5LQNA

Crystal structure of comt in complex with 2-[(3-chlorophenoxy)methyl]-4-methyl-5-(1h-pyrazol-5-yl)-1,3-thiazole
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Crystal Structure of COMT in complex with 2-[(3-chlorophenoxy)methyl]-4-methyl-5-(1H-pyrazol-5-yl)-1,3-thiazole
rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 79
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5lqnA00
4HGYA 2HV9A 2AZTA 4QPNA 3M6WA 3VYWA 1G55A 4E2ZA 1QAQA 1AV6A 3G2QA 3NDJA 4FS8A 1RI5A 1L3BA 1NV8A 3P2EA 5E8RA 3MTIA 4QDKA 4C03A 1ZKDA 2ZZNA 5BXYA 2GLUA 3Q7EA 4V0RA 3KQYA 1EAMA 4E32A 3SMQA 1VBFA 3FYCA 3LDGA 4OBXA 2ZIEA 3DTNA 1Z3CA 2WK1A 1UIRA 3BWBA 3GRUA 5GWXA 2AR0A 1X1CA 2NNWB 1L9KA 3ELWA 4M36A 4GC5A 4PGHA 3KQOA 4KIGA 5LSAA 2BZGA 2XYVA 3HCBA 3V97A 1WXWA 2OY0A 5EKXA 3DXXA 3C0KA 3KPWA 1VP9A 3FUVA 1RJFA 4EVIA 4X41A 3BWMA 3HCCA 3MERA 2B3TA 2OBFA 4O29A 1ZQ9A 3NVKI 2XVMA 4GOLD 4RVFA 4YUVA 3PFGA 1ZHFA 3DP7A 3FUXA 5EZQA 3TLJA 2FCAA 3FUUA 3FUWA 3GXOA 3HVJA 3M4XA 3NVMB 4M7RA 1RI2A 5LQRA 1G38A 2ZW9A 5DX1A 5LQCA 4EQZA 1VQ1A 1NT2A 1G8SA 4PYNA 3LCVB 2PX8A 3DLIA 2Z6AA 4PCAA 4P58A 1D2CA 3LCUA 2B9EA 2K4MA 2JH9A 3R9XB 2AOTA 4CTJA 1Q0TA 3WSTA 1RI1A 3FTEA 1WY7A 2EJUA 4EK9A 3G7UA 1UFKA 3UA4A 1KPHA 3AXSA 3IHTA 2ZZKA 3KQPA 2GAFA 3AWIA 5E9QA 1G60A 5FWAA 2AS0A 5FUBA 3A27A 3BZBA 3EGVA 2UYQA 3GRYA 4AZWA 1EG2A 1KIAA 3LECA 3M6XA 3G8BA 2OB1A 3DMHA 2IDKA 2NYUA 3DULA 3Q87B 2PXCA 3R24A 3GU3A 4CTKA 3FUTA 4Y30A 5C1IA 4FT4A 1N7JA 4R8SA 4YV0A 2GB4A 3O4FA 5LR6A 4CXMA 5GIPE 2IPXA 4PYJA 4OX9Y 2AOVA 5LQAA 3B5IA 1QAOA 1R8XA 4JXJA 4L7VA 4XCXA 2PVCA 5HIKA 3B7PA 5FULA 1TPYA 3P8ZA 1BKYA 2XYQA 4P7GA 2YXEA 5D1HA 5EKUA 5FHRA 5HILA 2WA1A 3GRVA 4RWZA 4P7KA 3KQQA 1NW6A 3BWYA 4QVGA 5CD1A 2IP2A 5IH3A 4A6DA 5E2AA 2FK8A 5K0FA 1M0EA 3EVBA 5GINE 3ER9A 1U2ZA 2P1DA 2IBTA 1ORIA 3JWHA 3TMAA 2PX2A 4QQKA 5HIJA 4ATNA 1BHJA 3CJRA 1R8YA 4E33A 1ZGJA 2JHAA 3FPEA 2JHCA 4PONA 3DLCA 3P9IA 4YUYA 3TFWA 5K0CA 5GP1A 2PX4A 2HMYB 2NXNA 4FGZA 3BXOA 4LG1A 4DF3A 3I9FA 4C04A 3CBGA 4YMGA 2PGXA 4GF5A 4RTSA 2B78A 4DCMA 2ZFUA 3LBFA 3SGLA 4PNEA 4FZVA 2E5WA 1XXLA 3NWEA 3OU2A 4RVDA 2IGTA 5K0JA 2ZZMA 1FP2A 3DMFA 3LDFA 2YQZA 4QVKA 2PSSA 1KP9A 3PB3A 2VZ9A 3EMBA 1EQAA 4HGZA 1SUSA 3UJCA 5BW5A 4FT2A 4C07A 1KPIA 3SR4A 4RTNA 1KYWA 1YZHA 1X1BA 5E1OA 3FRHA 3OCJA 5E8JA 3KKZA 4PWYA 3MCZA 3THRA 2P7IA 4YV1A 5HZMA 4RVGA 4RTOA 2G72A 3UJBA 5FQOA 4F84A 2O06A 2XYRA 5DSXA 3GJYA 3DXZA 3HM2A 1WG8A 2HWKA 4RYLA 4POOA 3KHKA 3P9CA 2ESRA 3QV2A 4OQEA 3UJDA 3DXYA 1JSZA 5E2BA 4Y2HA 3HTXA 4BLVA 4E31A 1F38A 1VP3A 4V0QA 2P41A 3LKDA 1NBHA 1M6EX 2AOWA 3ELUA 3I5UA 3T0IA 3V8VA 5KQSA 4P7JA 3OFKA 2KW5A 2QRVB 2V7EA 5KYGA 2ZCJA 1JTEA 2Z6QA 1DL5A 1YZ3A 1RJDA 2UYOA 3TQSA 3R3HA 1KHHA 3HA3A 1T43A 3EEOA 3B89A 2CMGA 1JG4A 4P7FA 3LSTA 2GH1A 3LX6A 4DA4A 3SX0A 3BT7A 3KPUA 2DULA 5EPEA 2OKCA 2PLWA 5T67A 2WA2A 5DTRA 4X1OA 2ZULA 3C6KA 1PRYA 2QYOA 4BP3A 1JR4A 1UWVA 5LQNA 4DZRA 4PIPA 4GQBA 2AN3A 1HNNA 2C7RA 3LDUA 5BW4A 1N2XA 3AJDA 2VS1A 3OZSA 3TOSA 5K0NA 3NDIA 1JG1A 3X0DA 1QANA 3G89A 2VP3A 2PX5A 4GEKA 2EFJA 1XCLA 3CCFA 3I53A 3EVFA 4C08A 5HIIA 3GIWA 3KPVA 3VC2A 3NWBA 1WS6A 1FPQA 2ZLBA 4XUCA 2PKWA 5E1BA 5MHTA 4RVHA 2YR0A 5LQJA 2I62A 2AN4A 4BLWA 5CCBA 3THSA 2OPBA 5EGSA 3B3JA 5EMKA 3HCEA 2UYHA 3DH0A 1MHTA 3EVCA 2IBSA 4X61A 4MHTA 4E70A 3PS9A 4KWCA 4YUXA 1JQ3A 1N7IA 3FRIA 2P3LA 3OZTA 2HR1A 3RW9A 1QZZA 1G6Q1 2B2CA 1XDUA 3O31A 5DTQA 1SUIA 2YUIA 4QTTB 5LQUA 3MHTA 2C7PA 1EIZA 5E9WA 2ONZA 4AZVA 2FPOA 3KQTA 3EVDA 1ZGAA 3B3FA 5JUWA 5T6BA 1ZG3A 5CVJA 3CC8A 1P39A 3PTAA 3NMUF 2PJDA 4DKJA 5FCDA 5B1SA 4E30A 5P8WA 2JH8A 1V39A 3I64A 3FPHA 4RTKA 1NE2A 4M37A 5KS2A 2BM9A 4AZSA 2OZVA 3FPFA 3KR9A 3OU6A 1TW2A 1P1BA 3B3GA 4KIFA 5CVEA 2IH5A 3NW9A 5EEHA 3NTVA 3DOUA 4HSGA 3G8AA 5EVJA 2PWPA 3VSEA 2YVLA 5DM0A 2P3QA 5DXJA 3OU7A 1P1CA 4H0NA 2A14A 1IXKA 1XCJA 1IY9A 4R6WA 5EIWA 4R8RA 4Z2YA 3AY0A 4XUEA 3KQWA 5K0LA 5K0EA 2P3OA 4GOMD 5EQJB 4YUZA 1VPTA 4YMHA 1X1DA 3IYLW 1YFJA 3P2IA 3KR1A 3PFHA 3A26A 3GRRA 1H1DA 1KXZA 1R18A 2ORED 1I1NA 3F4KA 2Y1WA 4FP9A 5C0OE 1AQJA 2O57A 5EHGA 4HTFA 5C9ZA 5G02A 4M38A 4RTPA 5BP7A 1IM8A 5GIOE 2C7OA 3G5LA 3PX3A 3TKYA 2G1PA 5E1DA 3SVZA 3HP7A 2LD4A 3QOXA 1DCTA 5K09A 1KR5A 1TW3A 2Q41A 3CJTA 3I58A 4PCLA 2ZIGA 4OA5A 5EC8A 3JWIA 3K0BA 3MCTA 3FPGA 3TM5A 1X19A 3C6MA 1XJ5A 3PT9A 3GWZA 3OE4A 3P2KA 3R0QA 2EX4A 5EZSA 4K6MA 1L3CA 5F2OA 2ZSUA 3ID6C 3L8DA 5DWQA 3RODA 4X60A 4ER0A 1JQDA 4RV9A 5CVDA 1XTPA 4FSXA 2F8LA 3NJRA 2VDVE 4IV8A 3BKXA 5E1MA 3FPJA 4QPPA 3ERCA 4PIMA 1VLMA 1QAMA 1JTFA 3GNLA 2OB2A 3IV6A 3U81A 4QDJA 2R6ZA 1YB2A 4DCGA 2GA9A 1YUBA 3GGDA 3R6TA 4GUAA 1AF7A 2IH2A 5KVAA 4U7PB 3LGAA 4PGGA 3ELDA 3ME5A 3GO4A 5FA8A 3MB5A 5K0BA 2QRVA 2VDWA 3OZRA 2FRXA 2NXCA 4WVLA 1INLA 5K0GA 1Q0SA 2P40A 3KQMA 5GM2A 2NXEA 5FQNA 2PT9A 5T64A 3RIEA 1VIDA 1O54A 4MIKA 3BGDA 2GS9A 2O07A 3GDHA 2AOTB 3H2BA 1XDZA 3ORHA 3VC1A 5F2NA 5DRTA 5ERGB 5CVVA 2OXTA 2DPMA 2HNKA 1MJFA 3MAGA 5DRYA 5EG5A 5KQRA 4C05A 1SQFA 4PYLA 3LHDA 4A6EA 3A7DA 3LBYA 1OR8A 2NP7A 3CKKA 5ICGA 3EVZA 5GM1A 1DUSA 1R74A 2ZBRA 10MHA 4MWZA 5GOZA 