5TGZA

Crystal structure of the human cannabinoid receptor cb1
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
439
structure length
439
Chain Sequence
GGRGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLAAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDKTYLMFWIGVVSVLLLFIVYAYMYILWKAHSHAVAKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSWEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAIPDQARMDIELAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cannabinoid receptor 1,Flavodoxin,Cannabinoid receptor 1
publication title Crystal Structure of the Human Cannabinoid Receptor CB1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 167
structure length 439
sequence length 439
ec nomenclature
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 5tgzA01
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5tgzA02
2BF4A 3B6IA 3WQJA 3S8FB 4YAOA 3NHUA 2XODA 4LTMA 4QOGA 4GP8B 1OFVA 5H2NA 3NS0A 3L9XA 1FLDA 3ODUA 1FLNA 3UXEA 1M0KA 3DQBA 2I1XA 1P8HA 5B0WA 2QX4A 1UAZA 1QHJA 3HA2A 3U7IA 1PXSA 5JJEA 5H2IA 5DYSA 2FZ5A 1S54A 5B3LA 1CZKA 3NHRA 5G36A 5ITEA 1JGJA 4C76A 2HNBA 3OWHA 4DAJA 5G28A 3NHWA 4IB4A 1H69A 3NFRA 5G53A 4G72B 1QKPA 1GG5A 1R2NA 4J4QA 1AKUA 4QRYA 4DJHA 3LCMA 5FJGA 4XDGA 4BWBA 3OE6A 1XI2A 2M6RA 1X0SA 2FOXA 4LA4A 1BRXA 4BMOB 4GR9A 4FGKA 4G71B 4A4MA 3UONA 2YCZA 5B3KA 1OBVA 4QOFA 1KG9A 5A4KA 4JR8A 1F4PA 4WW3A 1KG8A 3QBLA 1QR2A 3NHJA 4QOJA 4DY4A 1HZXA 3V2WA 4ICIA 5EAIA 1P8IA 3W79A 4TL3A 3G5MA 1E12A 3QAPA 2KLBA 4HS4A 3D7NA 3CAPA 4PXKA 2R97A 3BVDB 3QJUB 3KAPA 2HPYA 1J9EA 3ESXA 1IXFA 2YDOA 4QIDA 5G2DA 4EA3A 1YKGA 1IW6A 1OBOA 4BMPB 2BRDA 5DHGA 3FVWA 4DILA 4LTDA 3D4SA 3FNIA 3KJ6A 4XT1A 5H2KA 1Q5IA 3ZPQA 5LJIA 2X72A 3OJWA 4C0XA 2XOEA 1J9ZA 2I35A 3QFCA 2M3GA 3K20A 4YALA 3VVKA 5A44A 2Y02A 4NLLA 3RZEA 5C1MA 1XMEB 3QJTB 1FTGA 2YDVA 3T45A 3S3DB 5B2NA 3AM6A 4BVNA 3QJQB 2FVXA 1AKRA 2Z9BA 4FAAB 3TZBA 1Q5JA 2Y00A 5JJJA 1FLAA 3F90A 1AG9A 2F93A 5AHYA 1KGBA 3NY9A 1D03A 5FX2A 3HARA 3SN6R 2R4RA 2QPDB 1AKWA 3X3CA 4LTNA 2GSWA 4FPDA 4XT3A 5A45A 2W5UA 4HYJA 2I20A 5LWEA 3F6RA 4HYXA 1CZHA 1JFPA 4N4WA 4Y7CA 3W7AA 2KSAA 4ZVLA 2OHJA 5BR2A 2QMYA 4HWLA 2HPVA 4X1HA 4CETA 1FX1A 3C9MA 4OXXA 3NHKA 4GP4B 2V5UA 1VMEA 3ZHOA 1JA1A 1RCFA 3QBIA 4X31A 3S3BB 5LLDA 4BEZA 1DZEA 1VGOA 1F50A 5F4BA 4ZVMA 3UXHA 3OVMA 5FA6A 5EN0A 5AX1A 4HEQA 3UTXA 3QAKA 1YCGA 5H2JA 5LBTA 3SVLA 4MBSA 2OYSA 1CZRA 3OJXA 2OHIA 2BPOA 4GQIA 3REYA 2F95A 2V9CA 2Z73A 4FBZA 4G7SB 4F8YA 1NNI1 1KBQA 4GRVA 1BU5A 1AT9A 3F6SA 3OE0A 2YCWA 5A8EA 4L6RA 3EDOA 1YCHA 2RH1A 4JKVA 1TLLA 1BRDA 3HAQA 4L35A 4QOEA 1D04A 4KNFA 1WSBA 3PXOA 1TIKA 5B35A 3P0RA 2BMVA 2AT9A 3HAOA 3B6MA 3OAXA 1YDGA 3ABWA 2Z9DA 4U7GA 2VT4A 3QBKA 5B6XA 3LT5A 4BEYA 3OX1A 3QE2A 2Q9UA 5F51A 1M0LA 4C0WA 3EH5B 5LJLA 1X0K1 3NHLA 5ULLA 1H2SA 1PXRA 1AZLA 4FGJA 1CZOA 2J4YA 3NYAA 5H2HA 1RLIA 4G7QB 3FJOA 4XDHA 1D4AA 1I1OA 5ITCA 3S8GB 4N65A 5J7AA 1ZWLA 3NHPA 4PTYA 5B6VA 2BZSA 1S52A 2L6XA 3KEGA 4PU0A 4GYCA 3GFQA 2V5VA 2Q62A 2MWMA 2EI4A 3QBGA 4R81A 5EA2A 3EMLA 3P0GA 4WAVA 3UZAA 2G87A 2WC1A 3QDCA 1S8JA 1FUEA 2FLVA 3NHYA 3X3BA 3EH3B 1FLVA 2AMJA 5EMNA 1O0AA 4LDLA 3B6KA 2X2OA 2YCYA 1S8LA 2HNAA 3TEMA 5B6WA 4ZVKA 3O73A 4DKLA 4N82A 4CF6A 1WSWA 4K5YA 2KSBA 1GZMA 1P8UA 1V4BA 3PDSA 3N3BC 4GPOA 2WJLA 1TN0A 5B6ZA 4XTLA 3OX2A 3A7KA 1C7FA 3QFRA 1H68A 1C3WA 1C8RA 2QPEB 1KBOA 3VG9A 1RLJA 1AMOA 3UTVA 1QKOA 4PTZA 3EH4B 5BUCA 1YOBA 4GP5B 1SG0A 1XIOA 1E5DA 3CODA 3ES9A 1C8SA 3V2YA 1F4ZA 1DXOA 5H2OA 1L0MA 3OX3A 3AYNA 1BRRA 1BVYF 2ZZLA 1FBKA 3OE8A 2LNLA 3GFSA 5LBUA 1DX9A 1DXQA 4ZVNA 3UTWA 1XT6A 3EYWA 4GBRA 2JAGA 3NLLA 2ZKIA 3RFMA 4BV0A 1CZNA 4J8PA 1T5BA 4XTNA 2Z9CA 1YRHA 3N3AC 3GAMA 3S2YA 4YAUA 4U7HA 4H2DA 3UG9A 2Y01A 4G70B 2PEDA 4X32A 4DIKA 4QOIA 2OHHA 1M0MA 2Z98A 4LAFA 4H6PA 5FUQA 3PWHA 4M0CA 1VJMA 4QODA 5G54A 5KKHA 2BN4A 3FW1A 5AWZA 3O2NA 2JAFA 3ZPRA 3HASA 4UG2A 2FZVA 3ESYA 3F2VA 3HLYA 3NHSA 1AKVA 2RG1A 3OE9A 1B1CA 2Y03A 2QMZA 1PY6A 2Z55A 4FX2A 4NC3A 2FDXA 4YAWA 5AHZA 3NHFA 2F1OA 5BR5A 2KS9A 4Y9RA 1X0I1 2N1MA 5AZDA 4AMIA 3RPEA 1SQSA 3U7RA 1AKQA 2ARKA 2QX6A 1IW9A 1XYVA 3JSXA 3W77A 4MQSA 3L9WA 5NULA 1H66A 4NULA 3ZEVA 5ETZA 1LN6A 1FBBA 2B3DA 5B6YA 4AMJA 2A5LA 3KLBA 4YQEA 4GI5A 4PXFA 5H2LA 4N4YB 1GUEA 1JV6A 1MGYA 3QJRB 4EJ4A 1ZWKA 1QBGA 2X2PA 5G2CA 4FA7B 2FCRA 1S51A 1GU8A 2D5IA 3HR4A 4JQ6A 1BM1A 1QHEA 1RTTA 1AP9A 1UCQA 2R4SA 4U7FA 1QM8A 3S3CB 1CWQA 2R96A 6NULA 2MT9A 1E0PA 1L9HA 3OWXA 3PQRA 1J9GA 1ZX1A 1JV7A 5AX0A 4Y9HA 2KQUA 1S53A 4D02A 5H2PA 4N9QA 2ZFEA 1U19A 3N39C 1X77A 2NTUA 3HANA 5JJNA 2QR2A 3QJSB 1TN5A 2M6SA 2QX9A 1T0IA 3PBLA 2QWXA 4YAFA 3FX2A 2MOKA 5LMCA 3HAPA 3VW7A 4IARA 3VGAA 1JA0A 4XTOA 4BUOA 4XXJA 5LVAA 2Y04A 4MD1A 5G2AA 2MTBA 2YCXA 5H2MA 2FX2A 1J8QA 3B6JA 3NY8A 4G7RB 4ESEA 3DDLA 4LDEA 1YCFA 1QRDA 4LDOA 4KLYA 4MQTA 4EIYA 3K1YA 3TE7A 1KMEA 3MBVA 2I21A 1R84A 1AHNA 3VI0A 4C14A 4S24A 2WJKA 3AYMA 2KSYA 3R6WA 3VHZA 1F88A 3COCA 2NTWA 5DHHA 4IAQA 5F8UA 4FGLA 3UTYA 3UZCA 4Y9UA 3QJVB 1XYYA 1C7EA 4QI1A 2ZIYA 5B34A 3NSBA 4UHRA 3C9LA 4OV0A 2QX8A 4QOHA 3ESZA 5JROA 2FAXA 1XJIA 3KAQA 4N6HA 1CZUA 1CZLA 1FVXA 5F12A 3GFRA 5NLLA 1AKTA 5TGZA 4MD2A 1EHKB 3W78A
