5LXTB

Tubulin-discodermolide complex
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
428
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structural Basis of Microtubule Stabilization by Discodermolide.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 174
structure length 426
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lxtB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lxtB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lxtB01
5LP6C 3E22B 3N2KA 3ZBQA 2BTQB 2BTOA 3HKDB 4TV8A 5FNVA 4B46A 3HKEA 1FFXA 3UT5B 2VAPA 2VAWA 4ZHQA 3ZBPA 1Z5WA 3N2KB 3JAWA 4IIJB 4ZI7A 5CA1A 3HKDA 4TV8B 4I4TA 5FNVB 3RYIA 2VXYA 4B45A 3RYCB 1W5FA 4O4HA 4ZHQB 3RB8A 2RHJA 3JAWB 1SA0B 4IIJA 4ZI7B 5CA1B 4I4TB 3RYIB 3UT5A 1W5EA 3R4VA 3RYCA 5EIBC 2RHLA 4O4HB 5KMGA 4X1KA 1SA0A 3JAKA 5C8YA 5CA0A 3M89A 5MN4A 5KMGB 4X1KB 1Z5VA 3JAKB 5C8YB 5CA0B 4TUYA 3RYHA 3VPAA 4WBNB 2Q1YA 3VO9A 4TUYB 4U39A 3RYHB 5IJ9B 4O4LB 1TVKA 5ITZB 4WBNA 5JCOA 5LOVA 4E6EA 4YJ2B 2XKAA 5IJ9A 4O4LA 2R6R1 5J2UB 1TVKB 5ITZA 3JALA 5LOVB 3V3TA 4YJ2A 4M8IA 1W59A 5BMVB 5J2TB 5J2UA 4TV9B 3JALB 5BMVA 5J2TA 4TV9A 4IHJB 4X1YA 5MN6A 5EIBD 3JATB 4EI9A 4IHJA 4X1YB 4XCQA 4O2BB 3VO8A 3JATA 3WGLA 4HNAB 4EB6A 4DXDA 4O2AB 4O2BA 3C8LA 4O4IB 4EI7A 4HNAA 4EB6B 3HKBA 3CB2A 4O2AA 5JH7B 1RQ7A 2RHHA 2VAMA 4O4IA 3VOBA 1W5BA 3M8KA 4YJ3A 5LYJA 4O4JA 4ZOLA 3HKBB 1OFUA 3RYFA 3WGKA 2R751 5M7EA 5JH7A 4YJ3B 5LYJB 4O4JB 4ZOLB 3RYFB 5CB4B 5MN5A 4KWEA 1RQ2A 3JASB 5CB4A 5JVDA 2RHOA 5LA6A 5LXTB 5KX5A 1TUBB 3JASA 4I50B 5IYZB 4I55B 5JVDB 4U3JA 5EZYB 2Q1XA 5LA6B 5LXTA 5IJ0B 5KX5B 4FFBA 4X1IB 1TUBA 3JARA 4I50A 5IYZA 4X20B 3ZIDA 4I55A 4U3JB 5EZYA 1W581 5LP6A 4EI8A 4F6RA 5IJ0A 4FFBB 4X1IA 2GVIA 3JARB 3VOAA 4X20A 3N2GA 1RLUA 5JQGA 5LP6B 4DRXA 4F6RB 3WGJA 2XKBA 3WGNA 1W5AA 3HKCB 1JFFA 3N2GB 5JCOC 5JQGB 5EYPA 4LNUA 4DRXB 5GONB 3HKCA 1JFFB 3E22A 5EYPB 3WGMA 2BTQA 4LNUB 1FSZA 5GONA 3HKEB 1FFXB
chains in the Genus database with same CATH superfamily
5AG2A 1ZD4A 1Z38A 3CLUD 3D7LA 4G3XA 1EJ6A 1MZEA 2X8JA 3R3UA 1MHPA 2AUMA 2WVAA 3ILYA 2QTMA 3GLHB 1NWCA 2RI1A 2HOQA 2R72A 1U3LA 2CMGA 3K5WA 2Q7XA 3KSRA 2FOLA 2PZKA 4OH7A 2YWEA 4RNCA 3REOA 1F6BA 3LT2A 2PQMA 4RENA 4ZHQB 2OORC 3PFFA 1WXIA 5FTJA 1UZNA 4XYEA 3USES 4RVNA 1WCIA 4JI4O 3AUUA 3Q9UA 1TL7C 1QB8A 4LDQA 4ZQEA 4KMRA 2DLNA 4ZYWA 4DCGA 5KNLA 1G60A 2XX3A 1UMCB 1PD1A 2RK6A 2LCQA 1P74A 1T2NA 5ALWA 1Y0BA 3OQMA 4RACA 2F3QA 2W2KA 1FJ2A 3F6EX 5FTMA 3RNOA 5T6BA 1OYYA 1Q50A 5EZ5A 2GN2A 3B5EA 5EO3A 5B3JA 1A97A 3ZW7A 3HUUA 1MD9A 3HB0A 3O8NA 2XQFA 4XYMA 1WZ2A 4FM0A 1TA0A 2PR7A 2VA8A 3EHDA 5I7SA 1WPGA 3AHEA 2PWYA 4G5YA 3EBOA 1NBIA 1KIFA 3E82A 2YWRA 2XMRA 5FEMA 2HSDA 2ZWVA 3PDIA 1ILEA 2X6AA 4RESA 2IZ0A 2B9EA 4FGUA 4CIXA 5LWQA 2K4MA 3PD0A 5IT0A 3IIKA 4RY0A 1PD3A 2NO5A 4WT7A 1ULAA 1XHEA 4J2HA 5BSKA 1OB5A 1L5SA 3UB4A 4LZZA 4LSMA 3EPLA 3B89A 5CDFE 3MCQA 1TKBA 2N04A 1NFQA 3DDUA 5ED0A 2QG4A 1SIOA 4JBYA 2H31A 2XMPA 2WQ7A 4UZFA 1KMNA 4CV3A 3P10A 1AKQA 3SDBA 3SIWA 3KQMA 4BX2A 1OI3A 3MCAB 3WRVA 1VSVA 4ASUD 4DARA 4A8JB 4BV8A 3HUEA 4KUHA 4RVHA 4O4IF 4N21A 3WNBA 1LC0A 1FXSA 1TT7A 4O4HF 2P9FA 2YSUB 2ZSFA 4IGIA 1KD1H 1RZRD 1U7TA 1UKAA 1OXKB 1Y8QA 3R0JA 2I4NA 3QEJA 5C1BA 1Y3FE 4RK4A 5FLKA 1DG3A 4QO7A 1BW9B 4NQ3A 4I14A 1W25A 1D0SA 4GR9A 3HGQA 3N0VA 4MAFA 2PWBA 3D6HA 4MO2A 3C90A 3KTOA 5F9HA 3ZRWB 1M83A 4KL1A 1CE8A 2DWOA 4IS2A 3MRSA 3ZHSA 3H9EO 1QNLA 3QPVA 1F8GA 4P5DA 2A0WA 3K1TA 3ZK9A 3JD1A 1JE1A 1QIMA 1ZXLA 5HJ7A 2MQEA 2EP5A 4TSFG 4LY6A 3NBUA 2QTAA 3DMYA 1B14A 1NLMA 2YYYA 5TMDA 3ZHOA 4C0BA 4EQZA 1UDAA 3IPXA 3JASA 4GSKA 4BX3A 3C8ZA 5JS6A 1XRNA 1IJFA 3PFBA 4FYMA 2WBLC 4D8XA 1OA1A 3DO6A 2H0QA 2VKTA 2QDXA 3MCTA 4ZC8A 3K08A 3LYAA 3KSZO 4JU8A 5DTJA 3RUAA 3TW8B 3QELA 4U1RA 1IUPA 3D8CA 2P6NA 2PKCA 3NNDA 4RD6A 3VBEA 1T5OA 1ZOOA 4JTDB 3HMKA 4CMIA 3FTFA 1F9AA 5ALTA 1L4HA 2GLXA 2JJ2D 2OO5C 4JNCA 5BNFA 3WMXA 2X0FA 2HQ1A 3H7IA 2JJ1G 3HWX1 3PDHA 4MVOA 3FOEC 1U7HA 5BQPA 5LXTF 1SVWA 5E4TA 1LY1A 5FWXB 3WWEA 2R5WA 1E2UA 1BG6A 4GT1A 2AMVA 2IY7A 5B1HA 1PUXA 2KWIA 1V25A 2QXTA 5LM3A 4D82A 1M33A 5A6VA 2CB0A 4G27B 5C0OE 1FSZA 2F3RA 3KU1A 1WCWA 5JZSA 3F6YA 4QLOA 1MW8X 1J0CA 1Y7PA 3IT1A 4RA9A 1JVMA 2H8PC 1DAOA 3C74A 3JQBC 3KT6A 4NNOA 1CSEE 3U9LA 4ZK7A 1OC4A 4MB6A 1Q7YW 1W1IA 3WP1B 5CBPA 1XBLA 2XA2A 5IXSA 2H59A 1N6OA 5ECGC 5TT0A 1M6EX 5C4MA 1L9KA 2TYSB 4U9IS 1Y1KE 3FSRA 2Z08A 1M6NA 3Q0EA 4IIVA 4HPJB 2GZLA 3UAZA 2YJ4A 4F4HA 4HLCA 1E20A 3ZWNA 1WEKA 3S8YA 5M2QA 3I3FA 3HJUA 1Q7CA 4DK1A 3IAAA 4MV8A 1C8KA 3T7DA 5JNSA 3UWSA 4MUMA 3SC2A 2ZR9A 1G6HA 3DFZA 5T8KC 1I4WA 4N7RA 4RZUA 1I7SB 2VQFO 5BT8A 4IOMA 5I51A 4MVJI 4ZHVA 3JQDA 4I99A 4MSUA 1O03A 4Z9XA 1BXRA 2GM9A 3R75A 5K8CA 1EZ4A 3R24A 1LNSA 4XFJA 2Q7HA 3O84A 4TTQA 2PJZA 5JAZA 1EM6A 1P6UA 1SBYA 3VPXA 2FDCA 3SEQA 4UNIA 2J0UB 2ZTUA 2I80A 3MJRA 4JVNA 1UMKA 2OVBA 3MLAA 4FC7A 5DN6A 5DOVA 1H6BA 1H2AS 4I3GA 4ND2A 1ISMA 4MKFA 2H08A 3TWOA 2CK3A 1XQ8A 1U0SY 2V6JA 1LX6A 1YUNA 2PBZA 4O4LF 3QYPA 1RVDA 5K0SA 3WV5A 4ESEA 1FMFA 3AI3A 3O7MA 4G1CA 3SD7A 1NBHA 4UOQA 5M5BA 2O8CA 1GPNA 3ET4A 