3PLAE 4WXHA 3OE5A 2AOXA 3JWJA 2PT6A 4HC4A 4DMGA 4EMSA 1YFLA 3MTEA 5DX8A 3FTFA 2G70A 5DTMA 3IEIA 2AVNA 3G2PA 5LQKA 1M6YA 2P7HA 2ZTHA 5ICCA 5CVUA 4NECA 5HOQA 4OQDA 3UWPA 3K6RA 2PWYA 5DM4A 3E05A 5EOVA 3CVOA 2GPYA 2BH2A 3TR6A 5DT2A 2H1RA 3EGEA 1D2HA 5K01A 1O9HA 2QE6A 4LECA 3SSNA 2P35A 2YX1A 1L1EA 3OPNA 2I7CA 2CKDA 2YXDA 2ZBPA 3HA5A 3HVIA 3SM3A 2Y1XA 4U7TB 3T7TA 3DR5A 1R00A 2IFTA 4PYQA 3UJ9A 4CWAA 2JG3A 3MQ2A 2FHPA 5DXAA 3UBTA 1FJXA 1RI3A 5ICFA 5CUQA 5K8VA 4RX1A 3ER8A 4YUWA 1NW5A 2ZIFA 1AQIA 4ISCA 4BY9E 1D2GA 2FK7A 5H02A 5DM2A 2EJTA 3HNRA 1BC5A 1NW7A 4KRGA 5E9JA 3CJQA 1NW8A 3E23A 4R05A 1SG9A 3P97A 2NXJA 1BOOA 1SQGA 4OBWA 5CCXA 1SKMA 4B17A 1R6AA 1P91A 1WXXA 2BR4A 3KPYA 3M6VA 4AX8A 9MHTA 3MGGA 2ZVJA 1VL5A 4RSRA 1ORHA 3UJAA 1RJEA 4AUKA 4UOEA 1JG3A 4RTRA 5DM1A 3AXTA 3FYDA 2IH4A 3UFBA 2O0LA 3UJ6A 3G2MA 1L3IA 2ERCA 3S68A 2AN5A 3OFJA 4HH4A 1KYZA 4GOND 4IWNA 4LWPA 5CIYA 4KW7A 7MHTA 2HTEA 3KQSA 3GCZA 4R6XA 4ER5A 4RTQA 3EVAA 1EJ0A 3BWCA 2B25A 4EKGA 2P8JA 2YTZA 2AOUA 2UZ4A 3HVHA 4IKPA 3P9NA 3M70A 3DUWA 2G8NA 5DX0A 5FHQA 3TM4A 2FYTA 4FR0A 3HEMA 4F86A 3LPMA 4RTMA 5EHIA 2I6GA 2QY6A 3TPZA 2ADMA 3CGGA 4E2YA 1F3LA 5EMMA 1XDSA 3GRZA 4MTLA 1I9GA 3HA7A 3FZGA 5EMLA 5EMJA 5JR3A 2PXAA 3JWGA 4IV0A 4EKIA 5CM2Z 3SSMA 4BP1A 2JHPA 4GC9A 4PINA 3UJ8A 2CWWA 3BKWA 5FTWA 1PJZA 2VDUE 4HRAA 2OYRA 2AVDA 4PYOA 5FWDA 5HEKA 2PY6A 4BLUA 2C7QA 4KDRA 4F85A 1B42A 4QTUB 4ER7A 1I4WA 4RTLA 2OO3A 1JG2A 2BR5A 3E8SA 3KU1A 1NKVA 3G5TA 3LKZA 3BGVA 2N47A 2IDJA 3DMGA 2ZWAA 2V74B 3HCAA 4HG2A 3EMDA 4PYMA 1XVAA 5DSTA 2BM8A 3P71T 3HCDA 2QM3A 3ANXA 2Z6UA 3HVKA 4E2XA 3UJ7A 1NW3A 2YXLA 1FBNA 1JQEA 2H11A 3D2LA 1EJ6A 1WZNA 4AZTA 3BGIA 3HCFA 4DQ0A 3E7PA 3KR0A 4CKBA 4CKEA 4GBED 2JJQA 3BUSA 4QQNA 5U4XA 1KPGA 2EG5A 3UA3A 4YV2A 2PV0A 3TKAA 5ICEA 5DPMA 3PX2A 3FTCA 4CKCA 5EIFA 3SSOA 4X63A 3M33A 3KR2A 2CMHA 4OA8A 1NBIA 1QYRA 1HMYA 3UZUA 2I9KA 2NP6A 2ZBQA 3M6UA 3EEYA 4RTJA 2ZWVA 3SXJA 2BR3A 3C3PA 3KQVA 3EPPA 4HTFB 1YF3A 2PXXA 3A7EA 3TRKA 4E2WA 4C4AA 4PYKA 3LCCA 4FSDA 2ONYA 4MQ4A 4ER3A 4XUDA 1SVUA 5IKMA 2CL5A 5F2KA 3QOWA 3KPJA 3G2OA 5D1NA 3T7RA 1RJGA 4ER6A 1G8AA 3REOA 1JSXA 3T7SA 2IIPA 4PYIA 3EVEA 5FA5A 5K03A 2AOUB 3G88A 4G56A 1X1AA 2O05A 3FTDA 1VE3A 4GOOD 2XBMA 8MHTA 2R3SA 2UYCA 3EGIA 3A4TA 3PVCA 4LWOA 5FADA 1FP1D 4C06A 2H00A 3O7WA 3P9KA 3A25A 5HIMA 3EVGA 2XVAA 1O9GA 3LL7A 2G71A 4KVZA 1NV9A 5DLYA 5EEGA 2PBFA 5HFJA 1RI4A 4DM3A 5K05A 1Y8CA 4KDCA 3C3YA 4ZTBA 3ELYA 5M5BA
chains in the Genus database with same CATH superfamily
4B6GA 5A3JA 1Q3TA 3D7SA 4KNVA 5I9MA 3S4YA 1IPFA 2PPVA 1BGXT 3U4AA 2JFFA 1GOTA 4LF8B 1MNAA 2IYNA 4RLSA 1JZSA 4QNMA 1HOXA 3LPAA 3NHYA 1ENOA 2GLUA 2XTNA 3Q7EA 1V6AA 2B1GA 1AK1A 1P61B 1V2HE 4Q34A 4L9AA 4Q82A 5JY1A 1WDTA 2ZIEA 2O6LA 4I1OA 5GWXA 1UIRA 4OKIA 1MBZA 1VLHA 3Q72A 1O6BA 3OZ7A 4WNAA 3ZWNA 4CCWA 3NKLA 1I94B 3K1JA 1PJLA 3IPYA 4LJ8A 2DPHA 4OJTA 2ZPUA 1A7AA 1Z7WA 4K46A 2AF3C 2GCPA 3OMWA 3SVLA 3HCBA 4BZZA 2OQRA 3ZQUA 1F51E 3TTVA 5LU8A 2NNLD 1BS9A 3FUVA 1D03A 1RXEA 1ESEA 4OHUA 3ZE1B 4EVIA 2IYXA 2OBFA 4YWJA 1PFWA 3H84A 3L7OA 3CUKA 4I3FA 3KHUA 3LPLA 4D5EA 1SCDA 3I2FA 4YT8A 3EVNA 3SQOA 2Q1WA 3TD2A 3MG9A 4F5ZA 2ZJOA 4XD2A 3FUWA 4YS6A 5IEBA 5I3ZA 3TRDA 2ZW9A 5LQCA 3W5DA 2MMGA 3FXAA 3IODA 1YO6A 3OAAA 5EPUA 2DBQA 5T4EA 5FUWA 2ZGVA 1UMDA 1PEAA 4P58A 4CEHA 1D2CA 1NRIA 1PTJC 1UC9A 2QVBA 3B9BA 4CLRB 3TQQA 3ONDA 3RRXA 1UQUA 4NPCA 4NL4H 2EX1A 3TXXA 5HZKA 5FOSA 5LA6F 5A71A 1S2NA 1ZYUA 3GEBA 4ZMSA 3LPCA 3V4PB 5J4KA 5H8WA 2QTBA 1MW8X 4YCCA 4DCUA 2FAXA 5BSKA 1VMAA 2VWHA 2G83A 4ZO9A 5IAAA 4MPDA 4WFIA 1EG2A 2HD4A 3SYLA 2IIQA 2JFUA 1SHKA 4K8OA 3G8BA 2NYUA 1P2UA 2ZT5A 2GZ2A 4AZ3A 1LVGA 2LCQA 2O23A 3T1QA 1N0VC 1EK1A 1E3LA 2G17A 3O4FA 4P22A 4IIGA 5ETJA 1M2VA 2WF8A 3URMA 2G28A 4IFTA 3L6CA 4TRRA 5FTLA 1OZAA 1CQIB 5CYGA 4PU0A 1CJBA 4ZODA 1FP4A 3F3KA 4ZVUA 2EG9A 3I28A 3K0AB 3KS9A 2XOEA 4TL8A 4XCXA 3WKAA 2VTKA 5H80A 3R7LA 5ITZB 2EIHA 2RG1A 5M3BA 5DYTA 4ZAVA 1VLZA 5FHRA 5T6MA 5B3KA 3W0LB 4P7KA 3IMKA 1E2QA 4PLZA 3DDZX 5AW9A 2JB9A 4W99A 5IXSA 4IXTA 2IP2A 1V8OA 1A71A 1EFTA 2BKVA 3G0CA 1MZPA 1WHTB 1RBMA 2H92A 1Z7EA 2HDOA 3B8HA 1N3IA 4J7UA 1XE3A 4U2CA 1KJYA 2JI4A 2FZLA 3DKRA 5IM5A 3RGWS 4ATNA 2PA0A 3HKEB 1FIUA 5KKNB 1XA4A 2JHAA 3W3AD 1C9JA 3AU8A 3S99A 1ODJA 1H94A 1W581 3FNGA 3KLPX 2PX4A 2FI1A 2XOXA 1RRPA 4PHCA 4ZTUB 4Z54A 3U7QB 1M73E 1MOSA 1BVRA 1G9TA 2C00A 4BJ5A 4RK4A 5EXPA 3TG2A 2C97A 3WLOA 1EVQA 2CLHB 3AEKB 1Z8NA 3DD5A 3W5HA 4HLNA 3WR5A 4PNEA 1JFTA 2WJIA 4RVDA 4O0LA 1E1RA 1PW5A 2VTBB 3K5PA 2DRIA 2QUHA 1K5GA 1L5YA 3EH1A 5FDFA 3IPRA 4CKWB 3H1AA 2XTJA 3PWKA 4XH9B 1N3BA 1WCYA 4D3XA 4D6YA 4EG4A 2NTEA 2EQAA 3FRJA 5A5GA 3IE1A 2O7QA 1CXZA 2EP7A 3WB0A 3CA8A 4RYDA 4H6XA 4P36A 1N6LA 3K9QO 4TLEA 5DSXA 2E18A 1NPTO 5ABPA 2IPLA 1BH6A 1CLEA 4Y2HA 5AVWA 1AKTA 4N5DA 3ZTTA 4I3HA 2WWFA 2PKYX 4C1BA 2ZYWX 3I5UA 4WOBA 1CKEA 1CUWA 4DCCA 1XF9A 3L8FA 1FEZA 4W8GA 3GJQA 5LZ5A 1EI9A 3FLMA 2FLVA 3V00A 2F1IA 2VJOA 3EXG2 3LT1A 3SNHA 1Q21A 1XVLA 3QFFA 1HYGA 3U44A 5D3QA 1XPUA 4X66B 1UJCA 2ZAYA 5CW1A 3KPUA 2IOHA 2YZGA 3KD3A 2DQKA 5T67A 