1BU8A 1A2QA 1PK7A 4KRYA 1KYQA 3KOMA 1OA0A 3FZQA 5TRTA 4URUR 2YH2A 1JHRA 3BMCA 1R37A 3RFTA 1VSVA 1M1XB 4YJDA 1J2UA 3WRXC 2WWVD 3ZDYB 3LO5A 1T3LA 3L1JA 3OFND 4XYLA 1R6DA 4BNVA 1D04A 4Q3AA 1T2NA 4FR2A 3OESA 3JASA 1LPAB 4JUAA 3OJCA 5EYPA 4GSKA 4E5SA 4TYMA 1QHSA 3PWSA 1JBQA 1HZJA 2Q1WA 2EEZA 4MR8B 1XNGA 3C70A 3I4CA 4A0HA 1RYFA 3AZPA 4RPJA 1ZH0A 1ND6A 5B64A 3HB0A 2ZFUA 2QQ5A 4GMFA 4IDEA 4OKSA 4TKLA 2NUTA 1FDUA 3S1LA 1IHXA 3FOCA 1SG0A 1J70A 2FW1A 5BR1A 5IF3A 3GUCA 5HUQA 1IHUA 4FCCA 3IIJA 1PF7E 1TIPA 3CZQA 3VAZA 1WUKS 1JZQA 4L57A 1TX4B 4ZGGA 3DUFB 1KFKB 2ZW9A 4A27A 3E1KA 3GUUA 4UU1A 3IPYA 1W49A 4LWOA 4UEQA 1KBZA 3AB8A 1DG3A 4BRSA 8ABPA 3M9LA 2GFHA 2ZGVA 5B1DA 3FVRA 3I76A 2MINA 3PWZA 3O90A 4NJEA 3ND7A 4DM4A 5KQLA 1TVEA 2HRCA 4RFLA 1J7JA 1SD2A 1G3RA 2F8LA 2FSVC 3EGVA 3PENA 1FZQA 4PO1A 3Q7RA 2OEPA 1UJ2A 1XL1A 2BKAA 3PDIB 4XR4A 2FN7A 5EZSA 4EYQA 4P7JA 4P2GA 3HGMA 1L7AA 2G06A 4TKUA 1T9BA 2HHJA 1PLKA 2R48A 3DSRA 3RHFA 3NUZA 1KGSA 3G9UA 1SBQA 1GFWA 2DRIA 3K6JA 4GE3A 4NENB 5EUBA 3W4IA 1G8YA 4FJ2A 1AGXA 4CIAA 3A37A 1KMIY 2XJ4A 4PQFA 1P1JA 4XWKA 1XTKA 2GRAA 4J4HA 3HDTA 4KBYA 4FGZA 2D1TA 4HATA 1ONPA 3AJRA 2H3HA 4DRXB 5KCMA 5DXAA 3S44A 1GRRA 4NL4H 2Q6TA 3VTKA 2RGCA 4HC4A 2E49A 2QP9X 3KAKA 3VU9A 3C4VA 1UC8A 3MXOA 3MFQA 1OAAA 4UUPA 3WYGA 2VLBA 4MVJG 2NO1A 2A9PA 3GPCA 1DMRA 1UKCA 4HNQA 1ADBA 3QGMA 4OY3A 4S1WA 2ORVA 1EXWA 3OJFA 3U56A 2G7ZA 4ZRNA 1JV2B 1XX6A 4OB8A 3TPZA 3RUPA 4MGYR 5EJEA 2Y92A 3EEBA 2R1VB 1M74A 4DXDA 2XRFA 4JVNA 4BFUA 4A2PA 2GZSA 4L3WA 2GCEA 3A3YA 4PG6A 1EXNA 1KZ6A 2AOXA 5JVDA 5JVDB 5A6SB 3BGIA 2VP5A 3I72A 1MJNA 1NLYA 1S9DA 4KACA 3IOYA 5LP6C 3D5EA 1MD9A 1M0WA 1ZRHA 1NXWA 3H1AA 4L0CA 3AMVA 4P08A 4GPIB 4OJTA 1XHFA 1E0DA 3QI2A 3WSWA 2XMCA 2G0AA 1LJUA 1M1NA 4RVSA 3L1VA 1HXHA 3GJ5A 3ZV3A 4NOKA 1BFUA 3SFZA 1NUHA 2E4ZA 1A76A 4P1ZA 4U9UA 