2X42A 4UU0A 2LCAA 1O9HA 4R6XA 5DI3A 4EEZA 2Q0AA 2IP1A 3HB4X 2PL1A 2JA2A 3KPVA 3WGIA 4ZYZA 3RBAA 4H15A 1IIRA 3CRQA 5K4AA 3KXLA 1RAHA 1XAHA 3N59A 4WNAB 3OHMA 3S8MA 2Z2JA 3WK9A 1ZD2P 1ECBA 1K6JA 1QHSA 4FE4A 3KEQA 2YXNA 4U2EA 4DUZB 1KJ8A 4XVHA 1KAOA 1QH1A 2GAIA 4WZBE 1U7OA 5T4HA 5JYCA 3R41A 5K0EA 5JJNB 5IF3A 1F2VA 3EVNA 1W40A 3JQEA 4FXOA 4WDQA 1LLQA 3NBAA 2ODEA 2NQ2C 3UPDA 5K3OA 3M8KA 1BVRA 1Y6FA 5CNIA 3H01A 5EIHA 4W4KA 5JJJB 4LC1A 5GTDA 1BGXT 3BD9A 4JEMA 4MKIA 1KK0A 3LF2A 3DL7A 4C3OB 3PQ4A 3L70H 1H2KA 2NVOA 2NVUA 1A32A 9MHTA 2X6BA 2PX6A 3Q9LA 4BAZA 2ZAUA 2F8MA 1L1EA 1HEYA 3W90A 4QT4A 1H6CA 2GH1A 5IC4A 1CYEA 3TDKA 4DSUA 4Z1MD 3CRCA 3RFFA 3M4YA 3P0RA 1OX6A 3F4BA 4UBKA 1SUDA 5IYZB 1FA9A 3VI4B 3HYNA 3PF9A 4XDKA 2A78A 3GY0A 5FYQA 3ZUGA 4XD7D 2C1ZA 2F23A 2AJLI 3WL3A 5HHTA 3OWHA 3SC6A 1E1CA 2GJAA 1OXMA 1EHCA 2V7VA 5GIPC 3TZQA 4BNUA 3ZY5A 1NBMG 1MJNA 3DG9A 3TB4A 1CF9A 3BWMA 2G5TA 1GSHA 3GZJA 3P1JA 3G67A 3FR8A 3JSXA 4O33A 3MTQA 4KJXA 3GEEA 1ADJA 2MDTA 2YOHA 2ZODA 2IZ5A 1IH8A 4QUHA 4X8LA 5HP4A 2GM3A 1CULC 1XZMA 3WGMA 1L8AA 3W9BA 4YMUA 1E4EA 4DMFA 3Q85A 4WXHA 4YUZA 3RGBA 1YGYA 1Q91A 1KQSF 1LI4A 1VL5A 5L4NA 4DR1B 1R1BA 1FC0A 4CQMB 2WABA 1R8QA 1DLIA 3T5PA 1BDJA 1ZL2A 4MH0R 4YJKA 4E2YA 1OFHA 3LXUX 4ZKEA 5JUWA 1KYIA 1L5GB 1JDPA 3LP5A 2XNSA 2ZRMA 3UFBA 3OQNA 2E74B 2M6RA 3UICA 5H5NA 5K2MA 4PHHA 4DN6A 4UPEA 5F3WB 5SYMA 4XCVA 4I19A 2DYSC 4ON9A 4B3XA 1FX1A 1K8RA 4CQLB 5IS2A 1ZD1A 1N32O 5LMZA 1SCQA 3OFJA 2K9PA 3M34A 2JK0A 2B0JA 5C8YB 2R00C 4TTJA 4BQIA 1GAJA 2Y77A 1XXHA 4CKWB 4QHSA 4NZZA 3C5HA 4OQPA 5CYGA 2Q1YA 4MS1B 1S2NA 4JI3O 1NUAA 2B36A 3BY6A 3EIWA 4B2LA 5B2EA 2IT1A 2WTMA 4WXYB 3SPXA 1OLUB 2REQB 2YH2A 3EDRA 1JBEA 3GJ0A 3CC2F 3A1FA 1Q81H 4MLPA 4UDYX 3ZZ0A 3TGWA 5EJ5A 1KO7A 1GY8A 4HDOB 3M6MD 1JXOA 2IHUA 4HWTA 3H2SA 4QU5A 3EW9A 5HEKA 4K03A 1NT2B 3ZD9A 4KI0A 5TPWB 2KBFA 2ILMA 2VQ6A 3I9KA 4A0FA 3EXEA 1F51E 1RE0A 3CH7A 2JFWA 1N2EA 2C59A 3CWQA 2HL6A 4YVFA 5BMVA 3A3PA 1IB6A 1WNFA 3KTAB 4P7JA 2G77B 3AZOA 3E8MA 5G1NA 1W36C 1EWTA 3QYFA 3Q6MA 3BXEA 4PLCA 5GZ3A 3ZDDA 2CGOA 4KQWA 5TE9A 3I8OA 4RF3A 4UASA 3NDJA 4EJSB 1VB5A 1TLTA 3WVNA 1NJIH 3E9EA 2IYNA 4TSFD 1DO2A 2C20A 3AYXB 3RAEC 1HNWB 2ZR3A 3WGLA 2ZYRA 5H82A 4BHTA 5KNDH 1F1JA 2ONZA 5AM1A 3G13A 3P71T 3SMQA 4AYXA 1VDZA 3D2BA 3GYQA 1SBTA 1QLNA 4QXAA 2ZCEA 3T41A 2ZXUA 2JLXA 2A6PA 2R6AA 1SZPA 3O91A 4OUDB 2R8RA 2QKSA 3JR7A 2QROA 4DE5A 1SBIA 3C5EA 1Q21A 3OU2A 4DTIA 1LJUA 4Y0AA 2JIOA 2YOFA 4PG4A 2CWJA 1QCZA 1T5BA 1T8UA 3B53X 3EAQA 4MV4A 4XR9A 1Z4QA 3VQTA 1OBCA 4HGOA 1RR6A 2W2VA 4PINA 3GG9A 2D0PB 4Z4GA 1U9ZA 2CF6A 1U3WA 2HV8A 2TSYB 3KALA 1BOOA 3KTFA 4L8FA 2QLBA 4BAYA 1DF4A 1AF4A 1OOEA 4JITA 4XJVA 5FJJA 5A9SB 3FZYA 1BCSA 1CERA 3LHKA 3AY7A 4M3NA 2G1JA 4LWSB 1P9LA 2P0AA 1QIEA 3KQYA 1V43A 4Q9JA 3RUPA 3VZCA 1G7CA 2QZPA 3DMTC 5EJAA 5IU6A 5JADA 2W22A 3HUFA 1UFIA 1ENOA 2RKOA 5DEDA 3MAQA 3JQQA 1BL8A 5LP6B 4GXTA 5DTMA 4NCBA 2K1EA 3AEUA 4LBVA 4NZOA 3SC2B 3H19A 4B84A 4DAEA 5HZHA 2HREA 1Q1GA 2WAXA 4HD8A 4BS9A 4EGSA 1U02A 1LEHA 3EF1A 4LF6O 4LNAA 2H1RA 1NY5A 3F9CA 3KKZA 3W7AA 2H3EA 1JFFB 1NN5A 3H1TA 5L3CA 4JASB 5KCMA 3PICA 4ZV4A 5JANA 4UTVA 1O4VA 1HYGA 1TM4E 2ORWA 2AC2A 3HKEB 3DQZA 3OLYA 5DSXA 3KUDA 3OHSX 3N2KA 2J0EA 2R8BA 1C1HA 4QEKA 4DCSA 1POXA 3GH3A 3AR6A 4YCBA 5JW6A 5E6RA 1Y1TA 5LLTA 1QPZA 1QFSA 5F4ZA 3RSSA 2I9KA 1RRFA 5CRIA 2IPNA 4N82A 5G02A 3R6WA 2DWQA 3T1YB 1SPXA 4N7MA 3U60B 4IBOA 2FG6C 4UXNA 4DKJA 2QRKA 3WPXA 2CVLA 5GONF 3IQZA 1T4DA 2Z04A 3LI2A 1KZYC 2VXBA 3KJXA 4NICA 5DHFA 2W2MA 4DZRA 1U2TA 3RVKA 5JC1A 4Q66C 2OAGA 3C3AA 3PVSA 2X0RA 1IV3A 1FQOA 1SVNA 2C00A 3RVQA 1MJGA 1NRXA 2JL1A 4EOGA 1DCTA 1J09A 1QLWA 1FPMA 2G6TA 3I1FA 3A4IA 4EH1A 1NN1A 3EDCA 1RMTA 3SIXA 4L0MA 4DLLA 5JNTA 5DVZA 4UXJA 1ZH6A 4FPPA 1GU1A 3R3WA 1EEXB 4PXSA 5BVGA 5F9MA 5JZ9A 3VX3A 4TV9F 4PDVA 2I8AA 2Q2VA 3AVQA 3S2IA 1DJMA 1E0AA 3K0HA 1NJGA 4J1QA 4MXDA 5J1TB 2BCEA 4AG5A 3HCBA 1EFPB 4I1OA 3ZEIA 2J87A 4BO8A 1QP4A 4C43A 2AN1A 5DNDA 3ZHUA 1NMSA 4YS6A 2C5BA 3VO1A 5J43A 3ORFA 4IDPA 4DB4A 1PR5A 3FJYA 4FB5A 3O31A 2HO4A 2NXJA 5JDCA 4I0XB 2EIKB 1XYYA 4Y1GA 2HP0B 1KK2A 1W73A 2CK3D 3EDOA 3I5UA 4UVIA 3UKDA 3W8NA 1OCCC 4QJIA 5BOSA 4NUTA 5AP9A 2YC2C 3E9NA 3M70A 4X00A 2EGUA 4KAFA 2Q8NA 3JD4A 3DFUA 4X7PA 3TAUA 3H9UA 3QU2A 5A5EA 3TRKA 2TMDA 3A1CA 1AXEA 3BMCA 2YC0A 2WTBA 4H3KB 4OBXA 4WLFA 1NTRA 5BN4A 2SKCA 1FNNA 4R5HA 1JEQA 1M2WA 1P73A 2BSXA 3W06A 2QTZA 1PEKE 5ITSA 5KQGA 4HS9A 1QGUA 1UP4A 7REQB 4YI3A 4C7JA 3C41J 3A4YA 5EVCA 3THWB 1Y5LA 4L85A 4YRTA 3W79A 4V1CA 2HHAA 1GEGA 1ZQ1A 3CNEA 2RHHA 3K9FC 3V1MA 2XB9A 3TLZA 1I4OA 1U7PA 1VKJA 3CSXA 3PIRA 4F1JA 1Z0SA 3F3KA 2ZWPA 4AN0A 1ZOIA 2HSEA 3E48A 4B4DA 2R7MA 4Y18A 3G0DA 5DZSA 2NP6A 1UANA 4XI9A 1W88A 4UVAA 2PY6A 2P6JA 1I7LA 1UXKA 2EOAA 2IUTA 3D8HA 4MP6A 1NUPA 5LBTA 4ZWNA 4LJ4A 2IV2X 1NVPD 2GPWA 2VLIA 2VLBA 2ZSIA 3MSCA 2P6UA 3BMNB 3B3QA 4B9AA 1PWEA 1R12A 1KIAA 3QKSA 4I50B 4H4CA 3UC9A 5CVCA 2JLYA 4L4UA 2G7ZA 3AK4A 3IE0A 4K6FA 3UM9A 3KQLA 2ZF8A 1MHTA 1VQMV 2GHQA 5BSRA 1CKEA 1J99A 4KQJA 4RVFA 1RDFA 5IJ0A 2JCBA 3KZXA 4TL7A 3ZNOA 