chains in the Genus database with same CATH superfamily
1ODTC 1GQ2A 1OD6A 3B12A 3I4LA 1Z29A 3GEHA 1JH9A 4O4LB 4PXSA 1A7AA 3CVYA 2Q0SA 5FD8A 1EWYA 5DCYA 5KNDA 1JR3A 5HJ7A 5HRAA 4J1TA 2P5TB 3AVPA 1C29B 5KHLB 3CX8A 3QXSA 2G17A 4AVYA 5BN3A 3DCJA 2XVMA 3ODUA 2PH3A 1RR6A 4NDAA 1N5LA 1GG9A 1NBHA 3IMCA 1TIPA 2A1UB 4EUNA 3TDMA 1BWPA 2H4FA 2HK6A 3OPNA 1RLMA 3GAAA 3THSA 3B1FA 1J49A 4XWKA 2ZWMA 4IIJF 1T9DA 3OLVA 5HZKA 1H1LB 3EXHC 5J9FA 3VO2A 1GD1O 1M7GA 2FA9A 1G3MA 1SPBS 2G4CA 2WFMA 3A8TA 3OIWA 4HWTA 2CLSA 2H0QA 2IITA 2CFTA 3WYDA 2AH5A 2DMRA 2FSSA 3W3ZB 2QRNA 4Z3KA 4ZODA 1QMGA 4E46A 1CD5A 3BE5A 1F12A 5IUJC 1OTYA 1O96A 2H65A 3GOHA 3WADA 1JL3A 2M6RA 2E89A 1F8GA 1T8WA 2JGMA 1F0PA 1HH4A 3DAGA 3HDTA 3DBLB 2FW8A 3UCXA 1XDBA 1ULAA 2WYIA 1SRQA 2LP4Y 4YPVA 4FGKA 3O3OB 3BHMA 3TZKA 1OT3A 2H92A 3PUVA 2V0NA 1JJIA 4ENTA 2QAGB 1A04A 4QJIA 2YRXA 1M2OB 3UONA 2BT4A 2Y1XA 2LUOA 4BFTA 4MHTA 1Z33A 1H0RA 1OA0A 2VPTA 3QV1A 4U3JA 3JQ9C 3EG5A 4MV3A 5SZHB 3UIEA 1E2QA 3DE2X 3P4UA 3PC4A 3RVNA 3ZHCA 3AVXA 4LHWA 5LP1A 4TLEA 3S44A 1I3CA 2BM1A 2HOQA 1YI8A 1B8OA 2C8KA 5DO9A 1E2HA 1JTVA 4YJKA 4DRXB 1H2RS 5FULA 1FQKA 1XZBA 2I54A 4KXVA 4HWOA 1D2RA 5FLKA 3I1IA 1Z6AA 3JWEA 3NM5A 3OF5A 1H2EA 1FQJA 1QFJA 1S2LA 5LOVA 1E3EA 2JJ8A 4GVPA 2WVGA 1O3YA 2I65A 2YUTA 4C7VA 4D4GA 3GLHB 4O2BB 4NRDA 1XZAA 3PUHA 1O7JA 3FR7A 2AZTA 2HPYA 4L0MA 3ESXA 4NSNA 4YQYA 1MV5A 3V1UA 1N2OA 1REQB 1EFLA 4J4BA 4FONA 4TWZA 1YKGA 2E5FA 4WDRA 5FI0B 3UWPA 1IW6A 3KALA 3O4VA 3OQ6A 3QK7A 2B0CA 5IXYA 1UBOS 3VR6H 4FR0A 2P1RA 5COBA 2CLDX 3ICOA 2PQ2A 1MIOB 1B76A 4OI2A 3TW4A 1KDTA 2X0FA 4BO4A 1NOKA 2JKVA 3L06A 1P3JA 3MWDA 5BN4B 1L3IA 3O90A 2Q0XA 4C0XA 1J9ZA 1CUWA 1IVNA 2XH8A 3VNSA 4CQLA 3NBXX 4RMGA 1LXCA 1TFRA 5KTTA 3GDOA 4IV0A 5IDXA 5BUZA 3D6UA 3BTVA 1G2QA 3OMXA 3HNPA 5AVUA 1XALA 1GFSA 3OT1B 1E5LA 2MSWA 4KQ2A 3GR6A 3C6QA 1CC1S 4OQMA 1MX3A 2VI5A 1Z28A 2Z9BA 3EARA 3V2UA 3WRWA 3C7AA 2Y00A 1GLGA 2JH8A 4G67A 3NC1C 1CFJA 4X5OA 4HB3A 2PRKA 3IMEA 3ZLVA 2DHRA 1RKXA 5E6UA 2XZDA 4TZ6A 1HMPA 3IO3A 4AG5A 3TL6A 4KNWA 2Q4RA 5AJHA 2XJ4A 1DPFA 1D03A 2R25B 4C1BA 1BNCA 2BZGA 4E88A 4M7WA 3K5PA 4B8YA 1AKWA 1K3UB 3LC7O 3X3CA 5F2KA 3L7AA 4L9WA 4AJOA 4C0LA 2GSWA 1DNPA 2YC4C 5EFZA 4UEQA 1UKVY 1YR9A 2W2LD 3F6RA 4J0IA 3O8CA 3JZMA 2QUJA 3BULA 1QTNA 3L7DA 1Y9DA 2VL7A 1VBFA 4GFDA 5CW2A 5I3ZA 4WCFA 2F3QA 1WVMA 3V46A 3V7YA 5IJ9A 2VDNB 4IHQA 4YRZA 4HWLA 1AURA 2PL3A 4REMA 5EXXA 4BZPA 3U9LA 3UAZA 4YNBA 5K3SA 4DPMA 1ZGHA 1Q1QA 4LSZA 4OSEA 3TW0A 3CPSA 1PI3A 4RZUA 1QLHA 9LDBA 1OV4A 4R7ZA 3QE3A 4K0KB 1UJ5A 1VCIA 1KMHB 2OEPA 2RGGA 3VNUA 5H9WA 7YASA 1ECFA 1ZUIA 3DYVA 1BDIA 2C7VA 2XKAA 3GEDA 3AUKA 4XUGB 1XLUA 5JSYA 4EBBA 3UJ8A 2BEWA 1QLWA 2G1AA 4HLQB 3H04A 1L5LA 1E2JA 2Y1DA 4Z4EA 3LHFA 4FFVA 2NP6A 3ICVA 3G0IA 4N49A 1B1AA 2G0AA 2YKGA 4HGNA 1SCJA 2JLCA 2ZU0C 3OLYA 1JG1A 3B9BA 4R83A 4AZTA 4F4DA 1W36D 1NFRA 1QV9A 2BPOA 2GWRA 3JVVA 5EXPA 4A8PA 4RAOA 4P53A 5KNBD 2Q28A 1YOVA 4FBZA 1T6ZA 4EW6A 2BFBA 1OH5A 3E5NA 2QZSA 1JJVA 4IIFA 4RUKA 4DV7B 3E58A 4DR1B 3O1HB 2X7JA 3DKIA 3VR4D 4D97A 1DZIA 2Z4SA 2WKPA 1QGOA 1TZKA 4EB3A 1QU2A 1QG6A 2YWXA 2NNWB 4FWIB 3UCEA 1CUDA 5AW9A 2IPOA 5T4FA 1QJCA 3QOYA 1IN8A 3ED5A 4JFAA 1SA0B 4MV1A 2ZITA 1R6UA 3LECA 3O8BA 3EFEA 4M0EA 2YIJA 1J39A 3P71T 4B3BA 2YXEA 2AUNA 3D4BA 1IJEA 4L2IB 4RNDB 1T0UA 1Z5ZA 3M6UA 5CK4A 4YRIA 3LT5A 1H2AS 1R4MB 5TF0A 4F6RA 3CWQA 3TM4A 5EUQB 3ZNPA 4C0WA 1CEQA 3BXEA 2RHBA 1TEHA 2Z4RA 4UVEA 4F06A 3PVZA 2KYRA 4AJEA 3FCAA 5ULLA 3K73O 4UEOA 3VH3A 2MR5A 1TYBE 1FFXA 1QZZA 3WJ1A 2XOXA 3FAZA 3BKWA 3I9V6 3JQFA 1CQXA 1JIIA 3DB2A 3VKVA 1OI2A 1R6BX 5ECDA 1T9AA 2Q3BA 3VX3A 1KI3A 4AM8A 4NMMA 4F2DA 3C7KA 1DQZA 2XAAA 3LQQA 1VZ3A 2AZXA 4YLGA 4A6EA 2WKWA 1WDTA 2I2AA 1Q77A 2WU8A 3HKCA 5B6VA 3PVCA 4UHDA 4IG4A 5SYNA 3WMXA 2I2WA 1J8VA 3N87A 5J2UB 1P8AA 2OECA 1T1SA 1TCUA 2I22A 1UBFA 2GBCA 2ZVJA 3VNQA 5B58C 3E1GA 2ZCUA 3WGNA 2BLNA 1C0KA 1YS6A 3FF4A 1WPRA 5BPHA 4AX8A 2QRGA 3BXZA 1V26A 3X3BA 2J5RA 2LXNA 5HILA 3G8DA 5TGTA 4O59O 3TJZA 1Z63A 4O2AA 4XQCA 4G5RA 2GZDA 3V8NA 2RK4A 3IXQA 3AF0A 3KOZA 2UZ4A 2GKSA 3CRZA 1QK5A 4Z7OB 5BW4A 3HJAA 1EFCA 1VSVA 5KTMA 2IU0A 5EZ6B 4RDXA 1B0PA 1V4BA 1QFSA 2HF7A 1TJ5A 1M7HA 2Y67A 3GT4A 3PQDA 4IVQA 4JYBA 1Z7WA 4RQBA 1DCKA 1K1EA 2FF5A 3F4BA 4PZLA 2IBMA 2XMZA 3HO8A 4E12A 3BFKA 1KY2A 4YROA 4KV7A 1EXMA 1YS7A 3F7MA 3H17A 2DUMA 2DQYA 2R6ZA 4KDEA 4S1OA 2PWYA 1D5WA 5JHHB 5F9FA 4B0OA 5JCJA 4PYNA 4P33A 3K3PA 2GAFA 3Q11A 4P4SB 5FOVA 3QBVA 1TGYA 1C2TA 1K2VN 4X8LA 2C20A 3VR4H 3GRYA 1IY8A 3I8SA 1SUWA 3FVQA 2UZ3A 4GHWA 3RYFB 3NPAA 1XIOA 3FVTA 1FU4A 1GRNA 1OXKB 2ODPA 2X6TA 2FXVA 3LPMA 4MRPA 4TMZA 2Q6VA 4DSNA 4L5IA 2PMBA 3OM8A 2H85A 2J7PA 1VLJA 2IPXA 5D6OA 1UZUA 3LOPA 5SYAA 1NE2A 2IDJA 5KQPA 3A32A 4US2R 3KR0A 3FWZA 3FLEA 1KL7A 3I30X 3OTQA 3HRKA 3ELDA 4UZFA 1JR2A 3OF2A 1U0RA 4GXRA 4XOIA 1NXWA 4KIWA 4LYGA 1MCZA 5LZ4A 1T8PA 2XGMA 2XMDA 2X4LA 3HN6A 3N8GA 4UCXA 3NIGB 1ECJA 3UMBA 1RZVA 1KSHA 5EP2A 4IV5A 1OQAA 1Z4LA 3RFMA 4YTEA 1BWQA 3R3HA 4YCCA 5F23A 1I7QB 2G07A 4D3YA 3AEQA 1R3UA 4FJ2A 1L6IA 1II8B 2FGJA 1XZGA 4OEHA 4M1QA 2JD0A 