4E0BA 1LDEA 2VA9A 2WW8A 2XTNA 3DNMA 1FEZA 4DEYA 4A36A 4PHHA 3D0QA 2HJWA 3CLUD 4XR9A 2FPLA 2WKPA 1GSHA 3RKSA 5CEEA 3EA4A 2HHCA 2IIPA 2ORED 1QO0A 3FLMA 1QSGA 5JAQA 4KITB 5AW2A 1AHIA 2V5VA 2DTEA 4HGRA 1YL5A 4GE0A 4P4LA 4ZO6A 5IAJA 3ZXYA 3F71A 4RYLA 4BGEA 3WJ1A 4ENQA 1I2AA 2BW0A 4CUZA 1D1TA 1VC2A 3NIBA 4NU5A 1FP6A 2GCNA 3Q40A 3KELA 2WUVA 3OKFA 1UWKA 3X43A 1XZGA 5DGXA 3IV6A 4DBZA 4ODIA 1CUWA 2EYQA 2ZSUA 4LZWA 2Q7OE 3C85A 1Y5MA 3U7QA 2H31A 6REQA 3ZJYA 2BMDA 3N86A 3WGUA 4LC0A 3CUEF 4W1SA 4KQFA 4TRJA 4MVJE 3SVTA 4PLTA 3MBIA 2GEDA 2I9KA 3MUOA 1CY4A 2O4UX 1G7CA 2BF4A 4YRTA 1YDHA 1CJCA 2JLUA 3O8LA 2R8ZA 3A06A 2WPDA 2XYPA 1U3UA 4RSMA 2VTEA 4CETA 5GVSA 4O8ZA 2C77A 4EUNA 2OL4A 1J2JA 1NLUA 2FPIA 3O9VA 2XMZA 3QRWA 1J97A 1AA6A 1EP1B 5ESXA 5I8WA 3QJGA 4MHOA 4PZLA 1H3FA 1DINA 1A88A 5P8WA 5LUAA 2XUZA 4BKQA 1W1IA 1QRRA 4Z7JA 3DW3X 4UBMA 4QLAA 5JR3A 1PGPA 5C81A 1QE3A 2OWEA 3GGDA 4G36A 4HWOA 2AN5A 3RKUA 5K4AA 3SQMA 4GOXA 4EEZA 1K89A 1ODLA 1FSZA 2XEDA 1XALA 2X40A 5JNRA 3PI7A 1DLIA 2J3KA 4WT7A 5CITA 3FHJA 2YKGA 1YJXA 4DBLC 2PGXA 1UOEA 4Y9UA 3U31A 1KVUA 5TF4A 4OI1A 4PPQA 5T8KA 3KBBA 4GX1A 5DTIA 1ODCA 1J5EB 1YJ5A 3IMCA 4R1PA 4DREA 1Q22A 5K51A 3NDJA 4I5FA 3C3MA 4OGKA 2HXGA 5IKEA 2MSEB 5KUTA 2LP4Y 1BEEA 1VMDA 2PGIA 1YRYE 4HR7A 1XZPA 3LHSA 3GOHA 1DDOA 3W8DA 1Q16A 2A5JA 2R8XA 4GM0A 2DYKA 4NNPA 4P31A 1OA1A 1SUDA 3E23A 1G98A 3K2QA 4KAXA 4RIFA 5EWJA 1FIUA 1KYXA 4M89A 1I5RA 3PQ3A 5ARBA 10MHA 3DD1A 2FWAA 3KUXA 5BSGA 5KU7A 5SZKB 4NHOA 4D8VA 2IT1A 4UU0A 3V4RA 4YRLA 5HQ3A 1QO0D 1PDWA 1N6LA 1PYOA 3ERCA 5A03A 3LH5A 4RA6B 3FUUA 1HOXA 1NXXA 2VATA 1NW7A 3E0XA 4NMMA 3MBKA 3JAKB 1BN6A 3N2ZB 5HYVA 4L9AA 2FETA 4UAUA 3P0IA 2QGZA 6YASA 4KX3A 2WNSA 1XTIA 4QUIA 4EG0A 2DPYA 5DGHA 3DLTA 3HJBA 3ZGNA 1QLWA 2Q8QA 4MR8A 3OLZA 4W7SA 2BBWA 2P8JA 1QG4A 3BWBA 1PD0A 4H7PA 5ERXA 3WK6A 