5C1DA 4JI5O 3G2NA 3VH3A 3OQBA 3K1YA 1JHUA 3S06A 3B82A 3H5IA 4DRXA 1G5TA 3HJGA 2AR0A 2EIHA 4J91A 1IZ0A 1P29A 1P18A 2XI4A 3RU2A 2OHXA 4DAOA 5EYPA 4AW9A 4QPJA 1WUIS 1IULA 4GYKA 4ZT7A 5JNUA 1P39A 1H2BA 2PIAA 3BL8A 2DUMA 2XMZA 3FCSB 1ZINA 3JXEA 4OQLA 4WKGA 3L41A 2WWRA 1R5BA 1BN6A 3E22B 2H6EA 3ZPXA 3MMXA 2WA1A 3KAPA 2IXEA 4R1TA 4RSMA 1FU7A 4Y0NA 3RSOA 2ZR8A 4W9RA 1JB9A 3T1HB 4KO2S 3SXUB 3SHFA 2VQEO 3WLRA 1O0BA 3IYLW 5CA1A 2X8AA 1ZZGA 5FNVB 2FUNB 3WBBA 1CDEA 3GZTB 3G1UA 3QPWA 3C4QA 4ASUG 4MR7B 3GPCA 4EITA 4YP9A 2CFIA 3A14A 4NBNA 1YU6A 1XV2A 4QGHA 1XZJA 1JJ2U 1R8YA 2CXOA 4L7VA 5FULA 4JUFA 2GNPA 4N6OA 4RPCA 2J5XA 3GRAA 4H33A 3ZXSA 4W7IA 5B1IA 5REQB 3VI6A 4V0MA 3LH5A 1KEUA 2C84A 3PWSA 2ADQB 3BAZA 1I94B 4PQEA 3R9XA 1QFMA 2FCRA 4CKCA 5CA0B 4QVKA 3OTQA 2OV8A 3NVAA 3HQ4O 3LUBA 2VJAA 1TIKA 1WL8A 5K0ZA 4GBGA 2ZW9A 3ANNA 1KSJA 4JB8A 1UQUA 4A73A 2V0GA 1X77A 1NBME 2DWUA 1Z3CA 1WNSA 4RL4A 4LISA 3N7AA 4BWVA 1YS4A 1G7SA 3AFGA 4H31A 2WF8A 2NPIA 3K0FA 4DUGD 3E0XA 4P3OA 1EFPA 3FTCA 5ANRB 1Q6HA 3RC9A 1UBLS 4L0QA 4QU9A 2DXIA 2C83A 3VCZA 1U81A 3MXOA 2CVZA 1WWKA 2IBMA 5BRNA 4HPWA 4B81A 1ITZA 1FTYA 1I4DD 1AXGA 1Z12A 4XGRA 4ETNA 4PVDA 4EKNB 3JATB 1SFRA 1B8VA 1N6KA 1RRGA 2ZSDA 1ZUNA 2ZJ7A 4WINA 5EQDA 1H2XA 1MX9A 3ZRXA 1NBOA 3RVOA 2R62A 4R7GA 3UHOA 4AP5A 4EK9A 5KTYA 1X0VA 2BFFB 1R0KA 3K9WA 3OO0A 3LYLA 4FJ1A 4MVUA 1KORA 1QYDA 2Z5FA 1K5SA 3GNLA 3LDFA 3H6HA 4Y9DA 4DZZA 1NH2B 1JKMA 2ZRCA 1HPLA 2GO7A 1V16A 4PFSA 4X85A 3ZG6A 4ECAA 1AZLA 1MOSA 3THRA 5B55A 1W36D 4ARIA 3ESAA 1ZM7A 3BG5A 3LKBA 2GSMB 521PA 4MZDA 4KC0A 1RWNA 1F14A 3HLTA 4YXWG 4HX2A 4FSXA 4JZKA 3VKVA 3CPQA 3Q87B 2L26A 4TQGA 3SR0A 1Q81W 5CK4A 3Q3EA 4BLQA 4GMFA 4PSAA 4IJ5A 3BA1A 1JRLA 4QARA 5BN5B 4YRJA 5MN5A 1NMYA 1R64A 2QP4A 4KGZA 2JK5C 1R0WA 4QBHA 4NAUA 2PX4A 3EEIA 2CMDA 1SG0A 3FWNA 4BP9A 5IAAA 1TOAA 3GR6A 3I8SA 1RXUA 4OHFA 3WGTA 4ZZ3A 2VNJA 2IYLD 1YC5A 3OZAA 2GBIA 1GN3A 2FP3A 1EH5A 1YR7A 2IZ7A 3GROA 2ZDIA 1XT6A 1RJDA 3C7AA 1C7IA 1KZ1A 4PO9A 1TJPB 3VKFA 2PUEA 2I03A 2V1XA 1Q1AA 1QHIA 1NJIW 5DKFA 2R6ZA 5KHLB 1OFVA 2NV2B 1OXXK 1P61B 3E3NA 4CR7A 1XVUA 4GX5A 3P4EA 2H2WA 2XNHA 2YTZA 3KOOA 4MUBA 5GOTA 1PEAA 1L8LA 5KYGA 1O4WA 1DIRA 2AZTA 2UZ1B 4LJAA 1VG1A 4Q03A 1ZW6A 3NDIA 3UOWA 1VOTA 1AKNA 3F7MA 3ZLTA 3FOCA 3BTOA 1GCUA 3PZRA 2VSNA 5T3UA 2A0XA 1T2AA 5T41A 2TMKA 3AM1A 3IVAA 5SZIA 1JSRA 1E9VA 5KS2A 3N0RA 2GERA 3FPFA 2RARA 3I4CA 1XMXA 2J5BA 3C3YA 3KD3A 3IQFA 3LCUA 3KQPA 3DVRX 4FFMA 4PG5A 4AG6A 5B3KA 4TV8B 1LDMA 2QSUA 3AKEA 4TWRA 2Y2UA 4UDXX 3SJBA 3W8RA 4CW7A 2VVTA 3I0MA 3T5CA 2R4UA 2FSHA 2N47A 4PXAA 4AQ7A 4FLMA 1K68A 2QYOA 4TPKA 5IDXA 4TMWA 1A2BA 4BNVA 3ZV5A 2LZ0A 1ADCA 4G4SO 4D96A 2EAUA 4D25A 1NW7A 3O3NB 4KITB 5KHKA 3A27A 4ZVKA 2NXCA 1OVMA 3QVLA 4G88A 3EF3A 4UM7A 5KZMB 3OE7A 1AMUA 2RKWA 2NUBA 5EJ7A 3M82A 4NULA 1SURA 3B12A 5BWNA 3F73A 4RY2A 2X9LA 2OO5A 2EX4A 1QV7A 1NR5A 4G85A 3F7VC 4PWTA 1YQEA 2AN4A 2Y0EA 4PY2A 3S2FA 3SHWA 1QQ5A 3I61A 4BBPA 1EINA 1ZN7A 1M0EA 1E66A 1MNGA 4WSOA 2PO7A 1YJNF 2EBWA 3NHRA 4IKPA 4H77A 5T5QA 4PX3A 1Q14A 1E32A 2B82A 3PZBA 4G1MB 4WGGA 4B2IA 2E21A 2EWWA 5GADl 4XB1A 5AK6A 3GP5A 2Y1KA 4D9KA 1TMOA 3WDSA 1XTKA 2YMMA 1DAIA 2BIFA 3HCAA 3KSAC 1O9GA 2BFDB 2IOHA 5AHKA 4BE4A 4MWOA 5LWHA 3E5RA 4QUAA 5EB0A 5HJ5A 2WWXA 5HKLA 3U7QA 2N48A 3HL0A 3AVOA 3TNLA 4BX8A 4DCUA 3DHVA 4XCQA 2JZOA 1CLUA 2QRPA 3ZV7A 1YVDA 4OH1A 1NQ3A 5K3DA 3QEBZ 2I5PO 3KKNA 1UFVA 2D1FA 2FTKA 2IYEA 3USZA 3VR2D 4D0NA 4NIMA 3I5YA 1BW9A 2AFIB 3DCIA 4V0LA 1RKVA 4KN8A 1PP9H 4BNWA 4CKEB 1I5EA 2OCYC 3U17A 1AMOA 3L4KA 2X41A 4LYAA 2GF2A 1QYRA 4EGCB 2J46A 1FB5A 4BR6A 1ODEA 1CE8B 1E1RD 1TFUA 2Q1WA 1P7PA 1F1BA 4C9BA 3PC8A 4UAUA 4X0EA 3HHEA 3RG8A 9ABPA 3IRUA 1SXQA 1ZRHA 2XWJI 5IAKA 5CDUA 1O89A 3HWUA 2AWOA 2XT6A 3E7XA 3STTA 1MT0A 4G26A 2AGVA 4U7JA 3ER6A 1XNGA 2ES4A 4BT6A 4HZGA 2XAHA 1BDMA 1NVFA 2JCXA 3FG9A 3CLSC 1WVIA 3LS2A 3O1LA 4HQ0A 4HSGA 4KU4A 3UY4A 4AJLA 1N8KA 4DB2A 3AR5A 4DSOA 3A04A 3JQFC 1NYQA 3B78A 3K70B 1N5OX 2MSDB 4BQSA 4ENWA 2VF4X 3DAHA 4MW9A 4DDTA 5LNK6 3LO5A 4FGWA 5IZ4A 3FFMA 1WXFA 3FNIA 4JAAA 1V8BA 5A0TA 4NNPA 3GUZA 1NMEA 2AK3A 2Q5ZA 4UFZA 1DIAA 5IPFA 4X20A 1QAOA 3NC1C 5T7BA 1UBFA 4MLZA 1Z08A 5JEDA 5JBNA 5KX5F 3ER9A 4G84A 4TROA 4NTXA 1EN6A 1IN4A 3GVCA 4B8WA 3T5DA 1L7PA 3ELCA 1NP3A 3R5SA 3TW0A 4HVLA 5A5VA 5HOQA 5LQMA 4CDGA 5KOJB 5A0VA 3NATA 3UJPA 2FQYA 3Q40A 1YWGO 1ZA2A 2ILVA 3LT5A 4A8PA 5EUMA 1RPTA 4Z7OB 1NVVR 5BY1A 4H7IA 4DV3O 4A8HA 5ITVA 1GRNA 1KVQA 4C4WC 1LSUA 2BBTA 2X3YA 4G5QA 4UXHA 3BBLA 3SEZA 1Q95A 3DS8A 3NRCA 3LNNA 4XTCS 2VHJA 5CPBA 4EFNA 1CUHA 4NVRA 4YMSA 3H9BA 1IXMA 3OX4A 3S55A 1J8DA 1X1AA 4J0EA 1Y4SA 2A1TR 5AKLA 2P6MA 4GC9A 3OFNA 3LIIA 1PR3A 2XNDG 4IM7A 3B6JA 5HCUA 5J40A 4CV0A 1QG6A 4U3FH 3DW1X 4HFRA 5FOUA 3BMXA 3KXDA 3MGAA 4EG0A 1ESNA 2OVFA 4JLWA 4L8YA 3LX6A 2JVDA 2ZIMA 4JI2O 4C4SA 1IXSB 3K2EA 1HL3A 1ODIA 2PLRA 1WBDA 1DAGA 4M36A 2YZNA 2D1TA 4H13B 3DQQA 3U7JA 1KQGA 1H1LB 2DFNA 3WWOA 4H0NA 4OFZA 5DV9A 1A8PA 2NU9A 2X2PA 3GPDG 5BPHA 6CHYA 1GKUB 2VYND 3ZBHA 3CUUA 4LECA 1L7NA 3GNTA 4FYXA 4QRIA 2RGWA 4J6EA 1U2PA 5IZCC 