5OGOA

Crystal structure of chimeric carbonic anhydrase i with 3-(benzylamino)-2,5,6-trifluoro-4-[(2-hydroxyethyl)sulfonyl]benzenesulfonamide
Total Genus 79

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
Knots found
sequence length
258
structure length
258
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNVGHAFHVEFDDSQDKAVLKGGPLDGTYRLFQFHFHWGSLDGQGSEHTVDKKKYAAELHLAHWNTKYGDLGKAAQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTHPPLYECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
3H1 (13-18)3H2 (21-24)AH1 (131-135)TIV2 (25-28)TIV7 (251-254)S1 (32-33)S8 (108-109)TI2 (34-37)EMPTYS2 (39-40)TI4 (41-44)S6 (78-80)S3 (48-50)TI5 (51-54)S10 (116-124)S5 (66-70)S4 (56-61)3H5 (164-166)AH3 (220-227)TIV3 (62-65)TII'1 (81-84)S7 (87-97)TVIII2 (98-101)TI6 (100-103)TIV4 (105-108)S9 (112-113)S13 (191-196)TIV5 (108-111)3H3 (125-128)O1 (128-130)TIV6 (137-140)TVIa1 (200-203)S14 (207-212)AH2 (158-163)TII1 (169-172)S12 (172-178)TII2 (176-179)3H6 (181-184)S15 (216-218)TII3 (233-236)TVIII1 (18-21)S11 (141-150)3H4 (155-157)TI1 (8-11)Updating...
connected with : NaN
molecule tags Lyase
source organism Homo sapiens
publication title Crystal structure of chimeric carbonic anhydrase I with 3-(Benzylamino)-2,5,6-trifluoro-4-[(2-hydroxyethyl)sulfonyl]benzenesulfonamide
rcsb
molecule keywords Carbonic anhydrase 2
total genus 79
structure length 258
sequence length 258
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2017-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.