3AHEA 5ALUA 3A1NA 1Y5RA 3TSOA 3CH4B 5KSZA 1JA1A 2BGMA 2REXB 3KTOA 5BYAA 2C59A 2HO4A 2VRCD 1P5ZB 3D7LA 1PCXA 1PDVA 3N2YA 3Q2IA 1GEEA 3DT8A 3IT0A 1E96A 4MKRA 4IY1A 5AM1A 2JCVA 3PC6A 4IX1A 3JZIA 4X71A 5KVSA 2VDRB 4KR3A 2CZGA 4NE2A 4QARA 3PX3A 3AY3A 3O73A 5AKGA 4Q7MB 1Y7LA 4A15A 1C7FA 1YZVA 1NW6A 2E9SA 2XMGA 1IAQA 5ES3A 2Q5FA 3VGJA 4KXLA 3P9ZA 4X20B 3EEYA 4JASB 3ZNOA 3GQVA 5KHAA 1JFFA 3EFHA 3P2JA 1Q1GA 3BERA 4QYTA 5LIPA 4C6RA 1P75A 1PFVA 1V1RB 2OENG 3M4XA 4ZVTA 1Q7TA 1M75A 2FW7A 5NULA 5KYGA 5E6UA 4X6XA 5ALLA 1DBVO 2UVPA 2JCGA 2X5XA 4YT4A 5FV4A 1HE5A 5CX1A 1FNBA 2V4MA 3I3OA 4IQFA 2W6NA 4KE7A 3DEYX 2QROA 4G97A 3B2EA 1XA0A 3KQSA 3P5SA 2POCA 4YBZA 3C1UA 2WIGA 4YLGA 1Q0RA 2VJLA 4QYXA 3ISJA 1HRKA 2ISSD 2Z2YA 4LOKA 4ZTBA 1MB2A 2J32A 3A1VA 4GVXA 5SYNA 4Q01A 2XA9A 1OU4A 4WD3A 7AT1A 3STUA 1OX5A 1FP4A 1Z9BA 1T1IA 2R8OA 1E0JA 1E1RA 2WEKA 4M6WB 3A6JA 2Q3EA 3NIWA 1HO3A 4Y9SA 1UIRA 1TZKA 1T9GR 1PJ2A 2N75A 4UNNA 5KNDD 1WB9A 3NV9A 5CMLA 4B6FA 4URFA 1U8XX 1OXXK 1T2VA 2NU6A 4TX1A 1G6Q1 5ICEA 1TK2A 4H7HA 3KQLA 1X3LA 2P3OA 3ZQJA 5KX5B 3S2ZA 5LA6B 4Q9HA 3F90A 2DFVA 1S01A 1EVJA 3ELBA 3LUAA 3O2SB 5KZMB 2OE2A 4NARA 3O8CA 4X8LA 4M9XA 4S1TA 2R0QC 1F9EA 1QIKA 1WETA 3TINA 2VDNB 3DDNA 3SVLA 3EW7A 3AGPA 4LBWA 3H42B 1Z2AA 3CRRA 3L6UA 1X87A 4A26A 1NVUQ 1UFKA 4DMHA 2ZEJA 3TW8A 1E3WA 3RSCA 4LXUA 1RT9A 3MQFA 3I2KA 4ITRC 1SXQA 3I5MA 1GKYA 2P4EA 4PAQA 5HUHA 2C54A 4J0QA 4H1WA 3LNCA 1NUPA 4Z0NA 4CMJA 2WMDA 1E5DA 4D9HA 1R9NA 3OTOB 2BGIA 2YHSA 3NT5A 3OBBA 1IM5A 4DNOA 3WAKA 1V5FA 1ZNXA 4QYSA 1ISIA 3QHAA 4HB2A 4WL0A 1L5SA 2D4HA 2M2IA 3ZK8A 2O5VA 3U7IA 1K3FA 5LQNA 4JFAA 5DPMA 1OW3B 5I9SA 1UT5A 4UUBA 5EFOA 1H3EA 4P33A 5IF9A 5F9FA 2P9TA 4Z3KA 4ZCMA 5JLJA 3D6MA 4X66B 1QYXA 2F1RA 1ONSA 3TIXB 5I7HA 3F73A 2IZOA 2CJFA 4EAAA 3M1AA 4K6OA 3VU9B 1P3DA 4CEJB 2WOOA 2VAMA 2FPWA 4HNGA 