3AK4A 1T3GA 4XQEA 5E1OA 2QNIA 2R2GA 3H3JA 1X7ZA 4M9QA 5LLTA 4M0KA 4EHHA 2DSNA 1OFIA 5J3JA 5J59A 4A10A 1W5EA 4U5QA 1ZHHA 1QAQA 4PO1A 2H4JA 2IPAB 2FZLA 4QODA 4ZPXA 2OFXA 4DQDA 5FUQA 4AX4A 4RC9A 2HB6A 3PQ6A 2PXHA 4RSMA 5KMGB 1USKA 1MAAA 3R5KA 2OBMA 1L5GB 4IXMA 3RVJA 1JFSA 3D3JA 3HU2A 3L0IB 4NENA 4EG8A 1TO2E 4REQB 3U09A 4TUYF 2C9OA 2GBGA 2UUPA 1SKQA 2PKQP 3VI4B 1ZUWA 1B1CA 3OHSX 3CE9A 3TI9A 2X0IA 2OESA 4H7PA 2C4KA 4LF5B 4HUJA 4D0SA 3R9KA 4BN5A 2HSWA 1PEDA 4UMDA 1AQ6A 5EIWA 3ROZA 3SD7A 3WIDA 3GEEA 3MRXA 4LVNA 1V2HE 3OQBA 2P8SA 4IZHA 4EUHA 2A58A 2AX4A 2M6LA 3PUZA 4YV1A 5DGIA 3O84A 3ZS8A 4ENSA 4OD0A 1IPHA 4JQYA 4BRZA 5CFQA 2K4MA 2W9XA 2X9GA 2ARKA 2TMKA 4RV5A 2QG4A 5IJXA 3IBYA 1GQYA 1YZ3A 1OREA 2YYAA 5IC6A 5EWMA 4LCJA 3LPLA 5CCEA 3ZEVA 2A5FA 2CLOB 2ZRMA 3B13B 3FPSA 2WMDA 5CYGA 1FSGA 3AL0C 1PW5A 4YQEA 1H4VB 1E9SA 3PQEA 4N5LA 1E6LA 1F3LA 1JN0A 1F38A 1YQ9A 2C03A 5GIOE 5C18A 1A69A 2RGUA 5KREA 5FEUA 1II8A 3MCTA 2NAPA 3BHIA 3ZE2B 3FJ1A 2CD7A 4DMRA 2ZEJA 1OTHA 1VDZA 2FCRA 3EMDA 4R1TA 3SP1A 4F4JA 3QVWA 4DMLA 1N2EA 1KHHA 3PRJA 5C3UA 3FMPB 3SHTA 3HR4A 2P2LA 1P5FA 4XOUA 5HA5A 1R10A 3E2PA 3QPVA 4X61A 4GOJA 5FUVA 5J5VA 3FLBA 2IBSA 3T0FA 1A9QA 2GKGA 3KQWA 1VGVA 1UCQA 2YYZA 4DUZB 3ZX4A 1VCHA 4WE3A 5JQGB 1EX6A 1R00A 4UUOA 2VJLA 4U3JB 1C4XA 1QBKC 1ISMA 4HRAA 4YMTA 1I32A 3AJRA 3QLJA 3HSKA 4HVLA 5J4HA 4Q4LA 3FOBA 2G8LA 4MW5A 4Y9HA 5A6SB 3ZCXA 4EFNA 3BH0A 1J00A 2PYIA 3VVMA 1UMCB 3QKTA 3QA9A 4RTLA 1KO8A 4LJ4A 4QEKA 2Y77A 4D42A 3M3PA 1NG1A 4JI7B 4F86A 1K3TA 1SUBA 3DZ8A 3WMGA 2E9SA 4YP0A 3AB3A 5TQ2B 3T4UA 3HVIA 1ENYA 3ROTA 5I7RA 2P0AA 4EB8A 2IS1A 1LWOA 5JD6A 1G5HA 1L5YA 1EINA 2AGVA 2OBYA 3FNQA 3JYOA 1THMA 1TU4A 2QRVA 3DKPA 4CF5A 3U7GA 1MW8X 3I83A 2WOJA 1FTSA 5KMGA 3I2FA 3T3OA 4W5HA 1K6JA 1KMIY 1FU8A 1R5JA 2CVHA 3HPQA 4ALIA 4WEQA 1QYDA 8AT1A 2F43B 2ADFA 2QYHA 2D4HA 4ZU1X 2PRSA 1XXHA 4DIEA 3E1SA 3NETA 1NR1A 1UUFA 2Y04A 4URYR 3T7DA 3QEKA 4EHAA 1G6OA 1N4AA 4FS8A 1UBSB 4J07A 4OH7A 5FPPA 1Q0HA 2WJGA 3FGPA 3K1TA 4NBVA 3NY8A 1DDOA 1NUTA 1XQWA 3JPWA 1G3RA 4PV7A 4DM4A 2GOYA 2PXAA 1KP9A 3PJFA 2RHWA 3MGGA 5KDDA 3T6KA 3MTEA 3Q7IA 4WOPA 2QAJA 4RFSB 4ZQBA 3GFTA 4MK4A 3F3MA 2HMSA 3MRTA 4FHFA 4ARZB 1NI4B 1L7XA 3KDAA 2QLTA 4I08A 4UREA 5K6AC 2FH5B 1W5SA 4C14A 4DQKA 4P0PB 2DUNA 2BDTA 3RS7A 4CZ2A 4NYIQ 4KAXA 2I2DA 1IXRC 2P9CA 3JQFC 4JGBA 4UATA 4PSKA 3A6ZA 2OCPA 4UHJA 1Z5NA 5ITZA 1V3UA 4KRGA 3AVWA 4FK8A 1H8ED 1WZIA 1P4RA 3FRJA 3LL4A 3NASA 4L15A 1A77A 1DIAA 1GKKA 2AA3A 3UTYA 2VJPA 4DM7A 2O2JA 2JZOA 1UL1X 2OCYC 2WD7B 3DAFA 3KLOA 3ROKA 3VPHA 4QFBA 3AJAA 1OSNA 1A9PA 3L07A 3RUAA 4P4GA 4R7GA 1T36B 4TM8A 5JS6A 2ZIYA 3QVKA 1CB0A 3IP6A 4BLPA 4ER5A 4CR8A 2BZ1A 2GEFA 1HDEA 1CNFA 2AXPA 3JV7A 4JENA 3TPZA 3LV8A 2OAP1 2OXCA 3GD7A 2QRVB 1L5HA 4EPWA 3WGIA 2NT4A 4QDXA 3ZEIA 4OLJA 4N6HA 4IIYA 1ZR4A 2I2CA 4QJ4A 1G0NA 2H4XA 3GQBA 1WCWA 3RS5A 1AKMA 1HE3A 2DECA 2VWPA 4WMLA 1CETA 1SC3A 4J0FA 3K1JA 2CJPA 3EIFA 4L0CA 4ZCSA 2A1IA 4EKDA 2XQGA 1KIFA 1JNXX 3L7MA 2Q1UA 1VP9A 5A7GA 2BGMA 2X9LA 4PE5B 1OVMA 1SB8A 1J09A 3RHSA 5K5EA 1AHHA 5A6SA 2VRCA 1JJFA 1ZMTA 3MHPA 1EA5A 1ZG3A 3ROEA 4IOJA 4LWQA 3A31A 3EZXA 4KXUA 1QLJA 4WXMA 1FLNA 2QPOA 1I1QB 4IYRA 2ZSUA 3D8NA 5AOBA 5EIAA 3RVOA 1GZ7A 3KEFA 5GZ1A 5H2IA 3BRWD 4E5SA 1GPUA 2P9JA 4LX0A 5LQNA 1NW5A 1TLFA 2AUMA 2FWNA 2FSPA 1TC2A 2A0FA 4FHGA 3LKVA 4I9FA 3VU9A 4BGUA 1ZNWA 3IAFA 1W4AA 3SK0A 3UWSA 5LDHA 1Q84A 5A2GA 2B2NA 1I4TD 1WS6A 1U28A 2J3HA 1QKPA 2Y1OA 1DUIA 3C98A 4E2FA 5DMXA 4ZO7A 4RPIA 1SK8A 1HDIA 1QH1B 3JD4A 4CQMB 4HUQA 1ORTA 1JFFB 4FC7A 5AD1A 4OVKA 3UJ9A 2X0NA 1SXPA 3BF8A 1RHKA 4I1SA 2QHXA 2ZIGA 3G0GA 4F1KA 2PGNA 3GB9A 4HZUB 4B6EA 3BSSA 3K6SA 3UM9A 3AF1A 3EJWA 3FGNA 4OB7A 5EYPB 1OH8A 4IDOA 2NG1A 1SN7A 2ZR0A 1U8YA 3SHOA 1V3QE 3URKA 2BEJA 2JGKA 3GGGA 2DULA 2O9JA 1OZFA 6AT1A 2WJ3A 3PPIA 3VJLA 2SCUB 3E35A 4L2IA 1NLMA 2EJTA 4D9HA 5A4KA 2G5CA 2B4QA 1WV0A 2J9YB 5EZ5A 3BJEA 3PUWA 5JAZA 2XRFA 6REQA 1QDUA 2QTNA 1I9GA 4Q3LA 4QQFA 3TGLA 3VKHA 5AQ1A 4HH4A 4QG7A 4NJOA 1O0BA 1X1SA 3W06A 2QLNA 4EUEA 2FK7A 1NMYA 2OC4A 1PJTA 2VSXA 1NXTA 3CKKA 1KQNA 3M81A 2QJFA 3AL3A 1Z38A 3PR1A 2XYHA 2Z1DA 3T4EA 2WD9A 3PSHA 4QULA 1XO1A 1P8IA 2HQ1A 3H2SA 1L5MA 2VSYA 3MTIA 4AZ0B 3LG2A 3WBBA 2JGIA 5IT0A 3IIKA 3DL4A 2GJ4A 1BDBA 4MYTA 2A9OA 3G2HA 5B2ZA 4BYMA 4UHEA 3AR4A 1Y7TA 1YZKA 4D9JA 2RGNC 1MJGM 3P97A 1L4UA 1NW4A 4FZRA 4EKEA 4YRMA 2I71A 5KSOA 4QIDA 2GETA 3CT6A 2JFGA 4QTTB 4R54A 3UJ3X 2BEKA 1OC2A 1Z6ZA 2DY0A 1YZVA 1EHYA 3AVYA 2YMPA 5CX1A 1YB2A 2JLQA 3Q72A 3V80A 4CQMA 1TE2A 3G17A 4CV1A 3WQRA 3BSWA 3LP8A 3INGA 4RU1A 1IVSA 4ZVVA 2AOTA 3FNIA 4JLJA 4BNXA 1QOPB 5CLJA 1RLOA 2X72A 1TC1A 2XVAA 5COAA 4BUCA 4IOMA 3NIBA 2PA0A 4LUCA 4BOYA 1KNQA 4C6SA 4PC7A 3T54A 4TKVA 5AW2A 2YXLA 4LDRA 1M6HA 2O3RA 4DQ0A 1IYZA 3QJGA 4CG2A 4PNZA 2YDVA 3GT7A 3WQSB 2X9NA 3U0VA 5ARDA 5LZ7A 3W04A 4B80A 4CM5A 2V54A 5JNUA 1A1VA 1RXUA 1AQIA 2WZBA 2DKFA 2ZTMA 3BAZA 4BO5A 1DIRA 2GF2A 1JWLA 3TD6A 3CM0A 1M2WA 3RU9A 1X3SA 3CH7A 1VJRA 3KWLA 1CULC 3F8WA 4G5SA 4LV5B 1SCBA 4R3UC 3HY4A 3IE1A 1V7CA 2EHJA 2NXEA 3NUQA 1LI7A 2F17A 3HBLA 3SC2A 1LSUA 3SN6R 3OT4A 5G4KB 5HK9A 1FW6A 4F3TA 4Z2YA 