1UOQA 4LHYA 3W7SA 3N2EA 4F21A 5LU9A 2OHVA 2RHTA 1X14A 3KS9A 4RIEA 3M2TA 5G0TA 5ALJA 2GDSA 2JJYA 5TT1A 4EL0A 2XMSA 5DEOA 4FHEA 1IN6A 1LW7A 3ZK7A 1YZBA 1KD1W 1BROA 2V7PA 2VTDA 4O02B 5JPDA 4DL9A 1Q74A 3ZWWA 3ZWKA 3TF5A 1PNVA 4YV1A 3C0KA 5JQWA 5EJ4A 2FW0A 4RMIA 5D7NA 1GO3F 1K4YA 2OYRA 1H9AA 3LUKA 1W0JD 1NVTA 2WPNA 3E05A 5DNEA 5BN4B 3WLAA 3WK7A 5J4YA 1ZJWA 3ETHA 5DBGA 1J06A 3HTXA 3SMVA 2P75A 5IKPA 1RHJA 1HDZA 2A1TS 4JAVA 1FNSA 2UXBB 1TM2A 2G25A 3OZBA 4K87A 4O6VA 1LTHR 1WU8A 1NRIA 5JNRA 1NF3A 3PGJA 4ZQBA 1E79A 1P7YA 1RI1A 4D4MA 2IBTA 2AQKA 3W6NA 2I66A 5B1AC 2P8SA 2XZTA 3LA6A 3UB2A 5C2JB 3N2LA 4A03A 2YUAA 2ZK7A 4Q4AA 4RVUA 1ZH2A 2ID8A 2GTPA 4PFJA 1LF0A 2QQEA 2PUVA 1M3SA 4HVAA 4YUVA 3ITKA 2BWJA 4P82A 1WPRA 5H0IA 3EUWA 2VH1A 4IX1A 1RNLA 4DV2B 2M6YA 1F3LA 1TQ8A 3C39A 4G1FA 4IGAA 1XP5A 5EGSA 3A1SA 4LI0A 2P2ZA 4RGQA 3ASYA 1BKDR 4E3WA 3CZMA 3MCWA 1QP0A 3TXSA 2GQ0A 3OT7A 1UWKA 2FPIA 2ZBDA 3G2OA 2HPHA 4Q3AA 1VL1A 2JNWA 1XZQA 1Q82W 4EGFA 5SYAA 3OICA 3A3KA 4JVOA 2Q5LA 1GX1A 1E0KA 4JI7B 3OONA 3L8GA 2ZRFA 2VZ9A 1VHTA 1YS2X 1LBHA 5EMLA 5I9TA 5A1JA 4OX9Y 2DFVA 2AL7A 1T1JA 5KHOC 4NFSA 2ZNJA 2QA4F 4ZOQI 4BT2A 2GF9A 1QP7A 2P5OA 1L5RA 2EFCB 3HCOA 4BPRA 1P7ZA 1EM1A 3D9QX 3EY9A 3HJAA 1DZIA 1PZNA 4MIEA 4OKSA 5AYVA 3W2FA 4TLCA 5T6MA 4ZMSA 3Q3IA 4GNRA 3SJQC 1YJQA 5CFLA 4MR8B 2ACEA 2CUZA 4WZBA 4LDRA 4DV1B 2J6CA 3IAS1 3VTZA 4CQMA 4UV8A 1UJBA 1G8SA 1JPXA 2A84A 2OFWA 2ZYTX 2I7CA 2P7HA 4XQGA 5C18A 2VP0A 3KVRA 1IAQA 3VYWA 1J1ZA 1W0CA 1T5EA 1F2UB 1ZW1A 4U2GA 2W71A 4KNWA 1JZTA 1JYSA 3DTVA 4G5RA 4P7FA 4AZWA 5K45A 2UYCA 2GK7A 2A67A 1YBVA 4CLOA 2P65A 1RJEA 1H93A 1M0TA 3BIJA 2P4HX 3S4YA 3GP8A 3EQ2A 4JLOA 1X7XB 2VWHA 4ZU1X 4AP9A 1O97D 2JGMA 3CEJA 1Y9JA 2O2SA 4CM8B 2I2CA 4ZEOA 2RGXA 4JX8A 1ONOA 3IEKA 2BHSA 1KVRA 2ZR0A 1AKRA 4PZZA 3EC2A 3CNHA 1F8XA 5L95A 1XA0A 1KP3A 4P2BA 4ENVA 1TC2A 2Z09A 1LBQA 1YR8A 2XGSA 3LK7A 1N2CB 1PHPA 4GYYA 4ZAWA 3U39A 2XOXA 2ZUCA 3H86A 3EPKA 2UXDB 5F2EA 4LVNA 3FCXA 3HLYA 1II8A 1PDVA 1V7CA 3QV2A 1UDCA 4DWWA 3NV7A 2ZVZA 1Q3HA 2ODQA 1QK3A 4TXHA 4EFKA 3U4MA 4CCAA 1OU4A 2DF8A 1SQ5A 1ODSA 9GPBA 3D6FA 1Q0HA 1DKUA 2F1OA 1WUKS 4Q5IA 4X9QA 3LZCA 4K9NA 3VH2A 3ZV3A 1P8AA 2XD9A 4K9OA 3GEIA 3H1GA 1TQ6A 5AKXA 1COWG 1U2GA 2WSYB 4ESOA 2CXNA 3GGOA 3LUGA 1FU8A 1JPUA 4FYYA 2DTXA 4Z7JA 4NZNA 2RBEA 3T34A 4EMBA 2OT3B 1I08A 2HI0A 2IYYA 1Z22A 3JWEA 1H4SA 1BO6A 3H1FA 3QVUA 1ZN2A 3AKCA 3Q98A 5TVGA 2D06A 4P3YA 1WP9A 4PAMA 3G80A 4J42A 4ARAA 4AU1A 4BFVA 5IFLA 7GPBA 2ZRLA 4YPVA 2OGZA 4NBWA 4BLOA 4ICGA 2EXXA 2GM5A 3SHOA 4MUIA 1LPNA 2VOJA 3PVZA 5EKUA 1OCRB 3EXAA 4NJEA 1T35A 2QWNB 4NENA 3FKSG 2VQ3A 4BYMA 3BS4A 4H0LB 2WUEA 1N32B 4WECA 3QVNA 2D1QA 3UV3A 1NFFA 1M34B 2HU2A 3ZZ1A 5EWJB 1FTNA 1GPJA 4RTPA 2AJDA 3BF8A 2PL3A 4LK2A 5M7EA 2C31A 2WVJA 3DTUB 2ZBVA 4TKVB 4R54A 1GNRA 1WCYA 1YZHA 1TKCA 3RJ5A 2NU8A 1O9BA 3VUEA 4J3NA 4AO6A 3L72H 4DMCA 4IHKA 4ZOLB 4B08A 1E2LA 3KETA 2QV0A 3WL5A 1GAWA 1X4TA 1XXLA 2EBFX 4B2PA 4UPDA 5ENZA 5FL7G 1DLJA 4PDLA 2UVDA 2XNDD 2RJZA 4FDLA 5CDSA 1S5HC 5LDDC 4PANA 2QMUA 3KL2A 5KPJA 3GRYA 3L1IA 4FOTA 3M6XA 2RDCA 2FZVA 1AXRA 1DQYA 5ALGA 5L45A 4WLUA 4S0XA 4JBWA 1D7OA 4XPIA 3OOWA 4YGXB 2WLIB 4QPKA 1XRMA 3MOSA 4LUCA 2KYRA 4F9EA 1KI1A 1QGED 2FSFA 4KQKA 2C77A 1EFLA 1MZVA 3EA4A 3PGXA 4J8PA 3OH8A 5GV7A 3BWEA 3VDXA 3H16A 4EW1A 4FFBB 1X1EA 2GVIA 1MH9A 2BFNA 5C31A 4C0XA 1P7GA 3UPUA 4C7OB 4FE3A 1X39A 4JB2A 4YI5A 2EBUA 1G8PA 4IQ4A 4TWBA 5JV5A 3EJWA 2Q27A 4MWDA 1IXYA 1CDOA 1C9JA 4WTOA 2FEAA 2GPSA 2ZTSA 5IUJC 1QPBA 4K40A 3BGSA 4NV0A 1GDHA 4ZEVA 4DLNA 2GEJA 4MWSA 2P3QA 4B8ZA 3KYCB 5J59A 4RORA 3V2IA 2EZPA 1OYWA 4X6LA 3VV2A 3K4HA 1V39A 3KQQA 3HADA 3MRVA 1GVNB 2IPLA 3OZ7A 1MNAA 1AQJA 1G63A 4DRYA 4OQXA 3WSTA 1XKLA 1L3IA 4WFJA 4XEUA 3X1ZA 1S7GA 1DV1A 1N8TA 3DDWA 3IGFA 4I3FA 4M22A 3SS9X 1G1XB 3FTEA 3DOUA 5BSWA 1J90A 3ZCVA 1ZUD1 1S96A 1QZTA 1Y1PA 4ALJA 2QMOA 2XCSB 2HYIC 2HJDA 3PRJA 5DYIA 1DBWA 3MIIA 1R4NB 4J9VA 2Y6UA 4Z99A 1SG6A 2CNWD 2UUAB 2CLSA 2YFKA 4CTOA 1RJWA 4WE3A 2HVKC 1N34O 2C2OA 4JU9A 2X5KO 5T4BA 3VR5D 2VS0A 1UJNA 2O8FB 1GAXA 1AO3A 4DW8A 4Z3KA 2GN1A 1XQXA 2AOUB 1GTMA 4PRZA 3H1LH 1BMTA 3AG5A 2JGNA 2QN3A 3FPHA 3OPYB 5BR8B 4B83A 3I9NA 1ZAUA 1H23A 2AXEA 2VPWA 3CNLA 2HCFA 3PS9A 4KGVA 4X3MA 1FRQA 5D86A 3T5GA 2HGSA 2J5RA 3E3MA 3ITNA 1JILA 1RPOA 1Z5GA 1RWKA 2MINA 1FQWA 4L7QA 3QWHA 5NLLA 1ZJ4A 2J0UA 4UE6A 2ONJA 1FNBA 1IHOA 2FWAA 3MA0A 1OX5A 4M8IA 3FRIA 3QSGA 1W59A 3CCLV 2C5AA 3CE9A 4RSHA 4BGEA 4BBJA 3PQ2A 1RAEA 4A6DA 4V24A 1XNJA 3GLHE 1JBQA 2EBHX 4GL2A 2IFTA 3NHKA 1MEEA 1WPBA 3JQ8B 4YLEA 4F84A 3AG4B 3KQKA 3ADDA 3THXB 2AFRA 4JGGA 2REOA 4TTRA 4ZV7A 2BGMA 3E4DA 4YAUA 2G9RA 4EO4A 4IHJA 4EHFA 4DBLC 3H04A 1JDBB 4AD8A 4HTFA 1I3KA 3QWAA 1RIIA 2NLOA 3AHHA 3DLPX 2HJFC 3VYTC 1YZUA 3MLBA 1P9WA 2Y66A 3OFVA 3VR4H 5JISA 3ST7A 2WF9A 3JWGA 3MGCA 3CC2V 3ADPA 3N7UA 5AW3A 3AEYA 3J81N 2OFOA 4BW9A 1SJ9A 1ZEJA 1K3TA 2C4KA 2Q6IA 3DEJA 3KQWA 3LUJA 2R00A 2JFYA 5BNZA 2VJLA 3T0FA 4COOA 1IBLO 4G63A 3T7JA 4JYCA 4MEJA 4F0JA 2CUNA 2LPMA 3H3FA 5HUHA 2WWTA 3DULA 2J07A 1I24A 2NV6A 1ZGAA 1ZJYA 5F12A 3VPCA 