5I4CA 1Q50A 1Y5NA 2ZXUA 1Z5ZA 4L2IA 1V2HE 2OHXA 3UMMA 5K8TA 1XQXA 2PPVA 5IVDA 5GV7A 1ULUA 2WAAA 1JQLB 3HJTA 2ACKA 2GAIA 5GONA 1WZCA 1RWMA 3DXYA 1S3GA 5UKDA 3BSSA 4UUAA 1Y1QA 5FTNA 3VPDA 1SRRA 2XODA 3BMQA 3VR4H 3FAKA 3H8SA 1NR1A 3TX2A 1G8GA 3WDKA 1YI8A 1Y8AA 2O3TA 4IWNA 2I6QA 2WU4A 2K4MA 1XA4A 3DKRA 2MSLA 3EZFA 3K9GA 4IXDA 4ER7A 4YIHA 5HZKA 4BB6A 1EUQA 3BBPA 1N33B 3NTQA 4UMFA 5AVSA 3U4DA 4CUKA 5EE5B 4BCCA 2B4RO 4B71A 2ZT7A 4EEKA 2Q4RA 3IR7A 3B9QA 3M5PA 4GPD1 2D2FA 5KQPA 4DIBA 5KC8A 1T1EA 1Z0UA 4JU9A 1P72A 3KR9A 2OP1A 1L4YA 2P40A 5DBIA 3RPEA 1GPAA 1BH6A 1PR9A 2WMYA 3HUUA 4DV3B 4RCZA 5H80A 1OZFA 3CC8A 2XCIA 3Q12A 4S1PA 3FTFA 3ZE2B 3IIKA 1EXVA 1E1KA 4MA4A 3JZFA 1G5TA 2ACVA 1IUKA 1NLFA 3ZTYA 4G4IA 4GGPA 5BN3B 5KTNA 1MOPA 2I71A 2A9JA 3DLIA 1F48A 1V5GA 3DVAB 4YT5A 5TPZD 3VUFA 5LSAA 4YXFA 1I14A 4V0MA 3RASA 1EK2A 1FC0A 2WKRA 4BJ1A 5C51B 3PTZA 2DUUA 3D7RA 3PWKA 2AYXA 3N7UA 1GHTA 2UXBB 1B8PA 1CZUA 1TXGA 2IXEA 4IKOA 4JS0A 4LXYA 3CUSA 4JEUA 1DKQA 1HURA 2QZ4A 3WQRA 4BMNA 1CYEA 2QL9A 4L08A 1CCWA 3EXHB 3OKCA 4KNVA 1A7JA 4HDMB 4L28A 3TLJA 5ICSA 2WJZB 1A7KA 3FVQA 5EQTA 1DUVG 1N6RA 2D3WA 1BFKA 1TK3A 5D00A 3SJ7A 1TW3A 4FMPA 3KTAA 4AU1A 4EUEA 3THXA 1N6NA 1KAGA 4II2A 1U28C 1ZUNA 2XOKD 3ABZA 3MJFA 1KP2A 1V37A 2WVJA 2P1DA 5HILA 1JQAA 2C7QA 4ZI2A 2XIJA 4KN5A 3DFMA 1YDFA 3FPAA 3HFSA 3OIYA 5JATA 4FGSA 1KJQA 1IHYA 2X41A 4L3VA 4R1TA 5IJZA 3WIUA 5ULLA 4LXQA 5H4HA 1NVWQ 1RIFA 4QPNA 4K2AA 4IDDA 4NBKA 1N57A 5AK3A 4KIFA 1G8AA 4MCIA 3KP1A 5I9LA 5ER9A 2PNJA 5BO5A 1EE9A 2VUSA 1V6CA 4TSKA 1G3UA 5DI3A 3OPMA 1LNSA 5EP1A 3VSBA 4YCMA 2NU9B 2G4LA 2PYIA 4FXPA 3LA6A 1XAGA 5T6BA 1YK0A 1MAUA 3H0KA 5SYMA 3TXAA 2DTDA 5FUBA 3D3KA 4YJ2F 1KEVA 4WKGA 4HAUA 3ZE0B 1ILWA 1EK0A 3DE2X 3OCUA 3TQRA 2DULA 4AK9A 4EY4A 3BIOA 4WKNA 4IOLA 4LNHA 3K8OE 2ZPAA 3UH0A 1YNOA 3HJHA 1TCVA 3HY3A 