1BHSA 3FWKA 4XT3A 2AEJA 5EYPA 3RUHA 2W5UA 3SZMA 3E3NA 2E0IA 4MITA 4B5LA 1KK2A 1ETHA 1EFPA 2ZZMA 5HDQA 1OPRA 3THXA 5BR2A 5KS2A 1G7TA 3VR4A 1G0OA 4MEJA 2J32A 3BRCA 1UP4A 4NAHA 5LMZA 1NBMA 1BMDA 3EWIA 3O83A 3EODA 3CRQA 3DA8A 1T2FA 3JWIA 3QBIA 1E61A 1K8YB 2WTBA 4JP1A 1QP4A 1EX9A 4L8YA 3B6ZA 1GZ6A 4LZJA 3FH0A 4N5HX 3S3BB 2FQ1A 3UXMA 4KN6A 3QFSA 5C8DA 5LLDA 2YOGA 3W5JA 3ELUA 2QN1A 1A9TA 3GJ7A 3UUWA 2AJDA 1QHXA 2GX6A 3VUEA 4KBYA 2GZAA 1QYIA 4G4IA 2LGJA 3H3XA 4RTMA 2UYHA 3CR8A 3LHSA 3HXPA 1ST3A 3JATA 1MO3A 1W88A 2J7KA 3O0DA 2MSKA 2W71A 5ENDA 2XZPA 4E5UA 2G67A 1Y33E 4A1OA 1CZRA 5DE3A 5C8YF 2TMDA 2B35A 1ZICA 2LV8A 1BXKA 1NM5A 3DLAA 3O6VA 2EFJA 3LGAA 4HQFA 4U2KA 4BFXA 1B4DA 3H5LA 3NTRA 1AY0A 4BLTA 3IVCA 3JQPA 4GX5A 3HDGA 3ZN2A 1Z17A 3WR5A 4RVCA 2WG1A 4Z2AA 2B4KA 2OCKA 3K0SA 2G28A 1Z06A 2JBAB 3MJDA 1STOA 5FBWB 2EX4A 3ABRB 3SICE 3WLSA 4Q1EA 4BNZA 2NPFA 2KB0A 4P5DA 4S2EA 5ECYA 2I34A 4I3HA 1Y6ZA 2Q3FA 1QO0A 4IIUA 4R9RA 1TKAA 2CVFA 5JZSA 1KI8A 1ZI9A 4AY2A 2BUAA 1T6BY 4FZJA 1MJHA 3JQ8B 4LSWA 1SKMA 1GFIA 2WQ6A 2M6KA 2XADA 3VR5H 4KPEC 2C3YA 4CM4B 2CNKA 1PZGA 4II7A 1KZYC 2WJVA 1LSJA 3DDZX 4XB1A 1QG4A 4GEKA 2Q0HA 2V6FA 2LVBA 1HT1E 2IH2A 1R37A 2JZNA 2Q99A 5JANA 4IDQA 1ZNYA 3WLKX 4E5MA 3C85A 3VQTA 1VE9A 5LP6B 1F1BA 1I14A 2G63A 1Z6PA 3DWIA 4OKNA 3U4IA 1JEYA 2QS9A 3DNMA 1JHUA 2HGSA 1X0K1 1RQLA 4MR9A 3SN6A 1UAYA 4RFVA 4D1YA 1ADJA 1WSDA 3MC1A 3N6XA 4I14A 4ZT6A 4AIIA 2PD4A 3LE8A 1XMVA 4HEJA 5JCOC 2YNMA 5E7QA 2YW9A 5JSUA 4PTLA 2XVZA 4CT0A 3MERA 4R4JA 4CHGA 5JYBA 5K4HA 3T5GA 4TL8A 4G9GA 4NS1A 1W34A 1FIUA 2OV3A 2RGXA 2JH9A 1V6AA 4KKVA 1VG1A 3HKBA 4C0SA 1I2AA 1TVKA 2DTXA 2OPHA 2VJDA 4AMBA 4F4IA 2BELA 1DQPA 1VRVA 1T0JB 2G1JA 4D0NA 5C5CA 4M1KA 3PC8C 1ZSYA 1P75A 5E9JA 5J23A 2C4UA 1EUDB 4OUKX 3F74A 5DGTA 4TV9A 4DWVA 3UBTA 3T7TA 5KYTA 5GTDA 6LDHA 2FLVA 3Q5DA 3ZYCA 2VJNA 2ZI6A 4Q4DA 2FW7A 3NGMA 4HDNB 4CLDA 3J81A 3JQQA 1V43A 2ZP1A 3P5SA 5K01A 1ZR2A 2W42A 4E31A 3LBHA 4EJSC 4WPGA 1QG2A 4L4ZA 1N5IA 2IUTA 3O73A 5AT1A 3FOWA 4ND6A 3D3WB 1ORIA 2R79A 2ZAOA 1OT5A 1XDSA 2B6HA 3K5HA 5DVZA 3UHFA 2O50A 1UWLA 2J5KA 4GPOA 3BDIA 4ROTA 4ZAGA 2WJLA 4B3IA 1QFXA 3ONWA 1NT2A 1Z18A 2LPMA 3OQIB 3A7KA 3SR3A 2GA9A 4DB4A 1U9CA 1H68A 2IY7A 2EGHA 3NT5A 3OZBA 5LXTF 1N33B 1G16A 4UD2A 4YXWA 3DBHA 2FZKA 4ZALA 1KRWA 1RLJA 5FO0A 5A0VA 3UTVA 4IHAA 1WSAA 4WUVA 2BTEA 1H5NA 4OHYA 5KTNA 3MJCA 4X1KB 2RGDA 3HGQA 3MM4A 1Z9BA 2YBEA 4TV8B 4EPYA 4GBGA 1OX4B 3S7TA 3ZDXB 3IQWA 5J1SB 4O63O 5C51B 1ZNZA 2ENUA 4EG0A 2CL6X 1L0MA 1V35A 4C0QC 2AK3A 4BYGA 3GN2A 5DYYA 4YLYA 3N7UA 1TVKB 1DIOB 1KAOA 1PSZA 1FBKA 2QN8A 4JKIA 2HF2A 5BNWA 5LBUA 2BEVB 4ZVNA 4W5WA 1VL5A 2YZNA 5KI6A 4ABTA 4UZEA 4GBRA 1BOOA 1PUJA 1X8LA 3IV7A 3O2JA 2WK1A 2FR8A 5MFZA 3FVVA 4GUDA 3IH5A 1E62A 5KYNA 1M1NB 4YFVA 3E5RA 3GBVA 1SVNA 3M70A 1Z25A 4M98A 2IBTA 1LD3A 4MR9B 4R2MA 1EEHA 1JALA 2FLWA 3NP7A 4DEYA 1Y6FA 1EJ6A 3K96A 2WWVD 5D1NA 3CXRA 4JASB 4YAJA 2Y1GA 1X7ZB 3PBKA 1I1HA 3ILYA 3ASVA 3TCKA 1MTOA 1BW9A 2FMUA 5KC9A 2CLMB 4WZBB 5KYUB 1UWKA 1Z6GA 3E82A 3L7OA 3IJRA 3UMCA 2Q3HA 5FF9A 2GXUA 4I8DA 3MUNA 3ETGA 4UKDA 5ERGB 1L4NA 4X1YA 3S7ZA 2GCOB 3W5IA 1FMFA 2ZUEA 3BVPA 3HASA 2XEXA 3KQTA 1AKVA 1E1QA 3BGWA 3OE9A 1G4UR 4RVNA 1ORRA 4G2TA 4QPJC 3RVKA 4F93B 3T7KA 3AEYA 2BM8A 5GY7A 4ZEVA 2F3RA 2VKQA 3GARA 4IICA 5AHZA 3GJ4A 4ETNA 2RH9B 5J2UF 3BXFA 3PGVA 3BCUA 5BR5A 1CHNA 2OV4A 3BJRA 2ZS7A 3K9QO 5GM1A 3MWGA 5IU6A 5LIPA 3N0TA 1G5TA 5AZDA 2ODEA 4IGEA 3LYAA 1MO5A 3Q7PA 3OFVA 3ZTTA 3PI7A 3FXAA 2QTVA 1CUEA 3R9IA 3WGVA 4D7AA 4E4TA 1G7SA 4PO8A 2NO9A 1U2TA 1KDVA 4D6PA 4LBWA 4QX6A 2NZJA 4H60A 5KX5B 1JSRA 4LZZA 3NZEA 3PE4A 5T3YA 1K89A 2A5LA 3IGFA 3WDKA 1YRLA 2HI0A 4H1VA 3TW8A 2R5FA 5CB8A 5JARA 3HXMA 3ETEA 5EL0A 4XLZA 5L3QA 1V8PA 4MYCA 2KX7A 1NV8A 3FDFA 4FHEA 4R3NA 3CH4B 3PUXA 5IVKA 2FN3A 1S51A 3RYTC 2B7CA 4ZYLA 4NOLA 3Q9SA 3K31A 4K6CA 2ZQZA 2WF8A 4KYVA 1E1RA 3RVDA 5EJEA 2C82A 2X9VA 1RYHA 4GZ3A 5AJUA 1RWWA 4MQFA 3KQVA 4AJNA 3ZDAA 2EU8A 2E4AA 1AV7A 3PD7A 4HGQA 4WSOA 1MT0A 1BQEA 1HG1A 2IELA 2AG5A 4IIHA 4L7QA 1IUKA 3RG2A 4UNRA 4V24A 1BRTA 1DQYA 1ML3A 2CXSA 3DMPA 3LX5A 1UPTA 4NVRA 1KYWA 1NPYA 2Y2VA 3NS7A 4WFQA 4JVSB 2MHCA 3C5WP 2JAUA 5ILQA 1PR3A 4LKRA 3C8HA 3NBMA 5K3DA 1AB5A 1QH0A 2ENWA 3IJEB 3BFXA 4OQNA 1H3EA 5D85A 5DSTA 4DLBA 2HLPA 1G6KA 3OZFA 1ORHA 3E53A 5DW3A 2CVQA 5I9NA 2CJWB 2NYAA 1NR5A 1YA8A 2HEIA 3DZBA 1KJYA 4IJUA 2ZB3A 1MH1A 4KLZA 4LCBA 5AK5A 7REQB 4M1EA 4P98A 3T3PB 2F1RA 3NWOA 3QRWA 4FOLA 4FYPA 3IURA 4B81A 2PZJA 2FFAA 3PTAA 1OLXA 2PFGA 2AR9A 2H5IA 4QBHA 5F3DA 1K7CA 2GMWA 3G7UA 3W9UA 1ISRA 1VG0B 1MX1A 3FX2A 2ZBFA 3B6EA 3FTQA 3HMQA 4WNYA 2CFRA 1XJ5A 3GNLA 5DNVA 3ZW7A 5JTTA 4IARA 3L8MA 2Y1EA 2XCSB 2QUAA 3IDAA 4TL9A 3QVGB 3ILXA 1U02A 3TKLA 1WEKA 3L8EA 5CW1A 1QH8B 3NALA 2BFCA 1YS1X 3CLUC 5DTEA 3C48A 1W2WB 4DDWA 2R8PA 3A26A 5FV4A 1EJ2A 1NI5A 2CUNA 1WQ3A 1QGZA 1YS9A 3AEZA 3INRA 4FINA 4WJZA 4YJHA 1YD7A 1QS0B 2DPHA 4WW0A 4JQCA 4G0QA 4F56A 3EG9B 3TE7A 4EMSA 1LK7A 1IQPA 3QPDA 1XWIA 1P1JA 1XMPA 3N58A 4YBRA 1G8YA 3DL7A 4JU8A 4HNSA 2KSYA 5CXXA 2PRZA 1PJSA 2YMLA 5E9QA 2AX3A 2VHVA 2QRKA 3COCA 3WL5A 2F67A 3WK8A 3LQKA 1IZ8A 