3VR0A 2ZQZA 3E9RA 3FYTA 4TLAA 1E3JA 2WJGA 4NBKA 5HGXA 4F5YA 1XX6A 3FBTA 5K3AA 1GZUA 2VZLA 3ONEA 1MZVA 3A28A 3RUEA 4BNUA 2OD9A 1JG1A 2IEYA 3L0CA 4UHEA 1T2FA 4KXVA 4NAHA 1T36A 1OROA 1CVIA 1YHNA 1G8FA 1NOIA 5K0ZA 1LSUA 3CX8A 4ZAZA 1ZICA 2FG6C 4K9KA 4RU1A 1EVIA 5C7OO 3CINA 4NQRA 4HWSA 4QUDA 4ZAWA 1QH1B 4LRYA 4A5OA 4CEJA 3KHTA 2LR0A 1Y4UA 2VHZA 1Q83A 3SQWA 5CFQA 2BBWA 2FFHA 3LLSA 3IO3A 5C1PA 3AVPA 4QJIA 3EVCA 5LJLA 4C7OB 5CU7A 1TA0A 3WIUA 1TCVA 2RC5A 4DLSA 4EYQA 2YC4C 3F78A 2I8AA 2Q8PA 1M0WA 3RTAA 2BFPA 3AJAA 2YV1A 1TVMA 2Z5GA 1L8AA 1QGOA 2PGLA 5JMWA 3KT8A 3AHEA 2B2NA 1DEKA 1RU3A 1WHSB 1WJGA 2W43A 3UMGA 4HAVA 3HKBB 4BGIA 2A9FA 2GILA 3MOSA 4NICA 1DWOA 4MWGA 4MHSA 4EKEA 2FETA 2HNAA 2IF0A 3PJFA 3DAFA 2V6BA 1C7FA 4JX9A 5CVCA 5CVJA 5K3EA 2EP5A 2O4CA 1QHEA 3T1HB 1KVUA 2DERA 4MK4A 2MCFA 4H0FA 3I64A 2V6GA 1UPBA 1AUVA 1Z06A 3IIMA 3RTCA 1DJOA 2I9PA 1CRQA 1CRZA 2C5LA 3PPWA 4WLNA 3GLFE 2D2FA 4YDHB 2XF8A 4OQPA 1V16B 2VQ6A 4US2R 1U6IA 2MWMA 4M0LA 3QEBZ 5EINA 1S01A 2QRGA 1L5ZA 3B3GA 4RDCA 4N6GA 5AICA 1H6BA 4JI2B 3AKZA 3LHSA 2QM0A 4CLHA 4FMBB 1L8XA 3DMDA 3GHYA 3H17A 4B3HA 1D04A 3T35A 1PTJA 4US0R 2W98A 4KAFA 1DJMA 1O94C 1RKBA 3FG9A 1IY9A 1I3NA 1GPMA 2Q0XA 3BH0A 4R1OA 4ZRDA 3FZQA 1PUJA 4QOFA 5JPIA 4F1KA 4N76A 2PCJA 5CLIA 1H3NA 2B21A 3Q7SA 2PZLA 8GPBA 3TUZC 1VMIA 1Q7EA 1P1IA 2PTHA 6REQA 3SYRA 2C20A 4N7BA 2VDOB 2N1MA 3I0MA 4G5RA 4OX9B 3R2JA 5DYNA 1TTQB 2ORED 1V26A 3EHDA 3GH3A 3FKJA 1T8PA 3WBFA 1EE1A 3AR3A 4BVFA 3DLHA 4BLTA 4EW6A 1NUPA 4DTCA 1YR6A 3FFBA 1M8KA 4KPYA 3HP1A 3C8HA 3I58A 5MGBA 1PLJA 2CNDA 3IB3A 1S2DA 2OILA 1QO0D 4OHWA 3UMMA 4IIJF 5TPWA 3C4VA 3VZCA 5ADUS 4HMQA 4BRZA 1DKPA 1GTL1 3ODPA 2GN6A 1E6UA 1D4AA 5CM8B 2ID8A 3RNLA 1E9VA 1KEWA 1YOVB 3EZXA 2OTCA 3CYFA 3OD1A 1UZMA 3TVDA 3USES 2OO7A 2RHTA 4YJFA 2DQYA 1WZCA 1K6MA 2CJPA 1K3FA 1JX6A 2XOKD 1BJTA 3L8DA 4GGOA 4H3SA 1QG4A 4HDCA 3MJDA 1ZJ5A 4URYR 1KIMA 3FBWA 3MQFA 2O3TA 4UCFA 2KBEA 4K9MA 2WSMA 1OXVA 1XVVA 4HDRA 1ZK0A 3QHAA 4YRKA 2NU6B 4N4AA 5E1MA 4EITA 1TUIA 2WIBA 1JKMA 4M1SA 2I6XA 2IEBA 1J2RA 2WB4A 3WGGA 2TMKA 4D4JA 1MKYA 2IVFA 1RCTE 3MBKA 3N7TA 3QX8A 4Y6PA 3GGDA 3H9UA 1Y8RA 2J3MA 2L82A 3IOEA 3PITA 4NG4A 1G4UR 1XL0A 1ICEA 3C1AA 4PGGA 2JIMA 4IQ4A 2FEXA 3GAZA 5TX7A 1BVYF 3HB5X 1LBIA 3PUHA 3UAGA 3D4LA 2QLLA 4WVLA 1Q0SA 2WMDA 5CCDA 2JCGA 1L4EA 2ZIAA 4TL7A 4JKIA 5I47A 4EEXA 3I45A 3R4VA 2GS9A 2QENA 3IE2A 4UMEA 2Z1DA 2C7GA 4HVAA 5E6UB 5DRTA 5ERGB 4ALKA 1NLUA 1V8ZA 4WK6A 4DAEA 2WHRA 4O2RA 4EGSA 2JLUA 2C2YA 4NFHA 1HFJA 3CKKA 4BNFA 2HAEA 1DUSA 1ZM3A 4RQBA 2Z8YA 4OAOA 3RM3A 4NH4A 4OI0A 1TXGA 1PK7A 2EWMA 4YO8A 3K30A 2AV6A 1PL6A 1P4RA 1ZONA 4N9QA 4GSLA 3FTFA 1AGNA 1ZGCA 1JZTA 3RS3A 3B1YA 1YOVA 2J31A 2HT6A 2ZTHA 1QDUA 1HA3A 4XD7D 4DNOA 3UWPA 2XAUA 3RYFB 2OFWA 5KHOC 1Z6XA 2JIRA 4QYTA 2O5VA 2RJOA 3PGJA 2HSGA 1RVV1 3A3YA 1KQFA 3K9GA 1XTTA 5JALA 4OH1A 1QDEA 1QC5B 4AY3A 3MWEA 1ONNA 3MSCA 4X9XA 1NPDA 2QNIA 3IQIX 1C3LA 1CY8A 3F4LA 2XV1A 2KS6A 3MQ2A 5IM4F 3DC7A 2W58A 4UASA 5DXAA 1RWXA 3RSFA 1XC7A 2NN3C 4NZOA 2P9CA 4EG1A 2A0WA 4G41A 3ADKA 1YZVA 1AU9A 5F7ZA 1KO5A 3H1TA 4DV6B 4KRGA 1GN9A 1TCUA 2OMKA 5D3ZA 1YDGA 3PDWA 2GD6A 5JS8A 2OAP1 4WFKA 5KKAA 1GEEA 1QF6A 1E1CB 5KWJA 4FOOA 3RS7A 2JFYA 4BNTA 3TLAA 4QUHA 2AXEA 4Q37A 1SRQA 4II2A 5FORA 2PSFA 1B4DA 1VSQA 1ZJJA 4RK5A 1UKBA 3V7FA 3SLRA 1EP9A 5HE8A 3BB1A 1FB5A 2XUDA 3DMTC 1RFGE 1WRBA 1G9XA 3DHYA 3U4CA 2F1OA 3PEFA 2C2ZA 1EESA 4A1OA 1KYZA 2HWWA 2YH2A 2XKBA 1BNCA 7MHTA 2P11A 5COQA 1AB5A 2UAGA 5ALOA 4ZK2A 3KVVA 1UR5A 3COYA 1NF9A 4WTOA 3DAPA 2AOUA 2PIDA 1QNFA 2XVZA 1XAGA 2X8JA 3NC0C 4UHKA 3GFFA 1E69A 3GIDA 2P0AA 3TS1A 2W37A 4FU0A 3LCMA 4FVTA 5JXJA 3GGPA 4YJKA 1T5HX 5FNZA 1B3BA 3U4GA 3I34X 5A4JA 1D2AA 2GNAA 3LM8A 4LGVA 5FL3A 1YHZA 2OQ2A 3CRW1 4U2EA 4EATA 1N0HA 5NULA 4ZYUA 3QJGA 4PXSA 5JC1A 4GP6A 1GSIA 3P27A 4OM8A 2QP9X 4RF4A 4KDRA 5DTEA 2VPWA 3UMSA 1PZNA 2OZLB 4RTLA 3WGHA 1L8OA 3MUNA 1KK1A 2FZWA 2IHBA 3WYAA 4CEJB 4MRPA 3LT5A 3IR5A 4ZQEA 3DCIA 3EGCA 3BEOA 4PPFA 3W7BA 1E0AA 1MJ5A 2Q9BA 5DSTA 1KYXA 4KXUA 3I2IA 2WG1A 1WB9A 4N48A 2QVGA 1T8WA 4WUTA 1HFKA 1NZDA 2C07A 3SIWA 3TW8A 4FUQA 3EHEA 5KTNA 2VJAA 5LIPA 2M6LA 2XXJA 5L45A 2YHAA 1NLFA 2JIBA 1CERA 1GZVA 4QPJC 4MIEA 3KUDA 4B9EA 4Q03A 4F1WA 3U13A 2I5PO 4PLGA 1UP4A 3ZWMA 2JDIA 3QW2A 1SXGA 4L73A 5AM0A 4ZAXA 4BNDA 1E1KA 4DL9A 1H9CA 3G2LA 2GZHA 3DYBA 4X71A 4KVAA 5JCOC 5JH7B 5HA5A 3A7EA 1DO0A 4RIIA 3H0KA 2EL9A 3CV3A 4D26A 1TKCA 1B15A 1KA9H 1XZEA 4ER3A 5IKMA 4AY2A 4BQFA 5E7JA 2J59A 4HTAA 1DBRA 3I01A 3RVSA 3HUUA 2R7AA 4YXWD 2H4FA 2HN9A 4KAJA 3MK31 4DWOA 1CR1A 1PZGA 4XOUA 3RTDA 4OP3A 4IRMA 1TFRA 1C0KA 1A4IA 2WKWA 3IGFA 2XVXA 4IH9A 3WL5A 1JDVA 3QYJA 1E3WB 2JIZA 4P5PA 1PVOA 2B7BA 3M1AA 1IHOA 3PVCA 4FE7A 2I2WA 2RMKA 3AI2A 4G0NA 1MRZA 3DL4A 3LNCA 2AUNA 4R7TA 4C06A 4BGDA 1AK2A 5KZMB 1NNUA 2G1AA 4AP9A 3T5PA 4PZAA 3CY6A 2FPSA 5DLYA 1QG2A 3ONNA 1ECLA 1XWIA 2DPYA 3KLMX 3GWGA 3ULKA 4RLQA 2XRYA 2ZANA 1JIQA 2ADFA 4LHWA 5BY2A 3PEVA 4QOJA 2HV9A 1M33A 3C8MA 1HE4A 1V4BA 2YMPA 3AEKA 3FSGD 5EIBD 4O2BF 5G3ZA 4S24A 4DIBA 1Z63A 4H1UA 5JQGF 3FTPA 1ZITA 2J1LA 