3WL3A 3G7SA 2WWFA 3ORSA 3P2OA 2FR8A 1X7WB 3RS5A 2WAMA 3MQ2A 3V6LA 3ZHBA 3T7CA 3RBAA 1K5GA 1NJGA 4CMHA 3ZOKA 1MNQA 5B4TA 1QLHA 3EGEA 2J48A 1R15A 2R47A 3B6ZA 4HF7A 2W6ZA 4Y9RA 3SC4A 4WBSA 2XCSB 3TR0A 2QD2A 4REQB 2J0SA 2I54A 4BMSA 5EWLA 4KO1S 4L9RA 4N40A 1Z4OA 2XCRB 3RSLA 1DAKA 2GBLC 1XQ6A 1ZRMA 2DWOA 2DHCA 1ZVMA 4HLQB 5AMXA 1PP4A 2EW8A 2Z5GA 1ZI6A 1DP4A 3I42A 4PGGA 3RS2A 1E99A 3UAYA 3UM9A 2C88A 3WGOA 2ZP1A 2FFJA 2X8LA 3C6XA 3DLPX 4B6EA 2YY6A 4LJYA 4OL0A 1BHJA 1DC6A 2C92A 1KTVA 4C6TB 3AIMA 4LY3A 5F73A 3E82A 3M81A 2WYVA 3P0EA 3CZ4A 4D46A 3AU8A 1BS1A 2HDOA 2ZULA 4RMNA 2ZM5A 5CVJA 1NDUA 2V5AA 5H68A 2FQQA 1L7NA 4TLBA 4QA9A 1X42A 4BAUA 3UENA 3M1YA 5JDIA 3V3KA 3GVXA 3OO0A 3U37A 5J4LA 2OECA 3WDSA 4LXHA 1JN0A 2UVQA 2VYVA 1DC3A 1JG7A 2QXUA 3SPXA 1EG7A 2FW9A 3DE0X 3P9IA 5F3WB 1DRJA 3VNUA 3UV7A 1K8RA 5CDFA 2GCPA 1SVSA 1FMLA 4PZPA 4UFNA 3W3AD 1ZS9A 1O5IA 2JAHA 1JI0A 3VC1A 2W6CX 2ZVDA 1XYVA 2IXFA 5TMDA 1C1DB 4HGQA 4CNQA 4EHJA 1HA3A 4UQPA 3HCOA 4MYRA 3D6UA 2YBDA 1INLA 1SHTX 2CMFA 4Y2UA 3LDAA 3WRVA 4PLFA 5F7XA 2AK3A 2EFYA 1QH8B 2P9BA 4NEGA 3SIXA 3TEJA 3E6AA 1LD3A 4M1OA 2VR1A 2FR1A 4M0MA 4FNGA 4OLAA 1AV7A 2F1OA 4LQDA 3I6BA 4NPCA 5L53A 1FLVA 3E3LA 3BDIA 1AA9A 2ES4A 2ZRCA 3QFFA 4B5LA 4I8DA 4UNPA 2QLLA 1K88A 4G25A 5EQFA 4C0KA 1TCUA 3QWIA 5TF0A 1NGSA 1O6ZA 1RWWA 1L5YA 2QRZA 3H87A 1O96B 4R5HA 4IHQA 4BFLA 4KLNA 4XAQA 1T9HA 3K4HA 1TM5E 3TW6A 2SECE 2KM1A 1IATA 1QX4A 2NAFA 2MU1A 5KOHB 4MO2A 4B1FA 1EFVA 3BIJA 4Y2XA 1IN7A 5DNYB 1B3BA 2AN4A 1V39A 4N01A 5IN4A 3AJEA 4X20A 1ZP6A 1ECCA 3KL2A 1SFRA 2OT3B 3IE1A 1ETUA 3IQGX 4HP8A 2QRLA 2C8VA 5C53B 4CM4A 2F7SA 5LDDC 3D8RA 1GXSB 3I9V1 4QOHA 3ZU4A 3OP1A 1Z4NA 2K5UA 3EISA 4ZQCB 1OHHA 1PZEA 3DHWC 2Q46A 1RYYA 5EJ5A 4CT5A 4EF6A 3CFYA 4BFYA 1QAMA 4K26A 4XOUA 3A0RB 2VJPA 3OOHA 1FFYA 5DLYA 5IFKA 1TZMA 1WMDA 3NORA 4HGYA 