2B34A 2XQGA 3TZKA 3BKWA 3ADBA 2IBZH 1UAGA 3CCUF 1N0HA 4R4JA 1LV7A 2C2MA 3QKSB 5LUAA 5JSYA 1Y7HA 5H3HA 4LBWA 3TNJA 3O26A 1M6HA 3VZPA 4ARBA 4AWXA 3FYIB 3B3FA 1V8FA 3DGFC 4ZRMA 5ITWA 3KEOA 4OHYA 1LPAB 1OAAA 3L7MA 2OYCA 4AJNA 2PI5A 4X44A 3ZU2A 5IYZA 3PJEA 4FR2A 2CLOB 3RUEA 3EVEA 1DDGA 4LW8A 3SLKA 3OX2A 3H9QA 3R6DA 2UXCO 4RIIA 1LBEA 2Q0XA 1AZSC 2JFZA 2QN1A 1DBFA 1XQ1A 3I52A 3PGA1 4UREA 3DM9B 4D41A 4G65A 4K6HA 1FUUA 3D54D 3JWHA 3NBKA 4P36A 3H17A 1C7JA 4BVFA 2CCGA 1W44A 3QU4A 3GJSA 1O57A 4TQFA 2ZWIA 5EWRA 4HUQB 4WK2B 5DHAA 2AZXA 1EDDA 3CE6A 3MDSA 1YAJA 3M6WA 4WPGA 4IVPA 3C9SA 1PJAA 2V3WA 4DM7A 3ZDXB 4GPIB 4C4RA 1DDOA 1IRXA 2JJQA 2V03A 3AVWA 1I7PA 2XB8A 3SR2C 2EX0A 2XUPA 3BXPA 3KZNA 3PR2B 4KBGA 3EA0A 4Y2PA 1T9AA 2WFMA 1AK1A 5E3IA 2FPPA 3VU9A 1CJSA 4ZVOA 3THYA 1EBOA 2AQIA 2ZM6O 5GW7A 2BM8A 1OJ7A 1AB6A 1JDSA 5L6LB 5CDGA 1WHSB 1JR3D 4YCJA 3G23A 2NSDA 1DNPA 4YXWD 2QZSA 1R5JA 3ETGA 1EWVA 2N46A 2RAUA 2XOKD 4O2BF 5CVVA 5THQA 2OFPA 3QVMA 1OXBB 1W4CA 3DD1A 2JD1A 3FHCB 2OBYA 5FPHA 3ZGXA 1X7ZA 2E4ZA 1SC1A 2A59A 1SDSA 1L4GA 3E8SA 2HMUA 2IU4A 1XKXA 3Q15C 3QLVC 1RCFA 4MEAA 5ETJA 1T9HA 1P2TA 5AKGA 4UTRA 5JASA 4TMZA 1K7CA 3BJMA 4HQNA 621PA 2AOUA 4DV5B 3HO8A 4P5PA 4FIPC 1QKKA 2WIJA 4M37A 2NUTB 3B5JA 4GICA 2IVZA 3M5CA 4D02A 4C2BA 4KO8A 5LIPA 1B26A 3EXHB 3N9IA 1Q0SA 2CDNA 3ERCA 3VO2A 1QVRA 3D6NB 2EIJC 5CLGA 2YOGA 5WRFA 3UPTA 2UU9O 3VZBA 3OEEG 3D1LA 5JZOA 2OT5A 2WYUA 3LWQC 3D4NA 4UQOA 2C9DA 1RD4A 1UI9A 1MTZA 2VJDA 3IJ5A 4FDMA 4FUQA 4ITUA 3RIYA 5DTRA 1PSDA 4JTCB 2QE6A 4XJSA 3V7WA 3QXHA 1T3ZA 1U0TA 2PLAA 4RK1A 3NX4A 1ZR2A 3RKRA 2HJSA 2YNMC 3WG9A 4OLFA 1J5EO 2WZQA 4O2BB 3AT1A 4OAOA 4U7TB 4N5NA 3PEYA 2FOXA 1NJSA 1P2UA 1YQGA 4BO1A 2X8LA 3PXGA 1NN3A 3MWYW 4PRLA 1HUQA 4RM3A 2EYQA 1DO8A 5K4GA 3TGPA 3FWHA 1V8ZA 2QOEA 2WEKA 3BFKA 4V0ME 3BYZA 5L3EA 1CJUC 2JAPA 3NHYA 2PS0A 3MXTA 3ZYZA 4I1YA 2NN4A 3RYFA 2R751 1RYZA 3G85A 1W9MA 3G79A 4HAXA 4OMUA 2ATEA 2MTBA 1H1TA 3AX6A 3C24A 3S7TA 1OLXB 2O8NA 3QTBA 4U7HA 5KOYA 3EPHA 3HRIA 2FZGA 4IINA 5LB4A 1XDDA 2ZRIA 3I2KA 4QFCA 2W6JA 1Q0PA 2EIJB 1JCHA 1IV1A 1SQSA 4PHFA 4URYR 4WASA 1PK7A 3PNMA 2OAQ1 4OGWA 3KVVA 5IG2A 1F4MA 2AKAB 2J3QA 1DTWB 3ONDA 3M3DA 3O8DA 4DHEA 3NHPA 2OIEA 4HVTA 4NQZA 5BORA 1KQFA 3T54A 5IUKC 4EEQA 3AC0A 3FNHA 1H6DA 4UE3S 4B6FA 3TETA 4C5BA 4Z4EA 5DM1A 2FSGA 3HB7A 4QWMA 3LZ6A 4IL6Z 1LV8A 3E9MA 3LCMA 4UTXA 3JYLA 1KDVA 4UBIA 3UBTA 2HA6A 2H5JA 4HDSA 4DT1A 1YBFA 4KX5A 3ZI0A 1L5NA 3B6NA 1U4NA 2WAOA 3NBFA 4CM1A 2EQBA 5CIYA 3M99B 1BMFG 2NAFA 3S5JA 3DZCA 1E89A 2IXGA 1A95A 2ISQA 2G70A 1QAQA 4NTYA 1TM3E 1USGA 3KB2A 3B8MA 5GV8A 3SE7A 4CL0A 1N77A 1XDWA 3PYXA 1NNSA 1RBMA 1ZVMA 2FVYA 2G38A 1DEKA 2IP2A 3IKJA 1JJ2F 1CUYA 2CVQA 3BIOA 2W6IA 2XKJE 3K1JA 2LJ2A 3QXGA 1WN7A 4RAOA 5FV7A 5GIOE 5M3BA 4BT7A 3HFRA 4Z86A 1M54A 2BSAA 4GVXA 2VZLA 3AUKA 1AIPA 3CIFA 2XTZA 2Z8ZA 4QOJA 1H2LA 5F35A 2FMUA 2Z9DA 1JHPA 3ORRA 4FFWA 4FJCC 4N3CA 5J9FA 2IX3A 4M2LA 4IIBA 1OXVA 4EHJA 3T1TA 1H69A 1TZMA 1QYIA 3NRJA 2YYAA 2YIVX 2PYLA 1W5EA 1CNFA 1H2FA 4NMHA 4ZAYA 4L72A 3KJHA 1JLRA 3QXSA 5EKXA 3CBGA 5T64A 3JAKA 3WYNA 1M6VA 4LEIA 4RC9A 2A8YA 2WT8A 5EWLB 3NP7A 2D54A 3LL4A 3ENVA 1GP2A 4CIVA 3ASNC 5IP5A 2V1UA 3V9PA 1II8B 2J7KA 4UU1A 4JQZA 4OREX 4JP8A 3PX3A 4IL5A 1HORA 2VGNA 3I0ZA 1VK3A 1XAJA 4I7EA 1K7XB 3SJZA 5E9QA 3T1QA 1KE1A 1JL3A 2AZDA 2IHVA 2R85A 3KX2A 1I2AA 4N0DA 2OESA 2PX0A 3C4JA 2E4VA 1A9OA 4RLHA 3NPMA 4TL8A 1RIFA 4IVRA 3CLRC 4U7OA 1P0FA 5IASA 2R6R1 4ZCQA 5I01A 3LT0A 4EUSA 2IUEA 4O8CA 4IWNA 3S3XA 2ALEA 1FMJA 2ZB8A 2FV8A 4EEXA 3K0EA 1M1XB 4P35A 1NQWA 3NBYC 4CL8A 3A10A 2DJVA 1LR1A 4KUMA 2ZYIA 1L4YA 5GGYA 1D2HA 3TX2A 1I1QB 2YRFA 3D1JA 5HSGA 2BMWA 5GM1A 4BFSA 3EIFA 3L8YA 3ZMTA 4AJ4A 4XEHA 2X6CA 1VLVA 3LLCA 2ZROA 4KPFC 2J3MA 1P2SA 3CUYA 3GLUA 1WPQA 5HIIA 5EK0A 1GDDA 1RBZA 2R6GA 2ZTMA 1AJEA 1Z2DA 4UNSA 3NNNA 1XEQA 4Q16A 3HA2A 5EXSA 1RLOA 2TMYA 3LPCA 2GV9A 4YWJA 4CKEA 5IX8A 3R3HA 1RQLA 4G1BA 4HADA 1VMGA 4UC0A 1ZPDA 2XA1A 4OXYA 3UZUA 4DSZA 1JTEA 4IV8A 1E62A 5EJGA 1C8VB 3I34X 1UF9A 5HTOA 1PFGA 2DN9A 3KHUA 4LWQA 2NU8B 3WZLA 4NONA 3GT7A 3THWA 2OENG 4MGKR 2CL6X 4YP0A 1C3JA 3ZH2A 1N4DA 5D1HA 4KSYA 5TJHA 2NVUB 4LOIA 1MQ8B 3R5TA 2HKOA 3FR7A 1ZIYA 2WFZA 5B7QA 3WNVA 3EXG1 3RYFB 5JJIA 1KK1A 3DMGA 4LRQA 4BLWA 1TRHA 2Y1DA 4FGZA 2D6FA 2IY9A 4NG4A 2HJ9A 3KPUA 5D3KA 1UDRA 4EVQA 1D4AA 3PNYA 3KZMA 1QG0A 2Y9PB 4H6WA 421PA 1N6LA 4B5CA 1JV2B 3DLIA 4X6UA 2Y68A 3QOFA 4HN9A 1MB0A 2RGEA 3MT9A 5BVHA 3K5OA 2VYCA 2FWNA 4HAWA 4IX9A 5LZ7A 3A06A 3YASA 4F06A 1QRSA 1AN0A 1B15A 1B8UA 3VU3A 2L42A 2XR1A 5EWMA 3A2NA 2NU6A 4I08A 3F5MA 1TYEB 3ORQA 3PNVA 4U0KA 1S1CA 2FW7A 1QRAA 1GZ4A 1OIWA 1PJBA 2WWGA 2E18A 3EBLA 3H5WA 1EVYA 3T2MA 1G1MA 1SVSA 1C8BA 1ZUWA 2KB0A 1I1OA 2NXWA 3QEMA 3UT0A 2X5NA 3IP3A 3ZMZA 3K03A 1C7RA 1NJ5A 1THMA 3IRVA 4PXYA 1Q15A 4R9NA 3B9QA 1KYVA 5C3UA 5CDYA 1G17A 3H0CA 3ZU6A 3TQTA 2BTQA 1V5GA 4IFIA 5TGZA 1Q77A 3THSA 2WHPA 3KPYA 1EJBA 4KR3A 2DQ3A 2KG4A 1X3SA 1CUDA 1I4EB 2V74B 2XF2A 2QAIA 5FP0A 2CDRA 3C3WA 1ZICA 4C4OA 2VAPA 2FFBA 4MQEB 5TQVA 1E3WB 2KSQA 4IYIA 4JGBA 3UV7A 3BRWA 4NJMA 