4NBRA 4CLRA 2FHPA 4LWPA 4GKBA 4AD8A 2J3MA 4I50A 2RBEA 2D7DA 1H6BA 4I4TB 5H1YA 4B6GA 1AGYA 1V6SA 3BSYA 2W4QA 4IM7A 4DT1B 5HP4A 2QTHA 4M9RA 4CM3A 1H2BA 3NSBA 3BK1A 4OV0A 1RZ3A 3H1TA 4HEA6 3ENQA 3ESZA 5G3ZA 1WF6A 1YK0A 4E30A 3H9QA 2GS9A 1CUAA 2VZLA 1DKOA 1PX0A 2FMKA 1SWVA 3QUAA 1OWLA 1IN5A 2JGDB 3HKBB 4K9NA 5JD3A 3AI2A 4RY0A 4PLZA 5NLLA 3GFRA 3VTAA 1SXQA 2JJQA 3U49A 3W78A 3H5TA 5E1MA 3PHBE 4RGQA 5JPIA 3NTQA 1WA5A 2F43A 2HO5A 3NH9A 1SBIA 4BPBA 3SQNA 4GP8B 1YNOA 1DBPA 1AD2A 2E55A 2QD5A 5LBIA 3ORQA 2MDTA 2G83A 3DDHA 5FJIA 1N1MA 3SJBA 4I99A 3DAYA 4CFSA 3BHJA 5CG2A 5BSFA 4WZAB 3H5AA 4LY9A 4G8DA 5K0FA 2YRWA 1I30A 1WXGA 2HSGA 1W88B 3IUSA 3IXMA 5K3FB 1SXHA 3VPFA 2D59A 2E7ZA 2R1TA 2BGNA 1QIFA 5K8LA 4U00A 4OOEA 5B3LA 5FBLB 4JYCA 3DE3X 4H27A 4G5QA 4A03A 5I5GA 2HNBA 1RQXA 2WT9A 4O4JB 4PBTA 4WBSA 5E7JA 5ARCA 3INTA 4DDTA 3DC7A 4ZCPA 4B45A 3ER8A 3QXGA 2IP4A 4JJZA 3I8XA 4NNJA 2VTEA 2Q0QA 2XXAB 4U9IS 1NP3A 2HWUA 5KAMA 1ZI6A 4HNQA 2XCQA 5KYUA 5KOJB 4BTLA 1NNEA 3OPYB 4M1YA 3A14A 3VSBA 4QGSA 4LJSA 3UMGA 2OPBA 3K6SB 1LW6E 1J8YF 2PU7A 1UKYA 5B5SA 3S2EA 2WB2A 4PCVA 3OPVA 2QL6A 2XWPA 2BHLA 4KE7A 1T13A 2E4ZA 2DPXA 1GPAA 2X3UA 4BMOB 2FEXA 1NDHA 4E09A 4CIXA 4YCLA 4CKBA 4MOWA 4FLEA 4IY1A 1U3GA 3SQLA 3WNDA 3A2MA 3VC1A 4EYKA 4LJYA 5T6MA 3C45A 4QOFA 4UOEA 3AUJB 1NJ8A 4LHZA 2EG9A 1Q11A 1B3BA 2QV7A 1O9GA 2C59A 3MTGA 4JC8A 5C8XA 1GCIA 4FBMA 4QGAA 1E1YA 3TQHA 1EVZA 5FTWA 3N2LA 1E3JA 1LX6A 1SQ6A 2PZBA 2V4ZA 2WD7A 4JEHA 4MWOA 5E38A 2HFKA 3W2TA 4IWYA 4Z0HO 1R7RA 3FSEA 2GJ9A 3I9V1 4I3GA 4KW7A 4CPDA 4F3RA 1Q0SA 1ST2A 3DNFA 5LQJA 1Y8RA 1ZZGA 4HPXB 4DLPA 4J76A 4NHEA 3HV2A 1U8CB 3VR0A 4AUMA 3K70C 4XGRA 3NFYA 3REOA 3QU9A 1W85A 3D6HA 5ALTA 1HSOA 2D0PB 3QAPA 3A3OA 4TV9F 4NOMA 4K1LA 4A0RA 3GBSA 3GNSA 3KAPA 3LCUA 1G3QA 4K9KA 4MLCA 3U62A 3WRXC 3U3ZA 2YDOA 2C7PA 3PFWO 1T8RA 1SFRA 2BOVA 5E6SB 1B74A 1RZRA 1NVUQ 1RWMA 3VBCA 1L7RA 2C9BA 3VPDA 4ZAWA 2AW3A 3QEMA 4XUEA 3TRIA 4BJ3A 4NARA 3OX4A 1YFLA 2QTZA 2VH1A 3QKRB 2CMHA 3BWBA 3CO0S 4ZVTA 3QEAZ 1Z15A 2YJZA 2G70A 1HM5A 1RFGE 4E08A 3GOQA 4F6LA 2IX9A 1A8IA 2BAGA 2HPZA 3AFGA 1VL2A 2CLIB 2WABA 1Y3IA 4M3NA 5IMSA 2ZUFA 3B1VA 3PIDA 3WNVA 3RGGA 2VTBB 5CAEB 3H2GA 5SICE 4EABA 1Q12A 3KQMA 3VTKA 4DR3B 1IXZA 3KJQA 5CA0B 1U2GA 4KWCA 4Z99A 3TNJA 1D2NA 1Y3DE 1EGQA 3BILA 3QKWA 3WL4A 1OIVA 4ER6A 1E7WA 1G64A 3G5AA 3PTLA 3F7TA 3EMVA 2WR8A 4UQOA 3Q3JB 1Y9ZA 2I3GA 3FY4A 2F93A 1N0UA 4B7UA 1XVLA 1FRVA 5ALXA 2AQHA 3N07A 2IS2A 3Q2KA 2AR7A 3QTLA 4DZZA 1IVYA 4EFMA 4ND7A 5IC4A 2VYQA 2Y1WA 3M4ZA 4FNGA 3PUIA 1X6VA 2FZ4A 4KN5A 3TINA 4QDKA 1OX5A 4BQSA 4DQXA 4RVOA 2QGFA 4X63A 3SMQA 3EFOB 4A8HA 1D2CA 3QOXA 1DIBA 4N4WA 1U3DA 1VKNA 1DZ3A 4UOQA 2SBTA 5DHRA 5FR2A 3KD3A 5T5QA 3UG7A 4BVAA 3I28A 4GX1A 3E9RA 4CDGA 2FQWA 1YK1A 2PUBA 3IB6A 5JUWA 5FHQA 5TMEA 2YJGA 4MUKA 5EZSA 8ADHA 1Q57A 5KCZA 1WVIA 3WMFA 2O1SA 3RLFA 3ZCQA 3QVLA 1GG8A 2FJ0A 5JAQA 4MV5A 2IEGA 3DXFA 4L0QA 3TLCA 1B3RA 1I6WA 1A3CA 1K68A 2Q4OA 3A1UA 4M8NE 1I24A 5KNDD 4NBKA 2P1ZA 4LOHA 3DUFA 1J2UA 5HJ5A 3TEFA 1GHTA 1MEOA 4Y2XA 2HCRA 3U3OA 4XB2A 5DM70 3GFVA 2Y0EA 5FA6A 3QSGA 4FD3A 1KK1A 5EN0A 5LYYA 3SQDA 3VC3A 4Q3AA 3KUCA 4PIPA 1AU9A 5FT9A 1NZDA 1FBNA 4OK6A 5CUQA 4EJSA 4RF2A 4GWLA 2QRJA 3QW2A 5IG2A 1G2PA 4PHCA 1NLUA 2X8BA 4PLPA 1UT5A 2V65A 3MIZA 4C5BA 4E3WA 5C4MA 1RXVA 4BP9A 5IDQA 4UBNA 4WCFC 2C94A 2YNMD 3TMAA 4GRVA 1ZGAA 2ZQ5A 5DK6A 3DFKA 3UPDA 1KOFA 1P0FA 4LFAB 2VIIA 3D59A 3I52A 3EYAA 4CTJA 5A4IS 4MNTA 3QLTA 4LPKA 4TLLB 3W3AH 1GPKA 4MVCA 3HAQA 1PFUA 1QOQB 5DN6A 2HPAA 4BHTA 2OBFA 4H08A 3A6JA 2BMFA 3IHWA 1M72A 3K9LA 4G89A 3V8RA 3S1SA 3A4NA 4QAJA 4YQZA 5B35A 2BUCA 2VJMB 4C30A 4DHWA 2J4DA 2IV7A 4BJ6A 3WWZA 2Z3ZA 3O1JC 4ZCMA 1Q3TA 1GAQA 3CB4A 3M34A 3NWBA 4LXHA 1C1XA 3BMCB 4NESA 3DT6A 3AVTA 3NW9A 2ZRLA 3D8RA 2YTZA 3GH3A 3WLMA 2Q9UA 1YJXA 3G2IA 2JCXA 4Z8YA 5A4AA 3I92A 2MMGA 2PTGA 1YRAA 3KR9A 1Y1LA 3OHMA 4JR1A 2PUFA 3L8DA 4BNDB 4DADA 3NYAA 1JLKA 4IMJB 3OQJA 1TJYA 2ZRBA 3KCQA 4F9TA 3BYZA 4R1NA 3ZU2A 3CY6A 5IJAA 3SZUA 1UC5B 5ESDA 3F6CA 1BD3A 4B46A 2RH4A 4LI3X 1DARA 4X6XA 4F3NA 2LTAA 4BNMA 2JGDA 4PU0A 1U6JA 3BQMB 3PR2B 2WA2A 4Q6BA 3SF8B 2OD2A 4FW9A 4RQAA 5KSWB 2MMCA 3GYGA 3BL5A 5T4BA 2UVQA 1NBOA 3LFHA 2Q7DA 1HYHA 5HCIA 2Q8PA 3QDCA 1S8JA 2FOLA 3QBTA 4J0EA 1E18A 3PD0A 2X6QA 1U90A 1W52X 1BMQA 2EW2A 3A70A 3KU1A 1G5PA 3IP8A 1AUPA 4B3HA 1KMCA 2OHXA 2OWEA 2ZRQA 5C7IO 5DCWA 2AVNA 3LNTA 3R7AA 1WSWA 2VC2B 3NOXA 1IJFA 4K5YA 4EHNA 4U8HA 2H16A 1DPGA 1UADA 3UYLA 4JUBA 2BI8A 4LFCB 3BMNB 2VUHB 4XDZA 3HI6A 5B6ZA 2Y1LA 4ARZA 4A36A 2QSYA 3OX2A 3ZLJA 3ISJA 1YJAA 1EMDA 5HFAA 4I5EA 3ST7A 4GPAA 1C3WA 1C8RA 1RWPA 3DO6A 4PYRA 1C8BA 1PS8A 3IAAA 3H8VA 3H5VA 1CFZA 2O3UA 2AQKA 2W98A 3DEKA 3N2YA 3O93A 4K9DA 5A3RA 3KWFA 4EO9A 2IIQA 2WP0A 4OA5A 4Q24A 2OWDA 4Y0VA 3TX2A 2VAMA 4KHPB 3KR1A 1VA4A 3PIIA 4M9ZA 3SIWA 3AY6A 2HLNA 5G4KA 1C1DB 3HN7A 3OU6A 2A0UA 4O1HA 5FFMA 4X65B 3U7HB 5TY0A 4FI3F 1D1PA 1LPSA 1TQDA 4BP1A 1NY6A 4AKSA 1BFKA 3OX3A 5FBRB 2A92A 4YPFA 4MGEA 1T1GA 1OILA 2NVWA 4XIJA 1I3KA 3Q3VA 4FWBA 3D3EA 2LNLA 1A1SA 4JT4A 3VYVA 1A9OA 2DHDA 3O8DA 3GAFA 4UBIA 4H15A 3EYWA 5CA0A 2VS1A 2BRUA 4K03A 1E60A 