5ETJA 4BEWA 4P2BA 3FPEA 2CD7A 4U7WA 3SQDA 3ZCUA 2XMQA 3JPWA 2I3BA 2CVHA 2Z04A 3L7JA 1GUDA 1L1FA 1RYZA 3PUKA 2ASVA 3SCZA 3AXTA 2XTMA 4NV1A 4TT3D 1BXRA 1M2EA 5F64A 1BWQA 1Y5IA 2P30A 4TXJA 3Q0TA 3T4PA 2IEAA 4JOCA 5IVKA 4UATA 3IUEA 1EFCA 4GD3Q 1YU6A 2CHGA 4I50B 2PH5A 5ENVA 1T5LA 1MC5A 3IO5A 3DAOA 4MGHA 3OZWA 2QD1A 4BQIA 2CKMA 5JZOA 3OZDA 3WGVA 4MDYA 2D1RA 3QPUA 1GQYA 1JU9A 3B5IA 2R4TA 1P17A 4JODA 5CH8A 1ZMRA 1QWOA 3CU5A 3LJKA 2PLWA 4ZU6X 2GPAA 4R1UA 1ODJA 2Z2KA 3ORRA 4I1VA 1EH5A 4BO8A 2IPOA 3LPNA 3RFCA 1O0SA 1YJQA 3IAM6 5C52B 3O8OB 3EEOA 5JY1A 1SB9A 1XWFA 3KXIA 3QX8A 4FBMA 4YFYA 2HI0A 2SCUA 1QHXA 4OM8A 4NQRA 4DN6A 4WBNB 1R0WA 3UPUA 4AS1A 1MVNA 4BECA 4JZKA 1UPXA 3MJEA 1XTRA 4QQRA 2P6OA 1YB2A 5K09A 5JYCA 1GNQA 4V39A 4CV2A 4TYYA 4E88A 5FUYA 1YZNA 2QTFA 2W6JD 4PS1A 3QNWA 3STWA 5HHTA 4MQLA 3BB3A 3L0BA 2XXBA 3IAS6 3HCRA 3OG9A 4HSGA 2IYLD 5LWQA 3PBKA 4X7BA 5GZ3A 3WFJA 1I7DA 1CUUA 1X1RA 2BGJA 1DCTA 1AK9A 1C30A 3K9LA 4XGKA 1HYGA 1CYDA 3LQRA 4MKGA 1Q0QA 4RVDA 5CFZA 2E82A 4FYYA 4ECAA 1BKSB 2RIRA 4MW2A 1ORTA 2JEYA 2PXXA 4M53A 4YC7A 3R7WB 1JXOA 3FYUA 4OQQA 1P8JA 3EIXA 3FYUB 1ZOIA 1IULA 1H42A 2V7PA 4HGNA 4AY3A 2ASEA 3L8HA 3DR5A 4NYJR 2HRZA 2C2YA 1BDHA 1EWYA 3QUAA 4A91A 3T5CA 4AW9A 4MWOA 1Z2PX 3P94A 1DG1G 4L5CA 2I22A 3UCEA 1JSZA 5DYNA 4IIFA 2A3RA 2GPTA 2R751 4A2CA 3SIRA 4EM6A 4CV1A 4FM9A 5HFJA 2D54A 4RJIA 2YC2C 3MCUA 2XRZA 3CGGA 2Y27A 1G3MA 1DT5A 1SQ5A 4O29A 5IDYA 3KWJA 4FEEA 2FZ4A 2GN1A 4I1UA 2YDXA 1Y3DE 1BA3A 3EWNA 4L51A 2HIAA 1JLLA 2PKEA 2GAOA 2G80A 3W2TA 5F9HA 4FONA 4G6ZA 4FKBA 1NP6A 1FL9A 2XUJA 3ESZA 1Z8DA 4E4RA 3H5IA 4CFYA 1E62A 2R44A 2RARA 1ULAA 3PHJA 1PEYA 4BKOA 1KQOA 3WX0A 1TEXA 1NQXA 2VVTA 1TADA 1IQ0A 5HZMA 2JD1A 2YWBA 3LFTA 3F3SA 3E27A 4B5KA 4H1UA 3CM0A 5I7WA 2WFLA 2H54A 2VEDA 4J0HA 5BN5B 1WEHA 5HF6A 5EE1A 4DW8A 1ABFA 3A04A 2Z95A 