1OPRA 1R3JC 2D2CB 1I6LA 1NLYA 2D3WA 5IWAO 2IDKA 3FPEA 3OTHA 2OCBA 5BXQC 1Y8ZA 3DWEX 3AVPA 4MQFA 4PV1B 4WMLA 4POOA 2Y4TA 2RHGB 3KAKA 4AYTA 2IF0A 1Z2AA 1U5BA 3EDQA 3M4JA 4Z5XA 1N2IA 5G1PA 2QL9A 2C5LA 1P7WA 3CU5A 3KWMA 5FFFA 1T26A 1XVIA 3QQPA 3UOAB 1O95A 4TUYA 2PRJA 3FPIA 2PSEA 4Q1EA 2VTKA 3NBQA 4R05A 4MVJP 2OUIA 3W77A 1E7QA 4PG7A 5B4VA 3R9XB 4QU8A 4TS4A 3KAJA 4UBOA 2V7QD 5ECDA 3DT9A 4A8JC 3FCUB 3C5CA 1LVUA 3B6MA 1V11B 2YFYA 4BWAA 3H2GA 4O59O 3GLGB 3REGA 2XKAA 5LD2B 5B1NA 2XUQA 1XVAA 5HUQA 3K8QA 3QHQA 3QY9A 3LOUA 3X2FA 1X7YB 3T1HO 1H94A 2ZRJA 2GBLC 5AVWA 1HDIA 3H83A 4HAOA 4Y6SA 4BZZA 5K1ZA 4Z2WA 4YY3B 2E4YA 4B3MO 2YHBA 2Z1MA 2XJ9A 4IUCS 3MHTA 4DW0A 3KE8A 1JPVA 2JDID 4RDIA 1N33B 4N8SA 1YUBA 3V34A 4MTOA 1GNLA 1V1RA 4V0SA 4Z1VA 2C4UA 2H5LA 3D6UA 2JVJA 3G5LA 3RU3A 3B09A 3UCEA 2QUZA 1GO1A 3GGJA 1DMRA 2JRIA 3GJ4A 1KF0A 4WV3A 3T6KA 4X60A 1L6IA 3A7EA 4L27A 1SOWA 4RPJA 2XUJA 2Q1SA 1D2EA 2AG6A 3N74A 4KP7A 1M75A 3SZMA 2QT9A 4NG5A 3GT0A 1PZFA 2R97A 5TF0A 2DUJA 3WS7A 1XOUA 4N5HX 4ZD6A 1SHLA 2EWVA 5K0FA 1USKA 4H60A 2VSQA 3CZQA 3PHIA 4O4JB 4EYSA 3K3PA 1IK6A 2ZATA 1Q1EA 2FPMA 1L5WA 2M6SA 2NWQA 3GJQA 2VJCA 3GPIA 3HU5A 1LDBA 4LPKA 2Q2WA 4PTLA 3H5OA 5DGIA 2OBFA 5IBRA 2R0QC 4NPHA 1RWBA 1MB2A 3N8IA 4B0OA 4CVNA 2J45A 4GKJO 3CE2A 1V2HE 4BBAA 1S89A 4BLPA 1U63A 4GFDA 4J49A 5A62A 1J25A 1Z7GA 4BN4A 1HQDA 2JLAA 2ZRNA 2QVCA 4ZHYB 2HA5A 3GEHA 1X80A 4LF7O 1EYZA 4Y9SA 3V6MA 3WQBA 4D9BA 5I9IA 1AHPA 5BVHB 2GM4A 4DLSA 1I0IA 2XUHA 1U90A 2PTHA 2XCQA 3E23A 3NG1A 2WE7A 2C1XA 5B3SB 1AHHA 3L5OA 1GM8A 3RFCA 3G68A 4AG3A 4JASA 4OHZA 1PFWA 1CIJA 2I6UA 2PEZA 3EGXB 4EG7A 3D59A 3BN3A 3C1AA 1R0XA 1QVGU 2FF7A 2OEPA 5EP1A 3TOXA 3WISA 4BASA 3FPJA 5CURA 2QMZA 3ESXA 1ULUA 1GNTA 3GCZA 3HLKA 1G98A 4FOSA 4OOFA 1RJ9B 4ZARA 1JBKA 5K9ZA 2WYOA 4LJSA 2GHIA 3TVDA 4K8RB 1NATA 2C2XA 4M0MA 1JNYA 4I9FA 1UQTA 2A3NA 3I55V 1N5LA 4UB6Z 3OKAA 4E12A 5KYWB 4J4BA 4OHVA 2JAHA 4Q4DA 1V7ZA 3LDTA 4CH5A 2P3SA 3M81A 4HAYA 4NH4A 3L06A 3ZY3A 1GSOA 4EMSA 1VRWA 1E3QA 1NVGA 2A33A 2VUSA 5H02A 3U3XA 4CUJA 2QY6A 2JF0A 2RGUA 2B9ZA 3APQA 1C81A 1G2OA 4BFXA 1KKDA 2GN6A 4I4NA 3U5ZB 1T4CB 5K0TA 4N9QA 1NZDA 1T6NA 1V1JA 1E7KA 1N8SA 1XLTA 1Z62A 2IYXA 3AOEA 3BWVA 3D7KA 2XBUA 3EFOB 4DXAA 2V7QA 2VSOA 3HPLC 4E5MA 3OEEA 2QAJA 2W83A 2OCXA 4BEJA 3K96A 3IJEB 5CDFA 1KVSA 4PWZA 1K6EA 1LLDA 4TS1A 3ZDAA 1M74A 2MMCA 4KO4S 4P34A 5FH9A 5AKZA 4FEEA 4RHEA 5ITZB 2PH7A 1DIBA 2P6YA 1Y82A 5I7OA 3D6VA 3GLVA 1YJCA 4ZCMA 2Q6AA 3BUSA 4H44B 4BB5A 3VUFA 1ZU4A 4P31A 3VV3A 3W5UA 2OTMA 5IDYA 1S9DA 3PQ5A 4HQRA 4UMVA 1FRFS 4TYYA 1TQHA 2GEBA 2B35A 2HSGA 3K53A 4MCHA 4LCUC 1ZH4A 2R9IA 2AE2A 3U44A 2CNWA 3H75A 4JOCA 4CWAA 2VCYA 2ZUSA 3W4JA 3CRRA 1ULSA 4NC9A 3ZCTA 5I7EA 3IMFA 1E9EA 2ILTA 4OAQA 9LDBA 2ERXA 2PV7A 1TUIA 1COZA 3VO8A 1IHPA 4LQLA 1G8JA 3L4BC 3C3KA 1WB9A 1IHYA 3L46A 3LVQE 1ZD9A 4TM8A 5EWJA 3VR4D 4GBED 1C9YA 4RELA 3D01A 3CCSV 1RXWA 3LC2O 1ZOLA 5EN4A 1AKYA 5JHGB 3U37A 4OY3A 4JYPA 4O4IA 1FDUA 2FEOA 2VDKB 4ZZIA 1ESMA 3W7BA 3QQ5A 1KECA 2XXAA 2P78A 1XL4A 2YYZA 3WLJA 3LQQA 4L4ZA 2JK1A 4YAFA 5TQ2A 1FNMA 1D2MA 5A9RA 4QUKA 5C52B 2WD7A 3SJBC 2YC4C 4EYEA 2IZ1A 2ZRQA 3MIZA 3WHIA 3VSEA 2ISSD 4M38A 3V42A 2OMKA 1UBTS 3VFDA 3DO8A 1YULA 5TS3A 2QTGA 4J0CA 3M8AA 3LUTB 1TUBB 2YVKA 3EPPA 5BQ3A 5DYGA 3DVQX 4HH4A 1G4UR 1MPTA 1G21B 3INYA 4Q6WA 2KMLA 4KDEA 4Z9YA 3B77A 4FFBA 2OBBA 2ZLBA 1JJOA 3AUYA 2JFQA 3CXRA 4Q24A 3SJAA 5GAJA 2XSZD 3PJRA 4UCSA 4DT1B 5FPYA 2QD1A 2VYFA 3HV2A 5DCUA 1YB2A 4PQYA 4AZSA 4BVTA 2IM9A 3F4KA 3I2JA 4V0NA 1RFLA 1X80B 4MMZB 4W5WA 2G5GX 2AGAA 1KBQA 1B7GO 3A3OA 5LIRA 3P9RA 2IEIA 4DLTA 5GVRA 3DBVO 1F0KA 4I9WA 5JQGB 2IKSA 1Q7YH 3LK6A 3ZQUA 2QM4A 2PPVA 3L0YA 2R7KA 3JQFA 4OHCA 1D04A 2W58A 5K6RA 2ZRAA 3IUPA 1BRTA 1A5ZA 1MABA 2UYJA 1RJGA 1HT1E 2Q1UA 2H4YA 3RT9A 5JRDS 4MHTA 1BGVA 2IEBA 2WMDA 4FB4A 1XD2A 2E1RA 2ZI9A 4PBSA 1Y7IA 1B6TA 5EJ6A 3EEOA 2WLLA 1I2ZA 3RLFA 5KYYA 4NMLA 1L5FA 3O74A 3QVJA 4TLDA 1QLJA 3SR3A 4KN5A 1VGQA 3VGJA 2OFXA 3KJQA 3PEVA 1AJNA 3OLQA 3WV4A 1MTOA 2HZBA 1NBMD 3AP2A 5KBYA 3GD5A 5TLSA 1FP2A 2GFQA 4JVLA 5CTAA 2HU5A 5CLFA 1K33A 1IG0A 3DEAA 3F67A 4BO3A 3KWJA 4J1TA 4PZ0A 1ZESA 1W2BU 1QHHA 2B0CA 1XTUA 3I04A 4QFMA 2QENA 4B1FA 3VTKA 3VKUA 3M0EA 3S8EA 5KOHB 4DLZA 4M88A 1HE3A 2I2FA 2JD0A 3L7AA 1JXMA 4J7AA 1EK5A 3P4YA 4ZU3A 2B1RA 4B34A 4JUCA 2PNJA 2A5YB 5T4EA 1Q17A 1PT9A 2H2IA 3HNPA 3VR6H 3BDVA 1QGAA 5EJ2A 3K0FB 3ZMUA 1E79G 1Q57A 3QFRA 4X8MA 3KT8A 4ZQGA 2WJ4A 4P4SB 1MJ5A 4MUGA 4TWKA 1Y37A 2H6LA 3A32A 3VTFA 4FLUA 2BZSA 3NWPA 1OKKA 3QUQA 1JIKA 2HWWA 3CX3A 3IS3A 4J29A 3GJTA 1O6GA 3SIUA 3CYQA 1OAOA 5C93A 2BFEA 1T9CA 3KIPA 3RS7A 3BL6A 3U0VA 3DE0X 5J2TA 3K9CA 1C0EA 1R6BX 1AI4A 1OD6A 4TQ9A 4ZICA 2YY5A 5B3SC 4BMDA 4LMPA 4S04A 1FX0A 4OB8A 4YP1A 5CGZA 3OMAB 1BD3A 1N5KA 1NUUA 2C4TA 3K71B 1DCMA 1P2BA 1QAHA 1U65A 2DKOA 1Z34A 1OF1A 3CUKA 3ENZA 1LTQA 3KZKA 4KTTE 1MSDA 1SCDA 2HB6A 3MCAA 3MWGA 4OGKA 1QZ3A 2PN1A 3SYLA 3K9NA 3RSQA 4CKBA 3TOVA 4NF2A 2P77A 3OF3A 1M76A 2M9MA 5ALKA 4MVJE 4UVCA 4REQB 1ATIA 4RJ2A 5CH8A 1QPGA 5JDIA 2YEVB 4TYWA 2Y69B 5ENVA 4L2IB 3LUAA 