3GGOA 5A05A 5IJZA 3L4BC 4C03A 5BW8A 1QUEA 2BC9A 2EW2A 3BMNB 2JZOA 5BXYA 3THWB 1QRRA 4XJSA 5IZCC 4YRQA 1OGIA 2WK1A 3TDMA 3WQHA 2F4NA 5DTIA 4DLLA 1IEVA 4N5IX 1HPLA 4UU8A 4COKA 5L40A 3QE2A 3DZJA 3O8CA 3DGEC 1EAYA 2Z2JA 2AFVA 2VVTA 3E03A 3L18A 3S5JA 1UPCA 2HMTA 2IYTA 3VJKA 4BQEA 1GFZA 3SEZA 1UJ5A 1IATA 4IFIA 3BL8A 5C31A 3ZDQA 4JT8A 5KQMA 2BN4A 1FX0A 1WUJS 2ZUEA 2ODEA 3HRHA 5CB6A 2OHJA 1ZJYA 4Z1OA 4NCBA 1XEXB 1B0UA 2QX7A 4LY3A 4ITVA 4E1AA 3ZDDA 3OT4A 4BFTA 4JC8A 1TO6A 3G02A 3DF7A 1T9GR 3HFSA 1V7PC 4NMWA 2YXPX 5FPPA 1GGNA 2XCRB 3U4QA 3ZGVA 1NQWA 3OY7A 2FE4A 1S4QA 2QYSA 5I51A 3VNVA 2UDPA 4AZ3B 2HA4A 1TF7A 3O2NA 4HRVA 5LJIA 3ZY5A 1XPOA 1JEJA 4DXAA 3JALB 5FFMA 4W6ZA 3LZDA 4H59A 1LLCA 4H3HB 1B0PA 1U04A 3IBSA 2RGAA 1XEWX 3LOPA 5EFZA 4FFDA 1JE1A 1LPSA 4C4ZA 2WSIA 4JVLA 4GXNA 5JSZA 3R5JA 4TSRA 5CLLA 5EXDA 4I1YA 4CLOA 3HDYA 5DIFA 3V1UA 3VM6A 3X1XA 5ULLA 2DGDA 2WAOA 3FLBA 4RH1A 1YVEI 3E9DA 1YRQA 2R47A 3HFRA 1QDLB 3JQFA 1DKUA 4NWIA 4DCSA 2FF5A 1QG0A 1UMDB 2PZFA 3H5TA 5CLFA 1V0JA 3ANNA 4EL5A 1ONPA 2TSYB 4JCCA 1QF9A 2IK8A 2WYHA 3DFZA 3D1VA 3LQFA 3NH9A 3T7AA 3DJYA 4OP1A 3X44A 3TNYA 4KFTA 1Y5NA 1L5LA 1GQOA 5ES4B 4FM9A 1LLUA 1UPXA 4W9NC 4BCDA 2J33A 4RL4A 3K1TA 3BHJA 1TPYA 4IGEA 5D1HA 3IP6A 4G0MA 4EQ6A 3SS9X 1WOYA 2QRQA 4MKIA 4PAGA 5H9WA 3BWYA 2HDHA 4BZQA 3PA6A 1RM4A 3JX9A 3NDBB 3KJFA 1JA1A 4B8ZA 5BOSA 2FK8A 4Z8XA 2J9GA 1Y6FA 2BHTA 2P1DA 3KWJA 1K98A 1TGVA 1IMOA 3C5EA 5HIJA 4R98A 4N12A 3JQ9A 3PIRA 1EWKA 4GPIB 4PONA 3Q40A 2ZJFA 1C4OA 1PFKA 3QQPA 4E88A 2W42A 2HK6A 2HMYB 1FP6A 3S70A 3BXOA 4Z9XA 1U2DA 2BSXA 3ZIAA 1OLUA 4KO1S 5HGJA 1NMYA 1KVQA 4OK5A 4CMAA 3L7NA 4E5NA 3SGLA 2EGHA 3MCAA 4L8VA 1Q7CA 3MNFA 4OU5A 2ZRBA 1GGVA 4JEHA 1N8NA 2PH5A 3O2QB 1D1QA 2O5CA 3TIXB 4MV7A 3STHA 4F3KA 4P81A 2GK6A 2HRQA 1VXOA 5ALSA 3H1FA 3V1NA 4X94A 1RXVA 1HL3A 4JC5A 4HB3A 5CTAA 5HKLA 1U1CA 3MINA 5SY9A 3WLLA 4W7SA 3FGPA 4BPBA 3THRA 1H2BA 3W9YA 3KKZA 3Q8WA 5TGDA 4E4RA 4IHJB 4RTOA 1B93A 4RADA 3WHPA 2EBUA 3MF4A 4JZKA 2X42A 5KJ1A 1IE3A 4NE7A 4JA2A 4TTRA 1EIWA 4NQZA 1TI7A 1AKVA 4IOKA 4B4DA 2Z08A 4BC0A 3R7WB 5KWVA 4IDEA 1QGYA 4RKRA 3P2YA 1NYQA 1IPHA 5AW1A 4D3FA 5KVSA 4JAVC 4RIGA 3W8DA 3OFKA 2W8ZA 1EFDN 3K4QA 3M9WA 1FMJA 1H8HD 1OTYA 4HB2A 3L6BA 4QZVA 1RZRA 4A92A 2EFYA 4EUHA 4YMIA 5C81A 1Z5PA 1C9MA 5AK6A 4YRPA 3SBDA 1P5FA 3LBAA 1UM8A 1F2VA 4XIYA 4UU1A 2WICA 1LI5A 3U2QA 1AGPA 1XMOB 1QG6A 3C3MA 4YCDA 2BFBB 5FKJA 2J8ZA 5DJ5A 1SKYB 4J7XA 4DUZB 2BZSA 3L7CA 3IBGA 2QIPA 4X97A 5HSGA 1FTSA 4CI0B 3C7KA 5B53A 2CCJA 3O8QB 5SICE 1ORWA 2CYBA 4MRSA 5F73A 3G89A 5IC5A 3V2UA 2PX5A 4MJ7A 3CEPB 1RHKA 4JUAA 3T4PA 4A0SA 1Q12A 4AG3A 4ZVMA 4C08A 4Z6KA 5IH7A 3EGDB 2NZ8A 2C9CA 1Z2AA 4LNUB 1GDHA 1I3CA 2PQ2A 4AF7A 3RHSA 4CKYA 1N2BA 3PGVA 3TLEA 4Q00A 3OLXA 5F5LA 1RFLA 2OPBA 4NOMA 5HKAA 1PNTA 3RFVA 2C8JA 1G2QA 2WZBA 3AEZA 1U1FA 3PDIA 1DNPA 2DTXA 2VK1A 3LIIA 4MUMA 1D4OA 1KEPA 3X1ZA 1MMFB 2IV7A 4Z9AA 2A9OA 2NAPA 5DCUA 1H6AA 5BVHA 3WB9A 3WJ2A 1J56A 1PVVA 3Q9LA 4QTTB 5LQUA 2VOJA 5BT8A 4PXAA 3AV3A 4BGEA 2W71A 3U3RA 4IMPA 5H3HA 3U1BA 4XYEA 4PTZA 5CGQB 2QPAA 1OILA 3PHJA 3GZNA 1DT3A 5DIZA 4B6EA 2PJDA 4BB0A 1BN7A 4Z49A 4N3NA 1T3TA 3KEFA 3ZYCA 3VJRA 4R54A 4EPXA 2YY7A 4HDQB 5DNEA 4QODA 3D6UA 1HGXA 3WGMA 3ZDFA 4Y1EA 5I9LA 2I4IA 2ST1A 4ZO8A 1UDRA 3FDXA 4AZSA 2NO4A 4JI6B 4Z1MD 1M75A 2GZRA 5TPZD 4MUYA 2AEMA 1R4NA 3F6CA 1U3FA 3FNFA 4I66A 3WHLA 5KSOA 1T4CA 2RHBA 4BN4A 1JV2B 1ODLA 2PWPA 1E79A 2V97A 3G9ZA 4QKQA 5DM0A 4XM0A 4ZQGA 3H9BA 1NLMA 1IXKA 4Y2XA 3VR3D 1KS9A 1Y1TA 3I23A 4N5HX 4YECA 5ALXA 3ZV6A 3V4SA 1T0UA 1A8SA 1YJ5A 5FB3A 1FX0B 3KO8A 1M7GA 2GNPA 2NZVG 3I1YA 4L95C 4XFKA 2VNIA 5FOUA 5LPNA 3FPCA 3A1CA 4LBZA 5B2FA 4OMUA 3S2YA 1J25A 4U39A 3VKWA 2Y1WA 1AMOA 2WI8A 2PX0A 4E11A 4ETWA 4L5YA 5C8XA 5JXWA 4HADA 3ROQA 2AG8A 4MP6A 1X2EA 1IM8A 5E1DA 3BRWA 1W6RA 2DWUA 2DWPA 3A8TA 3N8KA 2BHNA 3L8MA 3UYKA 3WQRA 2J6CA 2V65A 4LOLA 2RHMA 2WUVA 3N7UA 4JU9A 1A98A 4HGRA 4MYCA 3W5VA 3MCTA 3BZWA 2Q6KA 2E4XA 5TEWA 7ABPA 3RUPA 3EPHA 2CN1A 1XJ5A 5CA1B 4LRUA 5ALLA 1IN8A 4KIUA 3IEKA 3VHLB 4M98A 3A05A 2P69A 4CN9A 3OE4A 3R4CA 1Z56C 1XZPA 3E3AA 3R0QA 3RS5A 5EA2A 3R41A 1L7EA 1TM4E 4M9QA 1QKKA 3NBFA 2HFJA 3JWEA 3NCHA 2LVBA 1LNZA 3I09A 3KVYA 4N6NA 3NVAA 5J47A 2O1EA 3RVRA 2VN8A 1E7QA 1YULA 1TDJA 1REQB 2YYYA 3HY6A 3I8XA 3KJHA 4Y9SA 4QPPA 1ZAYA 1NLZA 4BU0A 2FV8A 4XEUA 1X9GA 2H57A 1LPNA 3NM4A 1GJRA 3JD1A 4FGKA 4J0IA 1YB2A 4MR7B 4H18A 1G5TA 2WJWA 4EENA 2GCOB 3QTTA 4J1NA 3RSZA 4L2IB 1C2TA 3SSAA 4BZWA 1OZFA 1U3GA 2QMZA 4KLNA 4QHSA 3N87A 3L6DA 3KQMA 3RIEA 2FPXA 3SIXA 4QFDA 2I3BA 1ACLA 3HPQA 4H7KA 5DM60 1ORTA 4RE6A 5L3VA 2CT8A 2C8KA 2YXBA 4NYMR 3F9IA 1G6OA 3EIQA 3UWOA 2R97A 3MAJA 2ZPTX 3O7MA 4RF2A 1MJFA 4HB0A 5JMPA 1WP9A 1GHTA 1CEQA 4JSTA 5TT1A 3CTPA 3NONA 5KNDH 4RQUA 3BDIA 1WW3A 5G1OA 1SC4A 2F3QA 2AIRA 3N2NA 4DSAA 2VDQB 1CB0A 4C7BA 1OBOA 3PJEA 1IL0A 3TO5A 2WSYB 1UBNA 5TMPA 1UDWA 1TTPB 4EB0A 3QX9A 5DP2A 3TZ6A 4OQDA 3IL2A 4I8XA 2QQ0A 1T3ZA 4IVPA 5BYJA 1F12A 5EXXA 3V4LA 4CGZA 3W5CA 1U0HC 3ZIUA 4LECA 3SSNA 2P35A 1LBSA 3PZRA 4BMPB 5HKKD 2CUKA 1FJHA 3SM3A 2WV9A 