5WWNA

Crystal structure of tsr1
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
Knots found
sequence length
705
structure length
531
Chain Sequence
AAKIITIVPLVNDLDPLDILYKLLKCADDEGIMVQKRIFNVHIKKFKSNLKIIIPDMTNFLNILDCAKVADFVVFGLSGVQEVDEEFGEQIIRALELQGIASYIGVISNLSAVHEKEKFQLDVKQSLESYFKHFFPSEERVYNLEKNSDALNVLRTLCQRLPRSINWRDNRGYVVADFVDFVETSPDSGDLVIEGTVRGIGFNANRLVHIPDFGDFQLNKIEKEERQLREFRDMEKEDREFPDEIELEPSESAIERLKRYRGLKNLYNCDWQVDEKRLLRIGNYKNTKNRIIKETKNEAQAIAGDRIRMFIRFPKFLLEKIQDPKQLLFAVYGLLLHEHKNAVVNFSLQRWEQYDKPVPSQEPIVVQYGVRRYTIQPLFSQGPNNVHKYERFLHPDTVSVATCIAPVDFTQSPAIFFKPSPAKNIELIGHGTFLNADHSRILAKRAILTGHPFRFHKTVVTVRYMFFRPEDVEWFKSIPLFTKSGRSGFIKESLGTHGYFKATFDGKLSAQDVVAMSLYKRMWPMPSLPWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular architecture of the 90S small subunit pre-ribosome
pubmed doi rcsb
molecule tags Rna binding protein
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule keywords Ribosome biogenesis protein TSR1
total genus 133
structure length 531
sequence length 705
other databases KnotProt 2.0: Artifct K -31 -31 -
ec nomenclature
pdb deposition date 2017-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04950 RIBIOP_C 40S ribosome biogenesis protein Tsr1 and BMS1 C-terminal
A PF08142 AARP2CN AARP2CN (NUC121) domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...