1EQUA 4LZAA 1DRWA 3TQQA 1IG3A 1I4LD 2AOXA 2C2KA 1U2EA 1M8KA 1FFAA 2FTKE 4GQAA 3RJ5A 3M4XA 4M6WA 2CXNA 3PJRA 1F14A 1KU0A 1N2XA 1CIJA 1X7XB 3N2NA 1VLZA 5D5HA 3AQIA 1TIBA 2QM7A 5BYAA 2ZU6A 1FK8A 3HCNA 2GUWA 2IYNA 2F1JA 1TW3A 3QITA 4WOKA 2JATA 3HGTA 1ZIXA 4PRZA 1Z74A 1B0UA 1PFWA 4H6PA 2I2XB 1X8JA 1IZ9A 3PWHA 1Y6RA 5I7WA 4JKYA 4AQYB 1U4OA 3ESCA 4M8LA 5I9MA 2QP4A 1WTAA 1LS1A 5IN4A 2AYXA 1P2FA 2F8TA 2OTCA 4JP2A 4DS3A 5A9SA 1I51A 1IMOA 1X1TA 1KO7A 3RIMA 3CNBA 4RS4A 2Y03A 1FPQA 5BV1A 3RGWS 3ZTYA 4YAWA 4JI8B 1E9RA 2BCEA 3ZV6A 2NV2B 1V5WA 4GM1A 3NHFA 1MC5A 1RWNA 3R7WA 1GG2A 2OHOA 4L85A 4S1TA 5DLPA 1H94A 5K0NA 2UXDB 2KLHA 4NFYA 3PNPA 3PZRA 5KOYA 4IDFA 2QM0A 4JLBA 1ZRHA 4G63A 4GGOA 5KBYA 3AKYA 2QZ9A 2ZDQA 1PTKA 4S0ZA 5LSAA 3I45A 4ZCIA 5JQGF 4F5WA 5LB4A 1JR3D 2CYAA 2OCXA 1UZMA 3VO8A 4LWOA 3WDMA 1NOIA 4R84A 4CODB 2PV7A 2AG8A 2VHUA 2B3DA 3L82B 1S0UA 5JJKA 2BCJQ 4AMJA 4QBFA 4IRUB 4PAQA 3MD9A 3LYLA 1VRWA 3DGFC 1H93A 3KKKA 4IAOA 3RFFA 2YFQA 1U7DA 3OIUA 1SVSA 4OFZA 3G0HA 2L2QA 4G84A 3ZV5A 5BNZA 2D5IA 4MVWA 4DR6B 1LY1A 1Z4NA 5DLDA 3PFGA 4URWR 2YNMC 3ZW8A 3E9DA 1PJ8A 5DXJA 4V0OA 4ZVSA 2DE0X 4OLHA 4WCFB 1B6TA 3C3PA 4DEVA 1YQDA 4KQCA 1RQ2A 3Q2IA 3SR0A 4D8TA 4DVJA 3IHKA 3HMKA 4HNGA 3ZS9A 1CKEA 2H1LA 3CBQA 2B9EA 4NTZA 4BE7B 2RDMA 4BUZA 1AV6A 5EPOA 2JB9A 1L9HA 2JVIA 4L9AA 4JLAA 3GFBA 1BC5A 3EXIA 5F1YA 5TVKA 3UW1A 1U31A 3SJZA 4A73A 4D4IA 4DA4A 1Q1AA 1NSFA 5DLYA 5HQTA 1QHSA 3UUGA 4KVAA 3C7CB 3PXDA 2NVUB 3A9SA 2XE4A 3KHTA 3GCXA 1JTEA 1HDCA 1R4NB 2D2FA 1XTSA 3N39C 1OXVA 4KQ9A 1IBRA 5DULA 5AW1A 2Q9CA 2UXCB 3V7NA 4O4HB 4QAQA 2ZIFA 3VSCA 3ADKA 3NH6A 1GTL1 3EZ9A 4RA6B 4WCVA 3KKLA 2B1GA 4ZAZA 5IEBA 3HCPA 1U6IA 2AYYA 5IX8A 5C0OE 2DLCX 1VYTA 4TYQA 5EPUA 4W5OA 3KJZA 4UHHA 1VPWA 3CCCA 2CHQA 2EFGA 1T4DA 1ZN7A 3KLPX 1UBHS 2BFEB 3K1AB 4AWAA 4YHHB 4K6MA 3LHIA 1BX3A 5IM4A 2H4WA 2CK3D 3CN7A 1SUIA 2DKOA 3A05A 3QWFA 3HVRA 1XAGA 3ANTA 3DPIA 1V8OA 3MUOA 5GJWC 5EKTA 3LJKA 3VISA 4EB0A 2B2CA 1FUYB 1XTQA 3ZDYB 3A1NA 1BEZA 1RYBA 2PBFA 1HEYA 3IP5A 4V0SA 4CMGA 2WIFA 1DQNA 2A0KA 4KDFA 5BURA 1USGA 2FX2A 1X9GA 3F0TA 1I2BA 4OBWA 3ILSA 4YEDA 3LXRA 3SIRA 5JYEA 1FY2A 1ZM2A 1OBCA 1OFHA 3QG5A 1MJNA 2F4NA 3A4LA 4BLRA 2IDZA 1U2GC 4K9PA 2Z6VA 4EA7A 4PR0A 1FNMA 3W3AA 3OQIA 1MLDA 2LKDA 4JI1B 4TRJA 4EF5A 4YJGA 1WY7A 4WY5A 3VNRA 4BVJA 3K0HA 5DHHA 3BGIA 4AJ4A 4CBVA 4HAUA 1EX7A 1IUOA 1J70A 1PZHA 2NQ8A 2ZYTX 3AHGA 4NONA 4LWZA 4BKUA 1LDBA 4R01A 3SVTA 2G08A 2GN1A 3VZQA 5L3QB 1U3CA 3KJFA 1J5EB 4FMCF 1KJJA 3KPYA 3KP1A 2X1HA 2XQVA 2YJ3A 4AROA 1CVLA 3WRVA 5LPNA 1IPFA 1JI3A 1MVNA 1N3LA 2FPWA 1IEQA 6CHYA 1PQ4A 4L8LA 4ZDWA 5JH7A 2O8CA 3LPCA 3PC8A 5KYXA 1MO6A 3LCVB 1LTHR 2QR5A 1JHMA 2AK2A 3GY0A 3IUBA 4WOJA 3SG0A 2XNSA 1U94A 3UC9A 4X24A 1HLDA 3H1BA 5TB5A 3VJMA 3HKCB 5AW4A 3RU2A 4K9QA 5F12A 2FFHA 3I61A 5LUBA 3QE0A 3GNTA 3H87A 4F38A 2TMYA 2FN4A 1Z8HA 1C9KA 5AM5A 5F7OA 4KXNA 4X7MA 4E03A 3KYIB 2PD6A 1ECGA 5E6RB 4UUAA 3AL2A 4LDNA 4RDCA 3W1VA 2FN9A 2VYND 3I2JA 3AFNA 3SWWA 4R16A 1UDWA 2QQGA 1UF9A 3T41A 1UMBB 5EERA 4B83A 1R4NA 5D7BA 4FGWA 5KVVA 2XB8A 2BEWB 1FS6A 1ZJYA 2J5BA 5HQJA 3H4VA 5TPZA 2MJLA 1VLLA 2XUHA 1F0NA 3QQPA 3KWJA 4X85A 3QLEA 4AS3A 1TMGE 2PGAA 2CXTA 1MMFB 2ZSBA 4HFRA 3BDVA 1IOLA 5ALHA 4GPEA 4A8JC 4CKXA 4AW9A 4R05A 5C8ZA 4CM6A 2I4LA 1FNSA 1W44A 3N2GA 2IXFA 2PD3A 3KDSE 3ZCPA 4QRYA 1UBMS 1VC2A 4HAXA 1XCGB 3MLEA 3SDSA 2Y1FA 2C5SA 5HUJA 1OZAA 1R4AA 2I0FA 4HVAA 3JRNA 4D56A 2AZDA 2PX0A 1YA4A 5L40A 4HXEB 1WW8A 4PAGA 4OK3A 3QUCA 1E7RA 2YWFA 3FFBA 1LDYA 3WS7A 5BN5A 1ODLA 5E2BA 1DAEA 5CJPA 4DV3B 2HU8A 4HZUA 4WK4B 4OQEA 1E3QA 1JMVA 3GCWA 5LYJA 4GXQA 4YONB 3NWEA 4EKYA 4ZI7B 2G7ZA 3UJBA 3KV1A 3Q9UA 4A91A 1BHJA 1M3SA 3L79A 1CW2B 2GN0A 1MUUA 3OIVA 1DWPA 1UXIA 2Z3WA 3JQBA 4P3YA 4KNVA 2LWIA 3LBYA 1OUMA 4QL3A 3GVIA 3DLHA 3JWGA 3F6YA 4R1UA 3LXMA 1A98A 4MEAA 1ACLA 1QQ7A 2VYFA 4NBSA 2JNWA 4MDYA 3HGMA 2W11A 4OL9A 1UXOA 3QBLA 4V0MA 5CXQA 1IY1A 1FUUA 5LMNB 2EL7A 2B5WA 2CSUA 3SEZA 3IHTA 3I2IA 1JKMA 3KVRA 2H17A 3CF6R 1Z6QA 4M1SA 2NTNA 4OXQA 1OE0A 5L4NA 3QI2A 1IUNA 4UBKA 1E8DA 1SURA 1PLLA 1YQTA 2AR0A 4DDMA 4RGVA 3B5EA 4UPVA 4JP8A 1QK3A 2V6JA 3LT1A 2V6MA 1G21E 4YMLA 1FMJA 4FKBA 1QGED 1GU7A 5G2DA 3L6OO 4HJXA 4CKWB 3LA8A 2Q3EA 3GPBA 4ZZ3A 3PFBA 3V3TA 1Z68A 3O74A 2V1XA 4BLSA 4RD1A 3PXBA 4LYJA 1Z83A 1KXZA 3G89A 3H05A 5JDIA 5H7XA 1NW6A 3WBJA 5EOVA 4H1UA 3MGCA 3ZLUA 4EFDA 2PQMA 2W2TA 5M5BA 2B83A 1SQGA 1PGOA 5SY6A 3QFCA 4TUYA 4B6JA 3EBLA 4ZI7A 4MA0A 5C37A 4V1CI 4FDUA 5F1KA 1BO6A 1SQ0A 2C00A 4FNAA 4JLMA 3ZCUA 2DYKA 3WKCA 3FYUC 2VFAA 2W2KB 5F5LA 1JQBA 3Q5GA 4TWAA 2CXUA 2EP7A 1SK9A 2PMCA 5IYZB 3AGQA 3C7TA 3IUMA 2NNLD 1VIAA 4Q1CA 5D5QA 3H1AA 3TAUA 4YR9A 1XTIA 4Z1MD 1DFHA 3MW8A 3BORA 4D41A 1WE2A 3ILVA 3OQPA 5FQNA 5K45A 5C7YA 3VU1A 1RVDA 1MD9A 4BFSA 5AHKA 3RC9A 3S28A 2XTAA 5HKKA 1HDXA 1V9LA 4N41A 2CF6A 5CNJA 3L18A 2Z57A 4EGSA 4TV8A 2QTMA 4Q12A 4FDMA 1NJ6A 3ZWXA 1O97C 1PHPA 2V6BA 4UQLA 1SIWA 3IMKA 3HEAA 4HYXA 1I01A 4Q4JB 1MDFA 5CDSA 1T5DX 2XMQA 2G5GX 3G2MA 4DA0A 3CS3A 1VPLA 5A1TA 1F2UA 3AOEA 4G23A 2QMYA 2VLBA 1SIBE 3E3MA 4R8MA 1DAPA 2Y2UA 3UGKA 4EI8A 2X4GA 5F5XA 3AI3A 2GD6A 3CUKA 1NTRA 