4D46A 4ZOLF 3UGTA 4O4JF 1TF2A 3BAZA 2JG3A 5F1OA 3ZDYB 3R0IA 3I8OA 3AKEA 3HCOA 4OB6A 1HT3A 4LGYA 1O8BA 3MFYA 4YUWA 4JT9A 5BR4A 4B5LA 3C3KA 2F2TA 1IY2A 2DHRA 3A9CA 4Q7EA 1QCYA 1IRIA 4BEJA 4DR6B 3FWNA 2M32A 3QEMB 2BRUC 1BOOA 1K9VF 1HRKA 1PR0A 4H6WA 3UVEA 4BJ6A 3JQQA 1NHGA 4J91A 1YR2A 2QZ4A 2PGJA 2WM3A 3MGGA 3KT3A 1XQVA 2ZVJA 2J7PD 1Y7LA 1VG0B 2YDXA 3ESBA 3KKOA 4RK7A 3VAZA 4P84A 4UOEA 2HPVA 1JG3A 3PFBA 4F06A 1POWA 1KOJA 1TMKA 1KSGA 4CV3A 4F4IA 5IU6A 2YYSA 3VZQA 5AKYA 1J00A 1JYSA 1MJGM 1QYCA 4F0JA 3PKIA 1S0UA 4UM5A 5CB0A 4S2EA 1YZKA 2JASA 3NGLA 4JY7A 4LY9A 3VR4A 3ND9A 4PAOA 5KIAA 1ZJ4A 3I2JA 1OHHD 3GCZA 4JJ6A 2PCLA 1YDEA 4JBHA 3VDNB 3I52A 2RG7A 3W2FA 3EVAA 1XMSA 3DZIA 1LNQA 3FOWA 4ZU1X 3OETA 1A7JA 5CR9A 5AK3A 1YZNA 1SZDA 1FS4A 3DUWA 1XZ8A 3CZQA 4RJLA 3SC2A 4UARA 4B3FX 1QQAA 1A2KC 1JEEA 4MMZB 4CM4B 1RZ3A 1H2RS 1YJCA 3IOBA 4TMKA 5I7UA 3STXA 4A2PA 4OHVA 5AVJA 2DB3A 4JYCA 4P2BA 4X3CA 4J0GA 1ZOOA 4BE9A 4MW7A 3HA7A 3I9OA 3N2GB 3JWGA 4N3CA 5IBRA 1SVWA 3RANA 1I2AA 4P6VF 3SSMA 3C6ZA 3K94A 4GC9A 3ZU4A 1MD9A 1U9IA 3IA7A 3UJ8A 2HO4A 4BNDB 4ZEWA 5ADWA 1IJBA 1GLVA 3WBKA 5L95A 4WUVA 2W2OA 3RBXA 3QPBA 4BO8A 3L02A 4U00A 1P19A 4JLVA 5DTJA 1JDSA 3QU4A 1QTRA 2P4QA 4ER7A 3HRIA 3QVWA 4OGFA 4BVBA 4RJTA 3PDJA 4MGHA 1Y5LA 1OAOC 3S27A 1R12A 3G5TA 3LKZA 4PVDA 4Q6WA 1ZOPA 1GDTA 4PAWA 2D4HA 2LV8A 2UUPA 3FDJA 3LT4A 4IJUA 4UZEA 5LUAA 3OO1A 3ANXA 4LOAA 2IW1A 4KZPA 1MO5A 5FUQA 4ZCPA 4BWFB 2YJGA 1P2TA 4GS5A 4AZTA 3D2LA 3WMWA 1KK2A 2QE7D 4HXEB 2XE4A 1SEPA 3FMVA 3EC1A 1GPLA 4CLDA 4E08A 1H1TA 3PSAA 2EBHX 2XLCA 3Q0TA 3GPLA 4PPNA 1AXRA 2QTVB 2ZIXB 3AVOA 4O4JB 2ECKA 2WFAA 3HXLA 2EAUA 5D3MB 4BPRA 4WGGA 4DLPA 1JS1X 3R8CA 5BN3A 4ZT3A 3DW3X 3F74A 4TWJA 4PC3A 5K2MA 4Q4CA 1L7RA 4RTJA 2IY9A 1SOVA 2OBLA 1NM5C 3SF8A 3LD9A 4OSPA 1DGQA 4U7HA 2PD6A 3KAPA 1PNQA 4L28A 1YF3A 3TLKA 4C4AA 4Z4QA 1PGNA 3LY8A 2NLOA 1UBHS 1ZXLA 2H1VA 3W1VA 1HDCA 3WB2A 4GGPA 4CV0A 2YJ6A 1SELA 4QPCA 5EPOA 1JSXA 5EKSA 5B7QA 2PWBA 4RGVA 4D56A 2YVKA 3ADBA 1CUIA 2C95A 3JVVA 1B6GA 5KINB 3BWEA 3ISTA 2GRUA 3QVXA 4I4TA 1Y33E 1Y8RB 4C14A 4G1UC 8LDHA 3NALA 4L0QA 2XKKA 3EGIA 5LBTA 5KREA 3CIFA 4B3GA 5KJEA 2BUAA 3QXCA 4L5AA 1NU8A 1KJWA 2E21A 2QRJA 3AKYA 3QEKA 5IDVA 3CNNA 1Z0JA 3KTOA 1QZTA 4OBBA 5EEGA 2C4TA 2A84A 3HBFA 4P4GA 4PZLA 1CK4A 1RR6A 3KB2A 2NV2B 1XEAA 3JASA 5ERXA 1G3MA 5LBIA 1BU5A 1E1CA 5GONB 4E12A 2EFHB 4DIKA 3QH4A 2VT2A 5JBIA 4IO1A 2XNDA 5A4KA 1E7YA 3ZVRA 4RD0A 4JUDX 4MGEA 2WZQA 1BE8A 4LTNA 5KX5B 3PEWA 1R6TA 4FS8A 1SUFA 1V1RA 3P2EA 4QGGA 3VZBA 4ZZ0A 3H04A 5TPWB 1I51A 4QXOA 2AKEA 3B12A 3VV3A 3R7NA 1N57A 1VBFA 1Z25A 4M7PA 2UU9B 3CW9A 1X1EA 4Y2YA 3AF2A 1E2GA 1QIJA 1R9GA 2ODNA 3KLBA 3MWEB 3S1SA 2J0QA 2J7KA 1EFHA 2GZMA 1KO4A 2WMYA 3FN4A 2XRZA 1EFRA 1HK7A 2HSZA 3W2EA 3D3QA 4CCSA 5H5JA 4HNGA 2Z56A 2JAPA 2PGIA 3BMQB 1KMHB 4Y2SA 3TXAA 2JLZA 2XJ9A 3FWZA 5JE8A 1N32B 1Y8AA 5F12A 3LC1O 2QNRA 3TD6A 5HG0A 3SM9A 4GOLD 1O87A 3RPEA 3V4FA 2GT1A 3FTQA 3FUXA 2B5OA 3GXOA 3UO8B 1B8VA 3VVMA 4K3VA 1Z12A 2OA0A 3WOVA 1BDBA 1K1EA 4PYNA 4MVJF 1HOTA 4ND3A 2X7JA 2E7ZA 4LYJA 1ZH6A 3CKYA 2VFAA 2NACA 3SMVA 2V3CC 1V7CA 5A62A 3PA8A 1F8FA 1QRAA 4BNKA 5JCZA 4ZCLA 5EWLB 1QR2A 4YT2A 3BHMA 3UH0A 4AULA 5KX5F 1MIOB 2GAFA 4MV1A 1TMYA 1JE0A 1P7WA 2FVXA 3LRXA 4UAJA 3TQTA 3AKCA 3NNDA 3SDSA 5KYWA 3T1YB 1AX9A 1Y98A 3G85A 4JGBA 1WL8A 3VNQA 4F4JA 2Z3VA 3H1EA 4CNQA 3UKOA 3E18A 3HBNA 4R51A 1AB6A 1L4LA 1HO3A 1XLVA 5LD2C 2D06A 3HJCA 4DLRA 1H5NA 3FMOB 3IILA 4P1ZA 4BX9A 3QKRB 5HQ3B 1G3RA 1AOXA 1A96A 3TOCA 3HB1A 5LIRA 3KXKA 5C1IA 5BSEA 4JOCA 3IRUA 4EX6A 5FUVA 2LCFA 2G4LA 2GB4A 2YOFA 3PCTA 1MT3A 4YV0A 1AKEA 1VYHA 5M34A 4FZRA 2QL5A 2QTVA 2CXSA 1DQNA 2OCGA 3BB4A 2HWYA 4L5CA 1CE8A 3U3OA 1U7XA 1BKYA 1P1FA 4QOSA 4MQ5A 4XVQA 4FEYA 4YLYA 1M74A 4DKXA 3WGVA 1NW6A 1UADA 3GD5A 3P9ZA 5P21A 4G8BA 2I67A 1E9FA 2YFHA 4N0QA 1BCRA 1XMXA 3CZ9A 4R2XA 1XSEA 3K05A 2O8EA 2R2AA 4FZJA 3SX2A 1GIAA 1RC0A 2PX2A 1MEOA 5FLYA 1Q7GA 2A0KA 1MB9A 2ERYA 3WDSA 4B33A 2Q9AA 3OFVA 2FMTA 4XLLA 1CD5A 1EUDA 3GMIA 4HVLA 2EXXA 2QN3A 3X1KA 1I7DA 3IEVA 2HRRA 3TQRA 2B78A 5FUXA 1WUKS 2C29D 2GCGA 2R4QA 3RU9A 1X86B 3W8RA 3FLAA 1Z7GA 4FZVA 4A8HA 1XVTA 3NWEA 1N34B 5AW5A 4I14A 1KI3A 2HMUA 1E60A 4PCVA 1G5RA 4CM4A 2AR9A 1FP2A 3AFOA 5EVCA 3WXBA 1A8HA 4NDNE 4QVKA 1G8MA 2IPAB 4Q7QA 3KCNA 4L9SA 5I48A 1MDBA 1MQAA 3EMBA 4HGZA 5LC1A 2ZYIA 2ZRJA 4WCFC 5JBQA 1C30B 4R4JA 4H4EA 4Q3AA 3T3EA 1U3DA 5AVZA 2R6DA 4K5QA 2C2MA 2MR5A 4OFWA 4OXQA 1WD7A 3MCZA 1YCHA 3JAWA 5MGNA 2VF5X 3KELA 1RE0A 3GJTA 4KQIA 2VOEA 3A4VA 2HPHA 3HI4A 2OC4A 1G9SA 1UMCA 3EBLA 4HWTA 4AP6A 3AM4A 4Z0TA 2O8CB 3H16A 4RDHA 4JU8A 3DEFA 1AHNA 2YJTD 3OJOA 3HY4A 4MHOA 3SDBA 4NU5A 4G4SO 4H7HA 2AOWA 4DVJA 3WAJA 3ABSB 4P4SB 3R1IA 1TX4B 2I4RA 3DKIA 4P7JA 1EE9A 1GL9B 2V98A 5LYJA 3PWSA 3IJPA 2KJQA 3OM0A 3GI1A 4P7BA 5I9IA 3KUXA 5DI3B 1KHHA 3EW9A 3HA3A 4OJKA 5AHOA 3PQCA 1QYDA 5EP4A 2GN0A 1XR3A 2IXBA 3X1JA 3GD7A 2HWXA 4TQAA 3QLVA 2GUWA 2PLWA 4F91B 2WT8A 1GL3A 1VE9A 2WBLC 3HKCB 4B34A 1XHLA 2GFIA 1ZK2A 2Y27A 1P7PA 3CX3A 3M1YA 4GQBA 2ATCA 1X7YB 3V2IA 1OPRA 2Q99A 4LXUA 2Q5EA 2I54A 