5L3Pz

Cryo-em structure of stringent response factor rela bound to ermcl-stalled ribosome complex
Total Genus 127

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
Knots found
sequence length
802
structure length
545
Chain Sequence
EFDPEKWIASLGITSQKSCECLAETWAYCLQQTQGHPDASLLLWRGVEMVEILSTLSMDIDTLRAALLFPLADANVVSEDVLRESVGKSVVNLIHGVRDMAAIRQDNVRRMLLAMVDDFRCVVIKLAERIAHLREDERVLAAKECTNIYAPLANRLGIGQLKWELEDYCFRYLHPTEYKRIAKLLHERRLDREHYIEEFVGHLRAEMKAEGVKAEVYGRPKHIYSIWRKMQKKNLAFDELFDVRAVRIVAERLQDCYAALGIVHTHYRHLPDEFDDYVANPKPNGYQSIHTVVLGPGGKTVEIQIRTKQMHEDAELGDRIAWLRKLVFDDRVYVFTPKGDVVDLPAGSTPLDFAYHIHSDVGHRCIGAKIGGRIVPFTYQLQMGDQIEIITQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (18-27)AH2 (31-48)EMPTYTII1 (48-51)AH3 (59-73)TI1 (53-56)TI2 (85-88)TIV1 (87-90)TI3 (88-91)AH5 (96-101)TI4 (89-92)AH6 (105-118)TIV2 (101-104)TII'1 (133-136)AH8 (168-178)AH9 (181-187)TIV3 (178-181)AH10 (190-204)AH11 (206-217)S1 (245-249)AH12 (220-241)TIV7 (301-304)3H2 (265-267)AH14 (284-297)3H3 (272-274)S2 (277-281)3H4 (308-310)S3 (306-307)TIV8 (313-316)O2 (324-326)S4 (320-324)TI5 (326-329)AH15 (338-346)TII'2 (346-349)AH16 (372-380)S6 (405-409)S7 (415-419)TII2 (419-422)AH17 (424-431)S8 (439-444)TIV9 (443-446)S9 (447-449)TI7 (450-453)S10 (461-465)AH21 (518-534)AH20 (494-516)AH4 (77-85)3H1 (136-139)S5 (331-337)TI6 (410-413)AH22 (537-546)AH18 (433-438)TII3 (456-459)AH19 (487-492)AH13 (254-264)AH7 (144-159)Updating...
connected with : NaN
publication title The stringent factor RelA adopts an open conformation on the ribosome to stimulate ppGpp synthesis.
pubmed doi rcsb
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
source organism Escherichia coli
total genus 127
structure length 545
sequence length 802
other databases KnotProt 2.0: Artifct K -31
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2016-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
z PF02824 TGS TGS domain
z PF04607 RelA_SpoT Region found in RelA / SpoT proteins
z PF13291 ACT_4 ACT domain
z PF13328 HD_4 HD domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.