1RIIA 4AMZA 5I45A 4H7IA 4X31A 1LBIA 5BO5A 4KRFA 2MSEB 1P31A 5A04A 1FF9A 1KYZA 1G5IA 1QP8A 1UDXA 2O2CA 3A6DA 3C5HA 3DAPA 4MW9A 2Y4NA 3TZEA 1DZEA 3QVJA 1JKJB 3LQYA 2IHJA 5DTMA 2QL9A 4GX0A 1L7BA 2D0DA 3A1FA 4N5IX 5H0IA 3SR4A 3TQSA 3UXHA 1MO4A 3S2FA 3HHEA 2GM9A 2ZYIA 3Q10A 4WY2A 4AJIA 9ATCA 3PEWA 3HCAA 1NMQA 4NJEB 1GLNA 3E7XA 3FPCA 2PR2A 4D9CA 3HBJA 3RANA 4FPXA 3Q0TA 5K1ZA 2VG8A 1EP2B 1G20E 4AF6A 1IDOA 3MMNA 2FSUA 4MRNA 3WXBA 5BP7A 1OLSA 4KX3A 4PG7A 4FGSA 4GOMD 3QX8A 4NG4A 3IQDB 4HMPA 1YMVA 1N92A 1XCLA 4TS3A 4UEJA 1TVMA 3LHKA 3QHPA 1BKSB 4W6QA 2EKZA 1OFGA 3IILA 1F3OA 1M66A 5KHOC 3M6FA 5A8EA 1FSSA 2FPGB 3F5QA 4EF6A 4EPTA 4DLLA 3STWA 2RG7A 2YN4A 3GQVA 3HR7A 1PGNA 3JW8A 4XD7A 3WMEA 2IYPA 4KRYA 1TEZA 5DZSA 1RAIA 2OCAA 4AZWA 2JIOA 4N76A 4GM4A 4Q6WA 3RVBA 1D04A 2X15A 5BR7A 1XQ6A 4DG5A 1JU3A 1UBGA 3HXQA 1N77A 3IT0A 2EJUA 1HG0A 3T35A 3U61B 5F77A 1NKSA 4KO2S 3OUTA 4LYFA 3I0MA 2FQYA 3F5MA 4WBXC 4D6YA 3KSAC 2ZSJA 1XTVA 4Q7LA 3GGDA 4OAPA 3QKUA 2PNJA 5CHEA 3BBLA 4AJ2A 2ERYA 1AQLA 2EJWA 3ZXXA 2O2HA 2IX3A 4RPHA 1IATA 2OFPA 1NXVA 3ETJA 4HNTA 4N7BA 5IASA 1N3YA 1N1DA 4HC4A 4UHBA 3UG6A 1ZW1A 4JLPA 1IE3A 4HBGA 4B7CA 4C7JA 3QEOA 3RODA 3OSZA 4J94A 4YRAA 2MSLA 3OJ0A 2BTQB 1EXWA 3P94A 3KT3A 3CVWA 4A16A 2NXJA 1GPJA 2FPPA 5KVQA 3IBSA 1IEXA 1Q1ZA 4HO1X 1R50A 2ZBVA 3EGIA 3TPFA 2NIPA 1ZPDA 3P2OA 3UOWA 1KGDA 4WUTA 4E11A 3MJEA 3LQ4A 2EGUA 1OHHA 4HAOA 4WA7A 2FPXA 1M2HA 2P8JA 2QRPA 2FWMX 3H2YA 2O2EA 4G5OA 2VPWA 2PYZA 4NENB 4Y30A 4AWXA 4QYXA 1XFAA 2X86A 3KOXA 4JVMA 3UGTA 4AFNA 1E32A 1F8FA 2VSFA 4PZPA 4IH1A 3WB1A 4MW4A 1QF9A 1P5JA 2CLFB 3HJCA 4U7WA 3KZNA 3ONVA 4L73A 4NI5A 4WXPA 3WWOA 2PUJA 2R2AA 4FQ5A 5BN3B 1GOTA 1FOEB 1UPCA 1JVBA 2CMGA 3RWOA 4N82A 3E2IA 4Y9SA 1LPBB 5DCLA 3N0RA 4ZRNA 2H2WA 4KODA 3RC1A 4I5GA 1JMYA 4G5XA 5DBGA 1AQJA 5ILGA 1R74A 3PXAA 3IKJA 1W0CA 4LVOA 2XUIA 3LC0A 1T29A 1OXUA 3D1JA 2O8EB 3VPCA 3Q6IA 3WC4A 4UDOA 1T5IA 4G86A 4CL3A 1NDUA 4WL0A 1BMFA 1TTQB 4DC9A 1AMOA 1OAOC 4XASA 2V7PA 3A1CA 4PTZA 4QBGB 2QJOA 4LY0A 2J3QA 3KYBA 4W5TA 3VMMA 3AUSA 1SG0A 4F2HA 4ISCA 1WETA 5BW6B 5JAPA 3KE9A 1BAPA 2D7JA 1GRRA 1W96A 5IAGA 4OXIA 4XUCA 1JHPA 1CUGA 5KQMA 5D8DA 5H2OA 1EYZA 1F5NA 2JCSA 1K4KA 1X39A 2NSDA 3QELA 1YKFA 3DOUA 2P9HA 4JOCA 3M3HA 3H9JA 1RM0A 1DX9A 1NONA 3N6VA 3PUJA 1LV8A 2C58A 5CP8A 5AOAA 1N6KA 1YBFA 1EX1A 1RI1A 5EJIA 1OWPA 4PLTA 4X93A 3CFYA 4BZZA 2D5LA 4LY3A 2DT5A 3G0CA 4WDQA 1MRNA 2QVXX 3AR6A 3CLTD 1EPUA 1VSTA 4MO9A 3GLFE 4Y18A 3QUBA 4AZ3B 1X1CA 1CJVC 1U5CA 2ZBUA 3L8FA 1LSOA 3EZYA 2DFDA 4J3JA 4L50A 5FNVA 4NECA 5CFPA 7MDHA 4DIKA 3O4RA 4M22A 1JBQA 1P18A 2P41A 3GFOA 3IOMA 4RSGA 2ZPAA 5TJ9A 2BFMA 4LNUA 3T9BA 5FAKA 1PBTA 4Q1FA 1M2VB 2IHVA 4PR3A 1FJ2A 3U39A 1N6NA 3I9FA 3RK4A 4JWTA 4BGVA 2OQRA 1REQA 4Y1EA 1WMBA 3UENA 3RDPA 1PFKA 1ULSA 2CLLB 1XA3A 2C9YA 3NHSA 4UG2A 1U6KA 2BV3A 2PXXA 3LX6A 1QK4A 5DNEA 4WK0B 1M2NA 1NULA 1NW8A 4D9FA 5HS6A 5JXWA 2BKAA 1BRMA 1VGQA 5C8YA 3MTDA 5DFAA 3P9QA 2D54A 3AY0A 4HFNA 4C7OB 4RA9A 4MULA 2WJWA 3HCRA 3RADC 1KEZA 1W30A 4GXNA 5JFGA 2F1OA 4FYYA 4OXNA 1AXGA 4XRGA 1A5TA 4BX2A 2B9VA 1ECBA 1PJRA 3OH8A 4I5FA 3N28A 1BX0A 1L4HA 4MWSA 1C7QA 3BD9A 1LLUA 1WABA 4LCEA 5DU2A 2GZMA 5L9AA 4K28A 2EEZA 3PD1A 1E77A 1M75A 5KUTA 3V4LA 2VBFA 3ZOKA 2GRAA 3F6BX 4LOKA 5ALLA 4RCYA 3L02A 4WESA 5C1BA 4JV5B 4UAVA 2I6FA 3TTUA 4JMLA 2YV1A 4Q02A 4AS1A 2HJSA 2IODA 4QYMA 3ZE0B 4EW3A 3RSSA 1YQWA 4QSMA 4XYGA 1GT6A 3DONA 3R1IA 1U7ZA 5K8IA 1WQ1R 2ILVA 3QJRB 1LK5A 5KVAA 3RAGA 4YRQA 3A10A 3R3WA 4KQFA 4PAMA 5BWMA 3NM6B 3IP3A 3TNFA 5D01A 2GUGA 3CF4G 3DEZA 2HQRA 2VP6A 3WP0A 4EG4A 4RKRA 1BM1A 3K8YA 2I9KA 1NHWA 4B71A 1QYVA 3NQ41 1DEKA 5I4BA 5A4JA 3PJDA 3JQGB 3SU8A 1LNSA 3WHLA 1E0PA 5JMTA 3HG7A 4RY8A 1J9GA 1YV9A 3FNBA 3KNZA 3MWJA 3BJIC 3MWKA 4OY3A 3TZQA 5AHXA 4I36A 2WIGA 3MT9A 4Y1RA 4D02A 4BMDA 1S4MA 1XZHA 5ESRA 1EAYA 1SH7A 1TM3E 4FSHA 3H13A 4BQRA 1JKJA 2JKYA 5FNVB 2BD0A 1UP7A 4KZKA 2VF4X 2XCRB 1J8FA 2VYVD 1E0AA 1VB5A 2QTTA 4XM0A 4I4IA 4HQNA 3UV6A 2GTPA 1X8KA 2DBVO 3BE8A 3NKLA 4MVJP 2QR2A 5CVDA 5FTJA 8ABPA 1Y81A 4B85A 3F3SA 3E9QA 5F21A 2DLNA 4U7PB 4V02A 4WESB 5H82A 4G01B 4X1YB 1QHHA 1T0IA 1YULA 1ABBA 1JYEA 2QWXA 2OGUA 3NIWA 1N3BA 2FMFA 1XROA 1F2TB 3P9CA 2FPRA 2I1QA 2F1KA 1IY2A 1DC8A 2BC9A 3OZAA 2HBZA 2N46A 4RYDA 3UJ6A 1JSLA 4NIMA 3JZAA 1M74A 3OM0A 3AM5A 3TO5A 4F21A 2MTBA 4JLUA 1JFRA 3I72A 2V7GA 4C7OA 3LP6A 2JEZA 2NAFA 1V1RB 4D79A 4BGIA 5AK0A 4PHTA 1E8NA 2JRCA 4D4KA 5I4IA 3PT5A 4IF4A 4RK6A 1D8TA 4BO1A 2NU8A 1QRDA 2C83A 4LDOA 3OZVA 1XF1A 4UCFA 2JFOA 4GUAA 5CTJA 2I3ZA 2P68A 5KWEA 1R84A 2QRHA 3NBAA 1SIOA 1ZH2A 2F8MA 1YIAA 4GLBA 3M9XA 3DHNA 4KYIB 2GKOA 3DJFA 4NU8X 4S24A 5TNXA 2D62A 3TWOA 3OAAA 4F9FA 4TN5A 2UKDA 4Z7JA 1PYGA 3CCBA 4YRNA 3KZCA 1DMSA 3ZI0A 4KFRA 1U2DA 1ZJJA 4DUYB 2C42A 3LH5A 1PFGA 2VCHA 3AETB 4FGLA 4BRWA 1TLTA 3JPYA 3TZCA 5M29A 5MDHA 1GPWB 5AH0A 2JLUA 4NE2A 1NOJA 1ZJZA 4LMRA 1W36C 3FDIA 2VWQA 5EGSA 3MGKA 3SQOA 4IKPA 4A3SA 5IWCA 4DJ5X 1ZOIA 1WMSA 3C9LA 4G24A 4B6SA 1V1JA 4RTRA 3PNYA 5E0OA 3NYIA 1P17A 5CR9A 5T8KC 3SJ7A 1DRKA 5JR3A 1UMDB 3QFHA 3AFHA 3FD8A 4TMXA 5DDIP 1FVXA 2WT8A 3RRYA 3ECCA 4L57A 2DERA 3SXJA 4XFDA 