4L0MA 2XGJA 2VS1A 5COBA 1E89A 2PSDA 2GJ9A 1PBTA 3AJ9A 3NU1A 1DQRA 4Y7CA 3AM1A 2CV0A 3MFQA 3T54A 1PZFA 3FAKA 3ABQB 2D5IA 1FMCA 4RPCA 1BHSA 2BGGA 2VR1A 5I9TA 3A37A 4ZREA 3HR8A 1FPQA 2YIJA 4B3TB 1RMTA 2CEAA 2PKWA 4UHDA 4BQRA 1UC4B 2EKPA 3PL1A 4RVHA 2EJVA 3ROZA 1YQXA 2I62A 3ACCA 4BLWA 1E20A 4YIHA 5LQJA 3EXAA 1RXIA 2QQ5A 4HB4A 4MW5A 3CLHA 5ESWA 3HCEA 3SC4A 1M2VB 1W9HA 5EHXA 4INZA 1X13A 1OBFO 2G63A 4YJ2A 4JHXA 1VECA 5ILOA 3FBGA 3RTGA 3QUBA 3ZQ4A 5CB8A 3FGNA 1YJBA 2I8LA 1EIZA 2DZDA 2FW7A 2HCTA 3BIFA 3BCUA 3NH6A 3V4VB 2C7PA 5SYMA 5IKPA 1PW7A 2IXTA 2VP5A 3IE0A 2WWRA 4I1RA 4IDHA 5T6BA 4C0HA 3CC8A 2R60A 4CCYA 5JVDF 5K99A 3NMUF 4DKJA 3W8FA 3IQEA 4Q24A 4FK8A 4MCIA 4JIGA 1UJMA 3JAMA 4CF3A 1EVYA 1T1IA 5FRDA 3AGQA 3LK7A 3BL5A 3G8YA 4ASUA 1UWLA 2ES4A 1F2UA 1ULUA 3FI0A 3UV3A 4C88A 2A5YB 1VBKA 4CQLA 1REQA 4HFRA 4OB8A 1TEVA 2P9EA 5WRFA 3AQIA 1B14A 1YBHA 3O9MA 2PKXA 5F21A 2Y93A 1LDEA 1RT9A 2A14A 2O2DA 1X6VA 2YDYA 1Y80A 3OLVA 4KO3S 2FZEA 4QFBA 3WGYA 4JKYA 1N2SA 3PC8A 1RSZA 1UAAA 1C4WA 3FPSA 2W11A 3L01A 4MKZA 3GVIA 1YR9A 1EE2A 3FUCA 4XI9A 3LWZA 3U9LA 3PFCA 4WN3A 1KI4A 4PBTA 4O3FA 4ZWNA 2WQ6A 3WICA 4DJAA 1VMKA 3OZGA 3OX4A 4Z99A 3K8QA 2V0NA 2ZUFA 5TLSA 3JRWA 4URUR 3NANA 2X0RA 2FTKE 3U7EB 2VHCA 3HB4X 4LF5B 1LZKA 2D2XA 3E9MA 1EU1A 4AQYB 1X7GA 1BX3A 1GLNA 3PHIA 1ORVA 3IKLA 4GYKA 4UPDA 3VDMA 3B1ZA 2H4JA 3JQGB 1JUDA 2FN4A 3AH8A 3ANYB 2NTJA 3FOBA 1DKOA 2VIIA 4TSKA 1EQ2A 1ZIDA 3FH0A 2SBTA 2W2KA 4F4HA 2VSXA 2ZBUA 4NHEA 2EW1A 3WL8A 5JZOA 3KX2A 4IXNA 3CRMA 3ITEA 1WMEA 3DVSX 4G3XA 1R10A 4MYRA 1OGYA 5HTOA 4KH1A 4BMYA 1KMNA 1R88A 2AYXA 1ZC3A 3CEAA 1DRWA 3VISA 3AGPA 1T0JB 4IV8A 2ZRQA 4BC1A 4JI5B 5COAA 1RQXA 2BDTA 1QAMA 3UQYS 1JTFA 1MHPA 3IV6A 1HF3A 2ZRNA 3RWOA 3AINA 4BNWA 4Z4GA 1KGDA 4DCGA 1QP7A 2EKLA 2IH2A 1SZCA 3F8SA 3ZLUA 2RARA 2IHVA 1Q1EA 4IVNA 3UT5B 4A8PA 3ZJTA 4DSOA 2WSSD 3CMMA 3OKPA 1UFVA 4OU4A 3RRMA 7REQA 2I1VB 2DU8A 1XA3A 4MQLA 3RRBA 4LRSB 2PG3A 1IN7A 5CLHA 1EFPA 1PD0A 1VIDA 3LUCA 4Z7OB 2GAJA 4FWBA 3IQXA 4OHKA 4ZZ1A 4CLRA 3HU2A 2VJYA 4E94A 4TLMB 3OKAA 4U7DA 1G59A 3N7AA 4D99A 5BSTA 2I55A 5EG5A 3BQMB 5A3VA 1ZHOA 4PGFA 4JB3A 3QENA 3A7DA 2V1XA 5C8VA 3E70C 4L5IA 1T5LA 3STVA 2R1VB 3TI9A 3DMYA 2OGSA 3KOMA 1L4HA 2F67A 4TT3A 3UK2A 4MWZA 4ZT4A 2EKQA 1NJ8A 2JLSA 3LXUX 2NUAB 4HNRA 2SNIE 2BD0A 1JVSA 3P26A 5AJWA 5JBNA 4RKWA 1RQLA 2O3SA 3RVQA 1L5VA 1R6VA 1AHPA 4L4SA 2HRBA 4UMVA 3N2EA 4OYRA 4FTWA 3ZWDA 4C43A 4XIGS 5BOSB 2P1RA 5AIBA 5JAIA 5J2TB 2GPYA 1EHIA 1JECA 2YXNA 5EJ4A 3VZPA 3EGEA 3E9QA 4BFZA 1ZIPA 1ZP6A 4UDOA 1JR3E 3NBYC 2ZBPA 2BGUA 4KWEA 4BNYA 4PZUA 4TS1A 5H4GA 4E09A 2P6NA 4KR7A 1GNVA 2GM5A 2ZDHA 3F5FA 4Q4DA 5KCMA 4BL5A 3VC7A 3UBTA 1KVTA 3PQEA 5B64A 2V5AA 1VFNA 2ODAA 1EZ4A 1AQIA 3QELA 1SCAA 1ILWA 2FPRA 2BBSA 1GN8A 2PZ8A 2FK7A 5AOAA 5IPFA 4S1NA 1JFVA 4A8JC 2PQMA 4AJ2A 3FGZA 1AQUA 4DMCA 1GSHA 1P91A 2RHHA 1YQUA 1U2RA 1F1BA 1EFUA 2QRLA 4E03A 9ABPA 1Y4DE 4NDZA 3DT6A 3E2IA 3ZCTA 4GVLA 4IL5A 4K40A 3BICA 4MUGA 3GLFA 2XNJA 3W5SA 4QBIA 1R9MA 5KPJA 3ETCA 1S3GA 2P9YA 2R0QC 1EUZA 2IDMA 2G6BA 1WV1A 3RYCA 5FEUA 3OPQA 4LJSA 1DFIA 1NJSA 2NUPA 4OYYA 2QV7A 4IWNA 3IQFA 5JZVA 4FD3A 1SXPA 1GZ3A 4I8IA 2WB2A 4OHXA 1B3RA 5IT4A 3ZHXA 3QFCA 1CJSA 3RC9A 2RI1A 3R5XA 4G01B 5ENDA 2NQTA 1AVTA 1CETA 2L18A 3HNPA 3PC7A 3K32A 3IIEA 4RVUA 2WF9A 1R5BA 5CXSA 4HQOA 3RGGA 3HEMA 3S29A 5EJ5A 3F73A 1A2QA 1P2BA 2F43B 4KLRA 4G84A 4HWPA 1ESZA 4O5AA 3R7AA 3IC5A 3TPZA 4E2YA 2VI5A 2XEDA 3N8HA 3AO0B 3ZDAA 4GDFA 1XDSA 1EWYA 1QV9A 3ITNA 2EHDA 4RD4A 5EMJA 3MELA 2ZRAA 3DE3X 4MWDA 1O6ZA 1PFUA 4QXQA 3CVVA 4LRXA 2ZDGA 1PE0A 3LCRA 1XVUA 2Y77A 3I12A 3LC7O 3D3NA 2VZ8A 3TTTA 1VBNA 2Z9DA 2CZQA 5ALRA 3SICE 4LAFA 1UZNA 2ZRMA 1MTOA 2C2KA 1C4KA 3TBKA 4OHCA 1IUNA 5ECYA 2YRFA 1GGJA 3ILSA 4DNPA 1IHDA 3OOJA 3F1KA 4Z2AA 4YRNA 1MO4A 1NKVA 2OUKA 2PZEA 4JR2A 2FW8A 4MKGA 1P18A 1ZPDA 2IDJA 3GMDA 4RLHA 4BGUA 3VVLA 4DEVA 1P5JA 1P9NA 5FL7A 2QUZA 4ZV4A 1JQKA 3OEWA 1XG5A 4GZ5A 4C01A 4E2XA 3H2YA 4LOHA 5K8JB 1NW3A 1KZ4A 2XD4A 3F49S 4N0PA 5B37A 3JD4A 2WM2A 2VBFA 3TG8A 1KMCA 2WWYA 5H70A 4QT4A 4DQKA 4JJGA 1IXYA 1TM7E 3U3KA 1RPAA 4A6PA 3BQ9A 4QXMA 1VL2A 4FXOA 4UVGA 1TZCA 2A1UA 3SBXA 1SBHA 2TYSB 4FE3A 2R25B 4C3UA 1UOOA 1JIUA 1EA5A 1F6DA 1NF8A 1O95D 1THGA 2ZT7A 3WL4A 3OE7D 2VHJA 2PUEA 4JEIA 4GOXA 1U3VA 2GFHA 4X1YA 3HWSA 1A4XA 2KMLA 3C3PA 4I4TB 3V8RA 4QO8A 2WUDA 4DADA 2P90A 4ZK6A 1DRJA 2CBGA 1Q3KA 2CXTA 2ZJ5A 2LDBA 5K6AC 1EDEA 3IPCA 1GL7A 1FNSA 2JVJA 3QOWA 3WWPA 3ZNPA 1FJGB 1QGAA 2PO5A 3DG9A 3JATA 1KQGA 1NE7A 1NTOA 2B92A 1IHYA 1XP5A 5FA5A 5JO9A 3RF7A 5AW7A 1P74A 2WU8A 1I10A 5BWMA 4NMMA 2R8RA 4YMTA 5JTTA 2F3PA 5FNVB 3X3HA 3T5AA 1RAEA 3SF8B 1Z22A 1OX5A 2VUIB 4LWOA 3RYIB 2P2SA 3TZCA 1G21A 1AGRA 2MDTA 2VXYA 3BDAA 5HIMA 1IZ0A 5JPCA 3L1VA 5LOVF 2QW0X 1R5JA 4TVOA 3I73A 1GFIA 2PBFA 3AEUA 5DK6A 5HM8A 4G1CA 4WCFB 4TV9F 4UTPA 1HDEA 1JDUA 1XEXA 1AO0A 5A5FA 1NXTA 4A10A 4M8IA 2IPMA 1I1QB 3QWIA 2VKQA 3EIXA 5BRNA 5AM2A 4ETMA 4LPKA 4OXXA 4Z7JA 2ZXEA 1A9TA 3UC9A 1T3GA 1GAWA 4F2WA 1GARA 3NDJA 2E4VA 4QDKA 2J45A 2R9VA 1JPJA 1IIRA 4N1AA 4HNHA 3L5KA 1KY2A 5I8ZA 