2IYFA 4KO3S 3TTSA 3DDZX 3DV0A 3FUTA 3CO0S 3COPA 4HY3A 3K9HA 3T35A 4LZLA 4BIMA 2BE7A 3ZGLA 2ZE6A 1SRYA 2OP1A 2OC4A 3DONA 4JAVC 4OV6B 4ZRNA 1KDYA 4BKPA 3V4PB 2VP9A 1HNWO 3LSSA 5G3YA 4FZRA 5GTHZ 4IKOA 3H9JA 1PJQA 2LBPA 5KHGA 1UOOA 1HNNA 1WY5A 1J5XA 4L9WA 1WKCA 4L8JA 2HJRA 3D7RA 3LLMA 3OM0A 5AW9A 4C7BA 2JEUA 4MQBA 3U3OA 4NARA 3Q8LA 1U0RA 1VQOV 4P58A 1V7PC 5ENDA 4GMDA 3RVMA 1MLDA 1KTIA 3BTSA 5H70A 3FDXA 4YRIA 3BHMA 4EUFA 5FRDA 2H1LA 3BRQA 1XMJA 2OCCB 2EKPA 1O87A 3V1KA 5BP7A 3A0RA 4UCVA 2BEVB 1HZJA 2BDUA 1SD2A 4B2YA 1MXFA 2ZI6A 4R0MA 4RKRA 1KMCA 3K4QA 4MLCA 1L5HA 3CXHF 1N5RA 4OIMA 1YITV 3PFGA 3HKCB 1E2PA 2PVCA 4L5YA 1CQWA 3TI7A 3CZPA 4BLTA 4FCWA 3PA6A 3W04A 3M1XA 4P33A 3ZNNA 1QTQA 1CQPA 4Z53A 1EXWA 1S8NA 1ZIXA 1Z68A 2V45A 1FYFA 4UCOA 2PR2A 3NH6A 3BBPA 1XREA 3ZP7A 1ESDA 1ZH0A 4GPAA 2FPOA 3N39C 1CY2A 4I1RA 4B3IA 3E9ZA 3QE4A 4L0CA 2QRQA 5CX4A 5A7FA 5DXJA 3BT7A 2P1RA 3KE1A 4BKQA 2IHYA 3DFMA 2W8ZA 2BE3A 3J7AU 3DE4X 3QOWA 3ZI7A 4DY4A 1H3EA 1ZM4A 3SLRA 2O8BB 1BJKA 3VYVA 3SCZA 5CA0F 1M5TA 1ZM3A 4NMMA 2ZI5A 5HIJA 1E8MA 1LDEA 1J9ZA 5H9VA 4E5NA 3SYAA 2A14A 5KSZA 2WHEA 1L1FA 1PAUA 3BIXA 1N1EA 3FRJA 1XMOB 3CTPA 3WB2A 3CSUA 4AZVA 1WCIB 3V4OA 3TPCA 4ECEA 2WSSG 3GUCA 2JLWA 2QU7A 3IPLA 3H8SA 2PUAA 2CFSA 2JBAA 2Z5GA 3INNA 2YJ3A 3VC1A 2MWMA 2AYXA 2P2DA 3L18A 5FNVF 3UUFA 2QQ0A 2SECE 4XDZA 2OZKA 3HJRA 2M6LA 2YYSA 3SJ7A 1GR1A 2FRDC 3DZIA 3MWEA 1OFUX 4GPEA 4KSBA 2RGNC 4OLJA 2BZGA 3Q88A 4FWIB 3T0GA 5H9CA 2LTAA 3TLKA 3W78A 1BXRB 1Z9BA 2OGWA 4J94A 3SYPA 1C80A 5DEIA 4L3OA 3AEKB 4IVNA 4JUBA 3SF8A 4ZMRA 2PFKA 4J0QA 4MP3A 3HO1A 1USWA 4YALA 4IH1A 5DT9A 2CGNA 3UO8B 1VE9A 3WDMA 5JEEA 2YXZA 1AQIA 2JLQA 3VR6A 1NW8A 4QYXA 1V1RB 1Y6QA 2DHQA 4MSWC 1MAHA 3MTBA 5EJFA 5EAIA 1PR0A 1R6DA 1GPWB 5G4VC 2PF4E 1WVMA 2ODWA 2D74A 3AM4A 1NW6A 4PEVA 3RUCA 3L75H 3TBHA 4EF6A 3GBSA 2FDXA 1ZJZA 5HWSA 1YNOA 4X62B 2JFHA 3GMIA 5AM5A 4BT5A 2B3DA 3AG3C 1G0NA 1KQOA 2AFIA 3B1KA 4ITRC 1R3KC 1L8DA 3T5TA 3LWNA 5DHUA 1TKAA 1N25A 3ICEA 4KQMA 4M8SA 4B3SB 3OW2F 4UMFA 3IC9A 2Q4TA 1VJ5A 2R8PA 4G5SA 1BWSA 4FYWA 1P1KA 4DC0A 1MENA 1V5EA 3C70A 2DERA 1W30A 1YQXA 2RKBA 3EC7A 1E6MA 1GN9A 4FX2A 5IUNC 2VBFA 2WIDA 1ZJ6A 4Y2SA 2BUCA 5FWDA 1E2IA 1XJ0A 2QK4A 4JK3A 5IULC 3K6SA 5DO9A 2CGEA 1UWLA 3VDMA 2WSSA 1XDUA 2DFKB 3FNRA 1XMSA 3CV3A 3MUEA 4G24A 3E61A 3EHEA 4B62A 1H22A 3OJEA 4Y2RA 1AR5A 1B2RA 1RHMA 1ZYUA 2DQYA 2XQIA 3KSMA 4JQOA 4CG2A 2X1VA 3ORYA 1UADA 2SHKA 5B1DA 4BXOB 4KCGA 1S5LZ 1OJLA 1B00A 4GLXA 1U1IA 1HC7A 1NVAA 2EZ8A 2GYVA 2HLNA 1Z0ZA 2P5YA 2C8JA 2Q8PA 3MTGA 4GGPA 4N5MA 5GM2A 3L8DA 2XYPA 4LVCA 4GIBA 5GWXA 4EI8A 4NYIQ 4EW3A 1DINA 3E27A 4DJTA 3VOAA 2AIFA 1OH7A 1JHOA 2R47A 2F1MA 4QIWF 2BEKA 2NUAA 2PX5A 1US6A 4XLTA 3N6RA 1AU9A 1A1SA 3K0TA 3RSCA 1T9BA 4PI2A 2JLRA 2OD9A 1F4PA 4RO0A 3D3QA 3COJA 2JNBA 4CTKA 3N2GB 1DFHA 1DU4A 3CSSA 4JCCA 3LLVA 5FBVB 2V54A 3B1YA 1GL6A 1P3JA 5L3GA 3DEIA 3HCPA 4MWTA 3TGUH 4PQFA 4R3NA 4RJIA 4WOPA 3TLYA 3OTOO 3UK6A 2ZJAA 2H92A 3GELA 2WHRA 4D45A 1HEUA 3H5LA 3GLHA 4FZ5A 5HWEA 1PFKA 1PT7A 1EDZA 3G5UA 2F1IA 5EXDA 1UWCA 3ROMA 5JMPA 3B60A 2W48A 2RNBA 4M9RA 1SESA 3E6AA 5LQDA 1DKQA 5TMPA 4W5OA 3TJMA 3JAWA 4ESHA 2JZCA 2VNHA 4JT2A 1OQAA 1U7WA 6NULA 3NYRA 2NPOA 1KYYA 3VNQA 5B7PA 1W2GA 4AXXA 5CX1A 3R4VA 4HX5A 2C2WA 1Y6XA 2YWBA 1F8UA 3I37X 3I6QA 2Q41A 2F4VO 1D2AA 2GK4A 1GM5A 4OP3A 3SJAC 1DS6A 1N1DA 2XY4A 4Q9HA 5AKYA 5JCZA 3WRYC 1UXHA 3TE6A 4DWJA 3P27A 2GMWA 1K1EA 2H1SA 3E3LA 3L2OB 2UVPB 5HFMA 3MINA 4PS1A 4BLSA 4EPTA 3KYDA 3KC2A 4B7ZA 5BWMA 2UYQA 4MYTA 1IM5A 3MWEB 3O47A 3OT5A 2NT4A 3ZCXA 1WW8A 3K1ZA 4J0KA 3U3JA 1FFEA 3UK0A 4KPEC 1PK9A 4JI1O 4EFBA 2VJYA 2PJUA 4TTTS 1OCZC 1SZCA 1SUFA 3D4BA 2GWRA 5K3EA 2WNIA 3V4LA 1C4OA 4Q9DA 1L4EA 5SICE 1T34A 5DM6V 1W8DA 2BLNA 3E2IA 4G89A 2WU4A 3C5VA 3FPKA 3JVIA 1O96A 3I01M 1QGZA 4IH4A 3RHZA 1A77A 1DKNA 2O2JA 1M56C 4N39A 1ZI9A 2GTSA 2Q5OA 4K28A 3NTVA 2B21A 4F3CA 2FFJA 2WTUA 2B6HA 1CNEA 4C6TA 4Q34A 4M0EA 1XB2A 1DARA 1XUQA 4M6WB 4UTNA 1Z33A 5LQNA 2BZ0A 3FNFA 1ZX3A 5J5AA 4UOZA 1GWNA 5G53C 5JO9A 2VJOA 3FYHA 2VTVA 2O5EA 3AGKA 2VA9A 4EYOA 3FB1A 1R50A 3B8EA 1AHNA 1VPVA 2Z5VA 2ZDGA 3VZDA 1R9JA 2OZBA 5K3AA 2HLDG 4DNXA 3WY9A 1QH1B 3FSJX 4MPJA 4DDKA 1M2NA 1UM9B 1CVRA 5SZKB 4DR5O 2CE4A 2ZIEA 4U8HA 1X0XA 1P9RA 4DV4O 3RVJA 3IKMB 2NTJA 2R1UA 4AULA 1GM7A 3QFHA 2UYHA 2HMWA 3RC3A 3W6UA 1D3AA 1UT5A 1ZL0A 1DTEA 4HGNA 3IBCA 2I3BA 3GBPA 1WCV1 2QTWB 1V3QE 2OD7A 3HR0A 3G4SF 2OM2A 4RA6A 4TX1A 3TR5A 1WB6A 2IEDA 1UJWB 3L7OA 2X1LA 4E5VA 3DGEA 1QR2A 3TFWA 3VQXA 1VZ3A 5BNIA 1EX6A 4C0JA 3W8FA 3JZMA 3PDUA 4FNMA 1WNTA 4QXQA 2YXYA 4Q7MB 5FOVA 2VJNA 4JLAA 2F1HA 3HZHA 5F2KA 1WZEA 3RUFA 3EIEA 3FWKA 5F64A 4DA7A 1ZSNA 5DGTA 2UYNB 4UULA 1SBCA 3JQAD 3OCXA 1JY8A 4HYYA 1KOLA 3TCXB 3TJTA 4IWYA 1YU9A 3V8RA 4OHUA 1DFGA 1PS8A 3WGNA 4IMRA 4CG3A 4RTMA 1HG0A 1DAKA 2PX3A 2UKDA 3QPBA 3D3WB 3NHWA 3PD7A 1VGVA 1I30A 3GRFA 4B3MB 3GZNA 1YJ9V 3TR0A 1PXWA 2Q5IA 3MS4A 5L3QA 3A1DA 4NCAA 1W87A 1LPMA 3OMXA 3P9KA 4H1WA 4HUQA 2RE8A 3TTYA 3DHYA 2HN9A 1EU1A 2PD6A 5LJLA 5BYBA 3KG2A 1MVLA 2C7BA 1RRMA 2I4TA 3DOJA 3DZKA 4UBLA 