1LLUA 1N6IA 5KYNA 4CEHB 1WHSB 2IYVA 3VPFA 1ZQ1A 2H92A 1OLUB 1PJCA 3RUFA 3GCWA 2PCLA 2W90A 4MSUA 4RKEA 1D4AA 4NHEA 4D2IA 4HDMA 2ZB8A 2C07A 1CB7A 1U0FA 1WD7A 2VH1A 3LLMA 4FOTA 1XKXA 4FFVA 4LI3X 2JFQA 3HVUA 4Y1RA 3RF6A 3S0JA 1BWSA 4RD6A 1ENZA 3AY7A 1XELA 4IJMA 4ZCQA 1DC4A 1OT3A 1U0TA 2HMSA 2I9PA 3K4QA 3QQPA 4CLOB 2F3RA 2O2ZA 2GHRA 1MEEA 2JIDA 3JQFA 1VSTA 3HQ4O 1YDGA 4M60A 3C7DB 3GJ0A 3UJDA 4DR4B 1GZDA 2VWPA 1JWAB 1JIXA 3FYHA 4GOKA 2WV9A 3EUEA 4H0NA 4CTNA 3IQWA 1E89A 2P2YA 3LWDA 4R2IA 3NTOA 3WK8A 1IJEA 2IYUA 3BMOB 2Z08A 2JIQA 3BMNA 4AM8A 5FUMA 1OB2A 4IIXA 4YJFA 3KKLA 3CNOA 3I34X 1ISPA 3HGTA 4JSRA 3NT2A 2HZ7A 2RK4A 5EINA 3OQHA 3PC4A 3TIFA 3ENZA 3DFUA 1QDLB 1YKSA 2W9XA 1C9YA 3QENA 4MRMA 1ZONA 4WDRA 4DWWA 5BW5A 1AY0A 3FDFA 2QG9A 1O89A 4OQZA 2GVZC 3EMKA 2OYCA 2JAUA 2VJBA 2VYQA 4Q05A 4DDHA 1M54A 2VL7A 3Q41A 2I6GA 2OB2A 4HX9A 1JDBC 1V8BA 1O95C 3PNMA 1IQUA 5JSZA 1PE0A 1PG0A 4B3IA 1FQJA 1I3LA 4AIRA 4XX1A 4XOIA 4CKWA 1MAHA 4GECA 4G8CA 4O4HF 3C1OA 4RQBA 1RYMA 2GN9A 2C3PA 1MH9A 2OD9A 3IJ5A 3NT4A 5D86A 4Y30A 1YS6A 2FW8A 4RK5A 3RGWS 5I01A 4K81B 3O95A 4FEYA 2C5FA 9MHTA 4EDFA 3T5AA 1G8SA 4Z4HA 4DL9A 4EWLA 3JD3A 5AHOA 4Z1MD 4MA0A 5TY0A 2CDRA 3NHZA 5JIBA 2MR6A 2OUKA 4LN1A 1GUFA 1TFRA 2JEZA 3NHKA 4WFQA 1BOFA 2PSFA 4OGFA 2R87A 2A67A 3R20A 4RZIA 1TRKA 4DLYA 1N9GA 3T3IA 5AUPB 2QRKA 1EESA 5BOVA 5GINE 1BHQ1 3MTAA 4KLAA 1WXXA 3L1IA 1GA4A 3DC7A 5TQ2B 3FOAA 3VU3A 2CLIB 3HGQA 1M72A 2HLNA 4ZJPA 5L40A 4EHKA 3C3AA 3E9CA 1TAHA 2BI4A 4C21A 2GEFA 2AMLA 4DY6A 1QORA 5BSRA 2B0JA 1FBNA 2XQIA 3C3WA 3QEAZ 1PT8A 4JOSA 3DJFA 3FDIA 4NYMR 3S7ZA 1UXHA 3QTLA 4U9HS 4B9EA 5AVQA 4ZVNA 2RE8A 1GFIA 1B0UA 1KYTA 2C7OA 1BG6A 3FFWA 1Y3CE 2K7FA 4CZ2A 4PTZA 1KEZA 1FBTA 1P7WA 4TZTA 5DSZA 4IHJB 2IGBA 1EP9A 3AFOA 1QTRA 3N6RA 3WBFA 3QEKA 1WDMA 3AO0B 4AN0A 4BNHA 1U1GA 2PLNA 2RB5A 2B8T