1OWMA 4WK0B 1XAIA 4CZ2A 2R8EA 5HF8A 5J4VA 3FWYA 5L3SA 2GXSA 4EFDA 3ZKAA 2XGOA 3DWGA 3EQ6A 4UZFA 2ISQA 2Y76A 1S1CA 3MTDA 5EJGA 2R4TA 4QYMA 1XDBA 2RC6A 2G5CA 4GRAA 1BMFA 2XA9A 2YWRA 4ME6A 1RKQA 4J16A 4I5GA 2XIJA 1K2WA 4GLJA 4FLEA 3BWMA 3HCCA 2B3TA 3CZ4A 3U7RA 1LEHA 2IU4A 3OHPA 3EAQA 2VHTA 3D5TA 4RVFA 4YUVA 5G0VA 3W1WA 2HCJB 3W77A 3C6YA 5LQRA 2R5NA 1V6CA 1HEIA 2CVPA 3DDSA 2XUOA 2MINA 4EQZA 1WO8A 1SIWA 1G8SA 1Z28A 1YZGA 4YK7A 1CZKA 2REQA 4P8RA 2EEZA 2FU5C 5DOZA 2FWPA 4NOJA 1ENPA 4R16A 4U7GA 5AUPB 5B4VA 2QU7A 3DVAA 4IWYA 5BN4A 2DSNA 2EGUA 1JSCA 1BA2A 2BISA 3H5VA 4GPTA 4WXYB 2HMAA 1JEYA 3EQ2A 3ZZTA 1FDUA 1Z4KA 1BQ3A 4AXBA 1F60A 2J9FA 5D01A 4G37A 2BZ0A 4RV5A 1E3DA 4LSMA 1LPOA 4TLDA 4M54A 4MGIR 1NI4B 1L7OA 1ZD5A 3E3MA 4YHHB 1CWUA 4WLFA 2YC2C 2VZ0A 1D5CA 1KMMA 1BMQA 4TQ9A 4DSUA 4B44A 1E0DA 3FX2A 4HYTA 1R3UA 1Z15A 3EDMA 3FHJA 1WCXA 5J2UB 1ZD2P 2CLSA 5FBHA 1RHJA 3HLKA 2X6RA 4FYIA 5GV8A 5JWHA 2BEUB 2Y1EA 2V7XA 3B85A 1HKHA 1YBVA 2R44A 2NO5A 4GRDA 4MI6A 4Y9RA 3UCEA 1U7OA 1EUYA 3VRHA 4BO1A 2RGYA 4N3BA 1J8VA 4HDMB 3ZW7A 1JKJB 4HQKA 1IZYA 3SZRA 1OLXA 2M1XA 3REQA 1M6WA 4QTZA 1YQDA 3QYPA 5DLEA 4G85A 3ZC3A 1S2OA 3P9QA 3KWMA 3WYCA 4P7GA 4AYTA 3RVOA 1U6KA 3N2KB 3W8NA 2JJMA 5CD1A 1DOHA 2V7WA 1W2WB 4D41A 1NVDA 4TQGA 4A6DA 1T9CA 3CNOA 1TPZA 3MJEA 2Q29A 5GINE 4RIFA 3IT2A 1LFDB 4UHFA 4YJDA 4FYPA 1W59A 1KO1A 4HYQA 1BHJA 4G1VA 2OHOA 4ZHSA 5FYQA 4QU9A 1ZESA 3RJTA 2B8WA 1MG5A 4Q4LA 4TWBA 1KJ8A 2NZYA 1KJNA 5DEOA 1NUTA 4IBOA 5BYKA 2FQXA 1Q1NA 3ROXA 1SJ9A 2QOEA 4F6LA 2WT4A 3IQHX 2GD0A 4RK1A 5ER9A 1KOLA 2XWQA 5EZ6B 4YMUA 1IDN1 2Z57A 3AUAA 3GJ6A 3L7DA 2R1UA 1SCUB 2IGTA 1SHJA 3ADPA 2C98A 3KEQA 3ND8A 4H35A 1UQRA 1U0FA 2BUBA 5T3UA 3VOBA 2CL6X 4MQMA 2QHXA 2ZYGA 3F5DA 1AZTA 1KH3A 1UAGA 2WNHA 4HQ0A 2JAHA 4TX1A 2HJHA 1SBQA 5BN4B 1RHQA 2X0KA 1UIMA 1L7VC 1L6IA 4NRDA 1KF0A 3LP6A 4E5PA 4F84A 4J0FA 3DV9A 2JBHA 2CMFA 2OHHA 2WIAA 2XYRA 3BXGA 3DVQX 3EUWA 3KP1A 4GWGA 4D0NA 1QKJA 2PVSA 3Q1KA 3UGJA 3IV7A 5K20A 5I7VA 2YCLA 1OC4A 4LHXA 4U2FA 5D8DA 3ACDA 1KO8A 2XSZA 5KTTA 3V8VA 2VDWB 2Q49A 4KJZA 3GB9A 5DGDA 5BSWA 1BGVA 1XK7A 1Z8FA 1MOQA 2HX1A 2R7LA 3DEYX 3GVXA 3QUQA 4JBNA 1NXOA 1RQ7A 1U8YA 4L74A 3AHDA 5CXXA 1OFHA 4KDEA 2A0UA 1KYIA 1YT5A 4KE6A 2HHJA 3UGQA 4YDSA 3W05A 3VGJA 4DYHA 4FQ5A 1PRYA 4NEGA 4ENTA 1VJ5A 2Y0PA 2A8YA 2BGRA 2QSYA 1GUYA 2UVDA 3AR4A 1HNNA 2C7RA 3D7RA 1OI7A 5IFKA 1SXJC 1ZR2A 3G5UA 2WTMA 3AJDA 4CM3A 3TOSA 3AILA 5E0KB 4Y7DA 2GXQA 3C7CB 4D81A 2G06A 1KEUA 1C1XA 1C50A 2C0CA 4H7EA 3JQAA 4C89A 3D0KA 1OJ7A 1ZK4A 4V2UA 4OPMA 5T7BA 3N1UA 3IQZA 2ECQA 1XZDA 1XN1A 2XDYA 2ZOSA 3B60A 4DZZA 2YR0A 3E0XA 3ZGXA 2R6CA 3A9VA 3EE6A 3UB2A 1UL1X 1Z5NA 3WO0A 4AT1A 3B3JA 2UYHA 1E63A 1DQZA 1K8YB 4UKDA 4CEIA 2WIJA 3HMQA 3RYIA 2IBSA 1PL7A 3LWNA 3MWFA 3O93A 1XBTA 1YSCA 2J5BA 3ZPXA 4YUXA 4NXMB 1TUBB 2HL6A 2HSEA 3K4HA 5FNVA 3L6UA 1GUAA 3MT8A 1OIWA 1CFZA 4W5TA 3HL0A 2HR1A 2J4FA 3BERA 4C0XA 4MARA 4EF5A 2DH5A 3KQTA 3GDWA 5BVGA 3B3FA 4B74A 1A77A 2Q3CA 4JBYA 5DT9A 3GJ7A 1BU8A 4BNXA 3THXB 2P30A 3KAKA 1Q0ZA 2ZJ4A 5IVDA 3X2EA 4L4ZA 4EJ0A 1K7EB 4B3DA 3SEQA 5CD9A 2JFWA 2VPQA 5FTKA 1X14A 1HQKA 3LOUA 3VNBA 3F7MA 4MVJG 4DB2A 2XWSA 3EQ9A 1T9HA 1MOPA 2ZTVA 3QZUA 4II3A 3TOXA 4G0WA 1C4XA 1Q57A 1IQPA 5IVPA 3MQ4A 3Q5GA 5AVRA 4BKMA 4M9CA 2XH8A 3RFXA 3JQ8B 3OT1A 5IX8A 1MTZA 3KKKA 2WTXA 2QSZA 2GPSA 2BEJA 2EJBA 5IRCD 2BCEA 1YNSA 1LK7A 2XQFA 3OE1A 1I7NA 1NULA 4R6WA 1XCJA 4DUGA 1KZ9A 2FQQA 4BMVA 5AJYA 3EGDA 2WFMA 5CYFA 1Z82A 5L6LB 1X77A 3QMPA 1CUZA 3H0EA 1SOUA 5E38A 3S55A 2Y1GA 1YFJA 2XCUA 2OKGA 1ZNWA 1GNRA 4B8YA 5BOVA 4HH1A 1X0VA 3B1VA 2FSIA 2ZI9A 3LVBA 1U3UA 4FP9A 4G6ZA 3HUTA 4HTFA 3BD6A 4OJYA 3VC3A 1BD3A 1E8NA 3JYPA 1NNLA 3U3DA 4MI9A 4CIDA 4D98A 4I5IA 1GY8A 3H3JA 3SVZA 1HWYA 1V8DA 2PBRA 2PIAA 3V9AA 1IK4A 3EW7A 2X7XA 4YAGA 2IELA 4IDNA 2AI2A 2O2GA 3DGFC 1NONA 3ZLJA 1C14A 4KRXA 4QBTA 4D79A 5BWNA 2OHGA 3QPDA 5GPBA 4HWGA 2Q4BA 3HWWA 1OMOA 1H8ED 1RQRA 2QP3A 1M83A 2NVOA 2JC3A 1L3CA 2FN7A 4JWTA 4NZNA 5CH3A 3SIPA 1BVUA 4YEDA 2VZEA 3GRCA 2MHCA 4W7IA 3UC5A 1JQDA 2W00A 5AKEA 3EVTA 5AKZA 4BMZA 4F04A 3C2QA 1BXRB 1GFWA 1Z4JA 3B7GA 3LLCA 4JP1A 4WI1A 4C7JA 3ZHTA 4W6QA 1QK4A 1UEIA 2QGFA 1U7HA 2HWUA 4NG5A 1S3SA 4IGKA 5GJBA 2GPTA 4S3MA 5C7YA 1X7WA 2A86A 4HS9A 2KPOA 3RSSA 1H2AS 1ZH2A 1FFCA 3OLYA 2PKEA 5AW0A 2KM1A 1JA0A 2GA9A 1NMQA 1U0SY 4JJ8A 3CF0A 2ZATA 1Q0RA 3RJ9A 3NGXA 1JKIA 2XZLA 2YWDA 2ZI7A 4LJ7A 3A6GA 4LF9B 4X1KA 5AKHA 2VDWA 3N0XA 4XFDA 1XDDA 2IS4A 4MO9A 5ELXA 1QKIA 2EWVA 3H7AA 1XKLA 3HKBA 4GD3Q 1Y3FE 4ZV9A 1KSFX 2FFJA 4IEEA 4BYMA 4TWRA 4J2OA 4N8SA 2QRZA 5EZYA 1KNQA 5LB4A 1EJBA 1G41A 1E5QA 3BZUA 1XI2A 3CH5A 4PYLA 1QX4A 4BRWA 3JZDA 3ZCQA 5JNUA 4QE3A 4UEOA 3UMBA 4C6RA 4NBVA 3GP8A 3AUSA 3QWAA 1QS0B 3JWJA 1YFLA 3HWRA 2J3HA 2Q0SA 2G70A 1N2CE 1E2DA 1WNFA 3QI2A 2PD4A 1C29B 5LA6B 2JAWA 3M6LA 5IWAB 1WX1A 3LDHA 4UEWA 4JMLA 1ZKMA 2DFDA 1Z74A 5J5VA 3WNCA 2PZMA 3LQKA 3HDGA 5DISB 3RUHA 2R8BA 2O2YA 2OD2A 2OHVA 4WAUA 5D6OA 3CW2A 4UQOA 1KBOA 3K0FA 1GTSA 2P0EA 4Q18A 3M5WA 3TQCA 3ZWXA 3BRSA 3N76A 1W73A 1CT9A 3SDZA 5L51A 2X5XA 1L4BA 3KDSE 