1F6DA 2XADA 3SOZA 1E4EB 1D1SA 1NXPA 1R0RE 4X8OA 5A1TA 2X2EA 5G3ZA 5KDLA 1WBBA 5J3JA 3GARA 2FSVC 4I4TA 2OZPA 4PGGA 2GCOB 5B5SA 5EE9A 4OBEA 3QUBA 4QTYA 1UMCA 3DT6A 4FLEA 3WYDA 3GFTA 4K7JA 4HQLA 4CR8A 1T29A 4IDNA 3ZQKA 1SHUX 3JVHA 1KDPA 5IK2D 2RGRA 1XZGA 5CX1B 7AT1A 1KQPA 3FYUA 4IFTA 3OA0A 4FMBB 4IIXA 6PFKA 3M84A 3NHFA 4ZREA 3IC5A 4EX7A 1EAMA 4QE9A 1AH2A 2P0YA 3DKRA 1F5SA 2FHSA 1NJFA 4MGEA 3SVZA 3SZOA 5KNDA 4LZPA 5DNYB 3U10A 1G55A 3ZCPA 3PDIB 2ZVJA 4K9DA 1JR2A 1O94C 2B8EA 2VRCA 3LNTA 4ALNA 5A03A 2C9MA 3OUTA 3TLGA 4G8JA 1BEEA 5HZMA 3SQWA 4UBNA 3FJ1A 1C0IA 4I2VA 3GT4A 4BFZA 1GRRA 1WMFA 1WAMA 4GYWA 1DRJA 3H1HH 1ZMTA 1L4KA 2EFJA 1E1QG 3FFWA 5FA5A 3O92A 5J2TB 1FW6A 4NLLA 3UUGA 5TIIA 1WZUA 2QG9A 3NTRA 4I1UA 3AR2A 4E5PA 2WVGA 3CSDA 1K7DA 4MITA 1A8UA 2P4VA 2UUOA 2FYTA 4CZ2A 4TZTA 1DUSA 1KJWA 1WDTA 3CCCA 3MT0A 1K27A 1QLEB 1CIPA 2WF7A 3I3SR 5FL7D 2PDAA 5YASA 3E35A 1QG4A 4ND6A 1X7PA 4J41A 2ZUVA 4YREA 1E2NA 3FVVA 4CH6A 4R8MA 4P7GA 5LQCA 3MJSA 3PLAC 1KBHA 1PJCA 2B30A 4BNTA 1JEQB 1V55B 3PGVA 2HW8A 1DKPA 4AS2A 2ZETA 4ZPJA 3NWEA 3CGGA 4GRDA 2H1OA 1EFKA 1T9GS 4PDMA 5CG1A 5KNBD 3V97A 3HB1A 1VSQA 3ZGVA 1ZAKA 4JSTA 4ED9A 4NYJR 3OUSA 5DLEA 2C78A 3IB3A 2C99A 4XD2A 2O2GA 1J2EA 1NQAO 1TDJA 4HL6A 1H47A 1MQSA 1JZSA 1LZKA 2IXAA 1UBMS 1BH6A 1P1IA 3JTMA 1TAEA 4OBBA 5CJPA 3A0UA 3GEGA 4IIDA 2P6PA 1TD9A 2PMBA 4GX1A 4A91A 3E2EA 5C53B 1JI3A 2AG0A 2VJMA 5JVDB 5HS4A 3A0RB 4PD4F 1NU6A 3F5QA 5HF9A 4L4XA 1QS0B 1F7YA 1M4UA 3TZEA 3D5QA 2CHSA 1PJ4A 3N86A 2HMYB 4FDTA 2FU5C 4YONB 2GD6A 2PT9A 5EMJA 4AURA 1XQ9A 3EEFA 1YBMA 2WG0A 3KKOA 3EGXA 4PO3X 3H3JA 1PFYA 1TGOA 4OYHA 4N3AA 4FR0A 3TGLA 1I9CA 5EMHA 1CCWA 3ISTA 3RA5A 2OL4A 2C3YA 1Q86W 4RU1A 1GZ0A 1CXZB 1D2NA 1VG0B 3B2QA 4DRXB 3FGPA 3M5WA 3EZ6A 4FZ3A 4QATA 4J2OA 4D99A 1I5OA 2K5UA 3OO1A 5C5DA 8ADHA 1TCAA 1ECJA 5EYPB 1DUVG 3W3AA 1GNSA 5ALYA 4YGYA 4B7AA 2V8OA 1JDVA 2ZBRA 3OECA 1BXGB 5A6SB 1ICEA 4CLEA 1B76A 4RO2A 3CB4A 1T5HX 2VDRB 5CBPB 3IAFA 4ZYLA 4CN9A 2HIHA 2Q6VA 4OM8A 2C3UA 3PFWO 2WAAA 3N2KB 4ZI7A 4EJMA 1G3RA 2BM0A 2CN1A 3BXZA 3RFTA 1TEVA 1JR9A 3TLMA 5L3SB 1V9CA 5C7OO 3ND6A 3CCFA 4GLLA 1GN6A 1ZKMA 4GOOD 4I4TB 3B51X 3IULA 1O5IA 4EPRA 4BO0A 1E1QA 3EOAI 3B52X 2A30A 3ZU3A 5C51B 5ELXA 1YCIA 3GFQA 4P2GA 3ZW9A 4N8DA 1CEXA 5GZ1A 1IBCA 2I2AA 2Z5LA 2R9AA 2DW4A 2H3OA 3E9CA 3Q7RA 4G1EB 1P33A 2VRCD 2AOTA 1DJLA 1RYYA 2ALJA 3EGEA 3MJHA 2DP4E 4GRIA 4QT0A 5REQA 3ADOA 4BKRA 5A4DA 1HW7A 3CISA 2XZLA 4Q9LA 1H0HA 4RHCA 4CKCB 4CIDA 2XNKA 3OQPA 5FXMA 3VI3B 2B94A 4D98A 2V5AA 1YJ9F 5FBZA 1ONIA 1GQQA 1K8QA 4KZPA 5HY4A 4OEHA 2YWJA 2A5DA 5K3FA 4FCCA 2D5LA 2ZIGA 3LCJA 3QWFA 4HNQA 4F2GA 2BR3A 3T9DA 3U7HB 5JNLA 3IP5A 2Q3EA 3F8SA 2I2XB 2BF7A 4UUJC 1FEZA 1K86A 1JHMA 1AR4A 4INJA 1PQPA 5DI3B 2ECOA 4EPYA 1GPYA 3E9DA 3F96A 4M0FA 4MNTA 4K6OA 4CFYA 1C8LA 4I0XA 3DLAA 3LPAA 4OQFA 4TZKA 2CLLB 3JAMM 4YRFA 1M0SA 3RG2A 3L0ZA 3CGWA 3F5FA 2IIPA 4WNAA 3VR6D 2MOKA 3FVTA 2AQ8A 3ZR4B 4ER6A 2F8LA 1BVHA 1VQKV 5H2FZ 2ZS8A 4JL8A 2GZDA 1NWHA 2ATVA 4AJ9A 1LNQA 4RF2A 1JMKC 3F5WC 1LJ8A 3S2YA 5IEJA 3UW3A 4MROA 1FS5A 1S8FA 4H0FA 2X22A 4ZK6A 2P2NA 2GCIA 5ALQA 1T0BA 2YCBA 5ILGA 4OLAA 4R6WA 2EWMA 1VQ9V 2DCMA 2GTHA 3DXZA 3G0GA 1EDEA 3ND8A 4NPAA 4AY2A 1M2GA 3GHZA 2LIPA 4YBZA 3VNBA 3HG7A 2Z3YA 1RAIA 4U4AA 4YDSA 4DR5B 3OAAD 3GRVA 1BTOA 4TTVA 4HYOA 1PSWA 1B6RA 1OW3B 1XVVA 2Q2NA 3HCFA 3WHLA 4BMSA 4C1NA 1R37A 2FAXA 4K9MA 4OI2A 2A0YA 2HHHB 1ZMOA 1RQPA 2QHXA 1BS3A 4LSWA 3BWXA 3ZUPA 4C78A 3W1WA 5AW1A 2I3AA 4FD3A 4B4VA 4XWOA 3ENNA 1PV1A 4MGHA 5LA6A 4AQYB 1NQVA 2A9KA 1XRSB 4LDNA 4Q3DA 3NB0A 1DEHA 4QBIA 5GZ6A 3WLFA 4LWSA 1HLFA 3LFHA 4G86A 4BQEA 2CC2A 5EG5A 3R8FA 1Y1LA 5TISZ 2XGJA 4CMAA 2IS6A 3VH4A 1IIBA 3F6MA 1ABEA 1EG2A 4B76A 1II0A 3KYJB 1CB0A 2FWIA 1CQXA 1HI9A 1QS0A 1UBGA 2P2SA 5I9BA 5FUQA 2BF4A 2P9CA 3EZLA 2V7QG 3R3SA 4ZC1A 4LRTB 2ZAOA 3UHAA 3UENA 2PXXA 1FE8A 1C30A 1NUTA 1ZM2A 3H0EA 1XCBA 3AR8A 3MLEA 1F0YA 2XVXA 4QA9A 1M5IA 2WWVD 3NVKI 3DJFA 5CR9A 1HRKA 1F9EA 3NGLA 3VPFA 4GCZA 4OB6A 4CG1A 1XD2B 1W4LA 2DFLA 1EK0A 3LBHA 4HDMA 4YRMA 4P9OA 4LZJA 2VCHA 4YACA 5C8XA 5LYJF 3CCVV 2NNLD 2VK1A 2WQZA 3OZTA 5IDVA 3JCMM 1V54B 3O95A 3SS7X 1J2RA 2QTOA 1XTJA 1KDRA 1U8ZA 1KSFX 3IT3A 5FNZA 2CSXA 2YWDA 3MJEA 4RYDA 3BK2A 1NVVQ 1CK4A 2F4VB 3BD8A 1EIZA 1PTJA 3VVCA 1X92A 1VPWA 1CEYA 2ZYUX 4XSVA 5E7MA 2QLMA 2B99A 3P0ZA 3AL3A 4UAGA 4GZ5A 4Q4HB 1COMA 4FINA 5DHSA 3CMCO 5H68A 1XNRB 1LUWA 1ZKDA 1VQ4V 2V0CA 5FAXA 3RTBA 5AO9A 1S01A 4Q47A 5CCBA 4PI0A 2C04A 1RC1A 3GP3A 5BVGB 2HDNB 3QVKA 2GEVA 1E1NA 2O3JA 3M9WA 3Q8MA 1FVOA 2ASEA 1AQYA 3ZS9A 2WWFA 2GVDC 4DIUA 2IEYA 2C5HA 3FZEA 2X5OA 1WJZA 1Q7GA 3ZWCA 3GIWA 3LBAA 3LDHA 1FXVA 1R4ZA 3KDPA 3QK7A 4WBNA 4NI5A 1P1RA 4X8AA 4M99A 4FM2A 2Q5HA 4DIMA 5LHIA 4M8NE 4PTYA 4R1SA 3KLMX 3STVA 3CEIA 4S1NA 5T3YA 3O4RA 3WDLA 3QU7A 1CS0B 2P9TA 3ZWMA 5JXWA 2BRUA 1ZGJA 3I56F 4HHEA 2FXVA 4EAAA 1ZD3A 1QR8A 2H06A 3KKPA 4AICA 1AO0A 4B35A 4N5LA 1GGJA 2VSXA 1LK5A 4JR0A 3W6ZA 3RC2A 1K7SN 1SOAA 1TM5E 1DV2A 2EJWA 4RVSA 3S3WA 2J3DA 1G4AE 2W6CX 2LXNA 3HFGA 4O8ZA 4OGFA 2O2YA 5BUZA 1KO1A 3ONVA 4PCVA 2MMGA