3LYHA 4MD2A 4II3A 5LLSA 3D54D 4DBLE 3LWNA 4C6HA 4EFKA 1EFVA 1CF2O 1PS0A 1YACA 3ON5A 4POAA 2WT4A 3E23A 1BDMA 3L6BA 2REQB 3QLVC 4UU0A 3WFZA 4CM1A 3PWKA 5CITA 2YS6A 3KKZA 1WHSB 4X20A 2PH1A 4EHDA 1D0IA 3KOYA 4KXMA 3NDBB 2W90A 3EPKA 1DFGA 4KJZA 1U8EA 3U13A 1I2MA 1X7WB 1Y82A 3CLRC 2GPWA 4MB6A 3OFND 4C0JA 1K4YA 3IEUA 1KZ9A 3W4KA 1HLPA 1Z45A 3G0BA 3OP1A 2R84A 2C84A 2KW5A 2VF5X 2Q3DA 1F9EA 1NBMD 3QENA 4NV0A 1CZKA 5HOEA 5FAXA 1UT6A 4ZYYA 3BD8A 4NATA 3OWHA 2VPXA 5JG7A 4PAOA 2FV8A 4AC9A 1J0XO 4PO3X 2ZSKA 4OQQA 3MMPA 3I01A 4P80A 1O9HA 3D2AA 3PIRA 3FUWA 4HLNA 4MV7A 4XDGA 5DN6D 2FSVA 2P9BA 3CUSA 1PNTA 3QU7A 4HZIA 4IGFA 3QBDA 4N03A 3B38A 3C3EA 2ZUVA 2I7XA 5FFFA 5B6JA 5KJ6A 5HIMA 4N12A 1XJWA 5DW0A 4GR5A 2PKRA 1U0NA 4QRHA 4F45A 4EJ6A 5BT8A 3UMVA 3AV0B 4LRWA 1J6UA 4FCVA 3ZIAA 2X8AA 3FZQA 1RYMA 4L28A 5JY6A 3M5DA 4JUCA 1PGPA 3ENVA 5ALDA 3ZKAA 4PZYA 4EQZA 1BKDR 1HF3A 2YCZA 1ZOOA 3SFZA 4PINA 4ZTBA 3PHCA 4BMVA 1DBWA 1NVMB 2NQTA 2FG7C 4AZVA 3U31A 4DN6A 1R9MA 4OGFA 4WW3A 4P4TA 1UPFA 1PZMA 2E37A 3DAOA 1XZMA 1W4ZA 1OXMA 2YWRA 3GU3A 4J03A 3NHJA 1A8HA 1N6OA 3EQ9A 4MQ6A 1H22A 2QOEA 4PXAA 4YJ3B 4Z3DA 4OMFG 4EK9A 1YR3A 2QE7D 2X40A 4QASA 4EUKA 1KWGA 1I5RA 1Y1PA 1QP0A 1HNXB 4OHMA 3JRXA 1OB2A 1KIMA 3GDWA 2B94A 1AHIA 1SBZA 1B0ZA 4W5RA 2EFCB 5CA1A 1HDGO 4HV4A 4YJ2F 4CQMD 4URUR 5HXAA 1NWCA 1KAMA 2PT9A 1HE1C 4CMIB 1YZNA 1IAQA 4WZBA 1L5HB 4K2HA 4UDXX 2BFDA 2YJTD 3I09A 5HZMA 1B15A 1J9EA 2GEBA 2PT5A 4BV9A 1A96A 1R0RE 1XZKA 4XWYA 1T5SA 4XYEA 4D3XA 3IKLA 4C7BA 1ZM3A 3DV2A 4UDNA 3RUFA 2PJUA 4DG9A 4LMAA 4QQRA 2PANA 3ZBQA 1P9OA 3G7NA 4YCSA 3STHA 1A2QA 3PHJA 3FVWA 3WGYA 1ZC4A 2BJWA 1N5MA 2WNIA 1YB7A 2PPLA 1WOMA 3PDJA 3Q1KA 3T1TA 3GVCA 4NOJA 3KSMA 4KTVE 4O29A 4XT1A 5H2KA 2H29A 2ZZKA 2CJFA 3DM9B 1DHRA 3WA6A 5IULC 1J23A 4P3PA 3V8MA 3DZCA 2XGGA 3VVKA 3PE3A 3MINA 5FWYB 5FWAA 4MHOA 2F48A 5EQDA 1QOZA 3PGMA 5HMLA 1G1MA 5B4VA 4N0MA 2O0LA 3O26A 4E5NA 2V6IA 3U9TA 5ILOA 4OAQA 2PZEA 1QANA 1YDMA 1QFMA 3RARA 4LJ9A 1R8SA 3GGSA 3NDJA 1QNFA 1U2SA 2FXIA 1JLSA 4FEAA 1DRUA 4G1VA 3H18A 1BDJA 1CR1A 4PS1A 1L9KA 1RQGA 4TXLA 5I51A 3FTFA 3O8LA 1A76A 1G60A 3LK6A 5AKLA 3T1VA 3SXUB 5AVJA 3BK2A 2R1UA 3TFQA 4ZI5A 3VOAA 1LC3A 2IRWA 2WUEA 3F6PA 4U2DA 3KVOA 1OY1A 3IR7A 5CBPA 3OPYA 4C88A 1G8SA 4TYPA 2FCAA 2VT6A 4JNCA 4ALJA 3PPYA 3SC2B 3CX7A 2ZBEA 1RFLA 1T8UA 5KOHB 3KKOA 1G291 2CUTA 1XK7A 4FPDA 4HX9A 1OR8A 3PQ8A 4PN7A 1JBKA 2GAIA 4X44A 5DBOA 1Z39A 4ZYWA 1Z0JA 2AB0A 2YZ7A 2KSAA 3ED1A 4ZVLA 1NMSA 3QNMA 4YI3A 2EFHB 2ZROA 2CXHA 1XEXB 3G6KA 4UARA 1BE6A 3O03A 3AYXB 3DZKA 2PSEA 4OXXA 2AT1A 3TW6A 2J3JA 4K0RA 2ZAGA 3W5SA 5BR1A 3R6LA 2AD1A 4RVDA 3DDCA 4YC7A 5IAAA 5DHQA 1PWHA 4QXOA 1NC1A 1NQVA 1W47A 3GNQA 4A0QA 4E2WA 5AVYA 2DUWA 3OOEA 3NTOA 4TWBA 4RS3A 4JEIA 5AESA 2WTUA 1SBCA 3P2KA 4YUZA 1K92A 1QIMA 2BYTA 2N9UA 2BKLA 2FUCA 4YJDA 3BE4A 4YACA 2KS6A 3PYMA 3R0XA 4XQGA 3RLIA 4RBNA 1KOGA 4KWTA 4P08A 3W5DA 4UW9A 4E7OA 2N47A 3VU8A 2DFVA 1W9HA 4IDHA 1XRQA 3DCNA 4KHZA 3BFPA 4QDZA 4FIZA 5EXTA 4WKPA 2F95A 1S8AA 2WTAA 4RJTA 4G7SB 2XWSA 4M1TA 3U4MA 3EQZA 2CZQA 3IAUA 2HYDA 1QTRA 1BU5A 5FYDA 1BYUA 1CP2A 4C2BA 3EAFA 4US1R 4MKGA 2ZYSA 5LQMA 2ZJFA 4JKVA 3VR3A 4BO0A 3DOHA 2I1VB 4JSYA 1BRDA 5HJ2A 2FRDA 4WECA 2X8LA 2VDKB 3C16C 3LCRA 4RXUA 3UAVA 2HBQA 4EQ6B 4W5QA 1FYVA 1N5DA 4RF5A 1TFUA 4ZWNA 1AQYA 1C0PA 3LVRE 3EBPA 4OI1A 1XTTA 1Z07A 1RC8A 4D74A 2K2WA 4ZREA 2AT9A 3HAOA 1ADYA 1TF2A 2NZXA 3QEBZ 5IW8A 1VJ5A 2I2FA 3HJRA 1JQJC 3CRMA 1TCAA 3QBKA 4J16C 1XRRA 4EA8A 2Y6VA 4X62B 3FYDA 3IFSA 1Q0TA 3WLRA 1OU4A 3SFVA 1LZLA 3ZE6A 4B3RB 2CMDA 2P4HX 4XD2A 3IOBA 3RVMA 5KEIA 3KR2A 4XCXA 1P1HA 1R6XA 3T1YB 3I62A 3FSJX 4RKFA 5AXDA 1QRRA 2Y68A 2O7QA 1Y3BE 5D5PA 4REOA 5E2IA 4XTCS 1GY8A 1UBNA 4FGJA 2WSBA 3RYIA 1LDNA 1RLIA 2YFKA 2AVDA 3SE0A 3T5MA 1YC2A 1VL8A 2BGJA 2VT2A 2GI4A 1QIGA 2R6AA 4Y6QA 1NUPA 2P67A 4UVHA 1HT2E 3NX4A 4TLAA 4ESEA 2ZSEA 1ZHOA 3MQFA 5ITCA 3S8GB 5J7AA 4IS3A 3HA3A 3KCNA 1DAHA 5I01A 2W0SA 1SHTX 4MS4A 5JCXA 2Z8YM 3BFJA 2OO3A 3AV3A 1FDOA 3F78A 4TT8A 4B33A 1LQTA 4ZICA 3OM1A 1YSCA 4KFSA 3RC7A 3RO7A 4AKIA 2HT1A 4LPSA 1E9BA 1SUCA 2HJHA 4INJA 3WLOA 3UZAA 4ENRA 3GLIB 3LPNA 4URVR 1MVLA 4MP8A 4BE9A 2JW5A 1XN1A 3JD3A 4PZ0A 1CV2A 3P27A 1RAEA 2JHAA 1RHQA 4UTNA 2A30A 4EZBA 4BGEA 1VECA 2YCYA 1ZSNA 2X2OA 1UM9A 1Z5WA 5FUBA 3EGDA 5CK5A 1UPAA 2DBZA 3B1ZA 5CVEA 4DKLA 3IEPA 4WN9A 4MS1A 2PNFA 5J4VA 1JF8A 3IPCA 4B3TB 4GX2A 3E05A 4MQEA 4MQUA 4AXXA 2O8FA 1OBHA 1MJGA 3BICA 5EINA 2O0MA 5KTKA 3U6BA 2BL4A 1M76A 3U44A 5G3YA 2QROA 2W6JA 3DG9A 2CXPA 2HFJA 3QFRA 3LLMA 3R3ZA 2C0CA 1WBDA 2VTKA 4PHGA 2Y1KA 4S1PA 3VUFA 2RGCA 2O4UX 3WLTA 3IV9A 4HL6A 5DEIA 4MINA 5CJJA 1P1KA 1KR5A 1WW2A 3K0CA 3PHHA 4GPBA 3ZE7A 2D8AA 4X41A 1CDZA 1YOBA 2RKOA 3A3KA 4ILEA 4AJJA 4PG4A 4PM4A 2XCOA 4RHCA 1C1DA 5REQB 3EZFA 5EZYF 1WL8A 2VA8A 3RIYA 4A0FA 1D07A 4NCKA 3ZWVA 4YT4A 1UIMA 3GFFA 4TVOA 1EZ4A 5JFOA 2ONCA 2XUPA 4DSUA 4YUWA 2EQAA 3T9CA 2ZYWX 2Y0BA 2ZSIA 3QX3A 1M2OA 3GFSA 3V4ZA 1N9ZA 4U02A 3RS3A 2QU7A 2IW1A 3TLBA 3B1JA 4BNWA 2NGRA 1KYIA 4U39A 5EESA 3W9BA 2UUCB 4KI7A 4GMHA 1DL5A 2P3QA 1V8FA 4YJ2A 2OZKA 1PD0A 2W7TA 2ZFUA 2WA1A 4G0ZA 4HDNA 2I3BA 4DKXA