2LZ0A 1LS1A 2GXAA 1ZIXA 3ONWA 1FJXA 2RGBA 1PWZA 1Y34E 1L7MA 2IEAA 5EJMA 1UDCA 1KEEB 1O6CA 1Y3AA 2OYSA 2V6JA 2CNWD 2X4LA 3ED5A 3OICA 3C6QA 2Z9CA 3ZI4A 4BY9E 1JSLA 3BS4A 1YMVA 1YE5A 1UODA 1VJDA 5J2TF 1QIIA 1NW9B 2VSNA 4LZAA 4PZZA 2F6RA 4MS1A 4DMRA 2W6MA 1NFQA 2V7UA 1YU6A 3B8EA 1S3FA 1G6HA 4O1MA 5TVGA 4UNRA 1XCMA 5KYYB 1TTTA 1NNI1 3T95A 3LY9A 3DPIA 4Q66C 4I1SA 2EZUA 1L7AA 2Y66A 1XLTA 1WW2A 2PSEA 4A0QA 4A82A 3UXYA 5J43A 4FWIB 3AVWA 4JODA 4UU7A 4B6QA 3DTVB 2WJ4A 2XT9A 2I80A 1PT6A 3DAOA 4DPLA 4FXPA 2VPTA 1DKRA 4MQUA 1O8CA 1WPXA 5ALWA 4BASA 5IARA 4DIOA 2BEUA 1KK0A 4MPJA 5EHZA 5J2UA 1T5DX 2O8BB 4EHIA 4DM4A 1T24A 2JKZA 2WZCA 3CF4G 1SBTA 3OIWA 3TNDA 1IOLA 2JEOA 4MRNA 5TY0A 1SHUX 4EA8A 1R0SA 2YTZA 1Y7TA 1CQZA 4QNNA 3CCBA 3PU6A 4RTMA 1EBFA 3LPMA 1WBBA 5L53A 3GFBA 1K86A 4F46A 1SCIA 2ADMA 1T6BY 3IVCA 4AMBA 1ZN8A 5AKLA 1OI3A 3LZ6A 4JROA 2HQBA 2CF5A 3GT0A 2E6UX 3G7SA 4EKIA 1EYZA 2X22A 3BM5A 3C1TA 4PINA 4YCJA 3ZBTA 4OD0A 5JAQA 1FXUA 3HYLA 4IVQA 4WBNA 1JVBA 4BLUA 4RBNA 2FKAA 3DFKA 5BUCA 2REQB 3U0BA 4BNIA 1YA6A 1CG6A 4HR7A 4YP0A 3ZJUA 1FQJA 3OT5A 5JT1A 4Q3KA 1MAUA 1YJQA 4G8DA 4N01A 2WU1A 3KYCB 3SEAA 4M1KA 3WGIA 3ES9A 1BVHA 2YN0A 4LJAA 3EMDA 4XYGA 3NETA 5AI4A 4TYNA 3WKEA 1OW3B 1QR6A 1TU3A 3EWSA 3NBAA 3O90A 4QGAA 4S0ZA 2YHIB 2XIQA 3OX2A 4BNVA 4CMIB 4M9UA 3O8OA 1ZVJA 4HUJA 1JQEA 2CNBA 2AMLA 1VFPA 2GF9A 4DQ0A 1E99A 1U2SA 1UXGA 5PNTA 3UK0A 3ZCVA 3A06A 3FPLA 1CQIA 3TKAA 2Y1FA 5L3SB 2YMMA 5KDOA 1C3OB 1FYXA 4LSGA 3LLMA 5DE3A 4ZCQA 3KR2A 1ISIA 1PJ8A 2AXQA 2ZBDA 4HD8A 2ZBQA 1QQ6A 3CW8X 2JK0A 2ZWVA 3CR3C 1MA3A 1YZUA 2I2BA 1ORRA 3FOAA 3IX7A 5KYXA 4FZ5A 3EPPA 3T52A 2HJRA 2PL5A 1XNHA 1C3VA 3IJRA 2QUBA 3CISA 3PVZA 1SVUA 5EKDA 3IUMA 4D8UA 4IDOA 4M6WB 2B8EA 3RYHB 1YONA 3FSRA 3RSOA 1IEWA 3WS7A 5F33A 5BO5A 3KETA 3BD7A 3LX5A 3MIZA 4MULA 1K3UB 1GGEA 2R8YA 5KWEA 2VAWA 3PL5A 2FUEA 5FOWA 1UBFA 4WCFA 1DQSA 3B6KA 3ABRB 1NR1A 3DP9A 1NNEA 5JC8A 1E7RA 3A4IA 5DHFA 4I4TF 1K75A 1XK6A 2A35A 3R0XA 4L1KA 4UVIA 4DWJA 2VHQA 2H00A 2R6FA 4AECA 4ES6A 3FJOA 3PC3A 2ECPA 3ENZA 2G71A 1L7PA 1D2EA 3TRJA 3GELA 4LQLA 3Q11A 5ENZA 3H86A 4J7CA 1HURA 3ELYA 4HGOA 2IOFK 3UICA 3W06A 1N5RA 2FH5B 3H5NA 4IHAA 1SVOA 1NXQA 2M2IA 5D6NA 4DRZA 4Q4JB 4F4UA 3INYA 2LGJA 2PZJA 3HSSA 1F3OA 4UVHA 4A0GA 5GZ3A 1THMA 4HJRA 2P9JA 4ND4A 1TUGA 2HF9A 2QXUA 1TKAA 4GFDA 5JV5A 4DMHA 2O50A 2QT0A 2NIPA 3E7DA 3T4UA 2CJFA 1HZZA 4KCGA 2OESA 3NFRA 1K8RA 4KMOA 3KQYA 3KJEA 1Q95A 1T9ZA 1PQWA 2G1KA 3LOQA 5KWIA 3NBMA 3KJZA 4Q3NA 4Q0MA 4XPZA 1B8NA 1AGYA 1MRNA 1JTVA 2C96A 2DQ4A 1C3XA 2CFRA 3UAWA 3NOVA 3FWHA 4KE8A 4A2CA 1Y4SA 1DIHA 5FBKA 1J22A 2HK9A 2ODWA 3PIDA 4B0PA 1ES9A 2PM8A 3EMKA 2XYVA 3QVLA 4KBGA 5LFAA 1V43A 1VL6A 4ZGWA 3K9WA 5ALYA 1QTNA 1U5AA 4QXAA 5A4FS 5EE0A 2B2XA 1L4NA 1D2NA 2GBIA 2O2IA 2OCIA 3BK1A 3NDRA 4KHZA 4C6TB 1HRDA 1J07A 4WE3A 1U2DC 2JRCA 3K5WA 3DP7A 3QFRA 2OBYA 3E5NA 1WAMA 3M9XA 5HTKA 5EQDA 4EGAA 2NU7A 4BO2A 5DX1A 2QB5A 4XGIA 2VPYA 1T2VA 4IXMA 3T3PB 3NM6B 3DLIA 4G0UA 4K9DA 4PCAA 1ZUNB 5TF4A 1X8KA 4CTJA 4TTSA 4KUGA 4Q1DA 2WKSA 1RI1A 1ISRA 1Z9BA 4CHTA 4DEYA 1OKKD 3MLAA 2HBZA 2JBAA 1PFQA 1KPHA 3M5PA 1RM0A 3NGMA 2J9YB 3AFHA 1CUHA 4MVCA 4C0SA 4KAAA 5EP2A 3INTA 1FJ2A 4ZZ2A 1E1LA 3SZLA 3NPAA 2JIOA 2O8NA 2XB8A 3A27A 2QLJA 3GRYA 4M1TA 4R8VA 5THKA 1JBQA 4YAIA 2WHQA 4Z9FA 3RIHA 1ZO8A 2GARA 3VR4D 4DARA 1CIJA 3GLHA 1Q1QA 2JGLA 3GLQA 3ICCA 1QHHB 3FCEA 4Q7KA 3RSCA 1EUDB 3MWDB 4C0BA 2FEOA 2I66A 2IA5A 2Q6VA 3G2KA 1WNTA 4KAXA 4KV7A 4CDNA 3HBAA 4K9PA 1DKLA 1C9DB 1ULZA 3L4JA 1IU9A 2A5FA 2BGIA 1BXGB 3RVKA 1VRCA 1E2HA 2N46A 1T3SA 2G09A 2I99A 1QC5A 3HFJA 3MZ0A 2FSUA 3L3BA 3ZG6A 4WZAB 4G5OA 4QQFA 1Q74A 2BSQA 2JRLA 3QKUA 2FUNB 3VR6A 3C14C 1VLLA 2XECA 4FFMA 4RQAA 5DLQC 4J0EA 6GPBA 4G5HA 3RAEC 2W6ID 1FNCA 2YXEA 4M0FA 1S9DA 4Q7JB 3THYA 3S8MA 4XEHA 1CE8B 1RHRA 1SURA 4QVGA 2IXEA 1XQ1A 3W3AA 1E66A 5IH3A 4LQ4A 1OVGA 1T8UA 3OURA 2WYVA 1ZXBA 2WPDA 1M2HA 1U2ZA 5DH9A 1ORIA 2XB2A 1E59A 4YXFA 5BQ3A 3FOEC 3EARA 4XX0B 1M2WA 1D09A 4QUBA 4EEZA 5F98A 3DE4X 3IEPA 3CZPA 4YP1A 3IB6A 3GLGB 1A4RA 2IV2X 1OBVA 2VEOA 1MC5A 2AB0A 3T1OA 3UFXA 2Q21A 2DUWA 3C4QA 4MLDA 4DCMA 3P0RA 2IU6A 4FGJA 4PLPA 3UPDA 1M7BA 1S9HA 1TJNA 1RQNA 1TVKB 1NAHA 2GKOA 5LYYA 3VZSA 2GXUA 4D6XA 1S2GA 2G9RA 4AJPA 3NV9A 1S2IA 3ELBA 3LUPA 1JF8A 2A67A 4MWEA 2F4VB 2VHXA 1HE8B 1Y3CE 3QKSA 3BWDD 3OLCX 1DTSA 4RKYA 4FDMA 2JFNA 3QY0A 2YJNA 5HXAA 2IF2A 3K8OE 4RZXA 1CCWA 3N6VA 4OIMA 1IY0A 5EY5B 4BIIA 1MQ9A 1YZHA 1X1BA 3QPAA 3S2EA 3V8NA 5JNVA 3USCS 2F3RA 2FZKA 1M1UA 2NU6A 2OV8A 2P7IA 4PZPA 4C22A 4AD8A 2C5FA 2XCIA 4KMRA 4CDGA 2QN2A 4ROTA 2A88A 2J30A 5J1SB 3HACA 4GZ3A 4UU0A 1SUCA 2AJDA 4YP5A 3EXG1 1PYOA 1WIWA 3BTOA 3SI7A 4YT5A 2VWQA 2D2VA 4OQQA 1LCIA 3NIWA 3GCWA 4UDYX 5DSZA 5B3LA 3STWA 1MR3F 4YJHA 1QHFA 3L7AA 5AI5A 4Z4CA 3BMQA 1JTEA 3ENVA 4MS4B 4B3JA 2UYOA 1KQOA 2BJHA 2GA8A 5KC9A 2ISSD 2ZTMA 3A9WA 3AONB 4IJVA 2BKAA 3SHVA 1VIVA 2JPDA 2CMGA 1JG4A 2P2GA 4FX2A 4NVRA 5HJ2A 3Q5DA 2G04A 1M5UA 5JS7A 5BSUA 3HJNA 4JL5A 5D86A 3SX0A 4ZCTA 4WWHA 4JJAA 1NXVA 4DC0A 1WTAA 1XKXA 2WA2A 3A1DA 2C77A 1CUXA 1DC3A 3WWZA 3ESDA