5GRAA

Crystal structure of trmj from z. mobilis zm4
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
Knots found
sequence length
232
structure length
224
Chain Sequence
AVPAIILVRPQLGENIGKAARAMLNFGLDDLRLVAPRDGWPNPSAGPAASGADRVLQQARVFPTVAEAVADCAHVYATTVRKRGVTKPVMTPEQAAQTIHEQEGGVGILFGPERAGLETDDVALARTIITVPVNPEFSSLNLAQAVILVAYEWSKGQDMEPPAPQEELEAMIGHLENMLDKNGYFFPIPRIPTIKRTLRTLLTKPSWNSMEIRTLRGVLSTLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An asymmetric dimeric structure of TrmJ tRNA methyltransferase from Zymomonas mobilis with a flexible C-terminal dimer
pubmed doi rcsb
molecule tags Transferase
source organism Zymomonas mobilis subsp. mobilis zm4 = atcc 31821
molecule keywords tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ
total genus 70
structure length 224
sequence length 232
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase.
pdb deposition date 2016-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...