5X2PB

Crystal structure of the medaka fish taste receptor t1r2a-t1r3 ligand binding domains in complex with l-glutamate
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
Knots found
sequence length
470
structure length
453
Chain Sequence
PNWFNNISTDLFSMPGDIKLGGLFPIKEQSSVSCDSLNKDGLGRALVMKYAVEEINANSQLLPGVKLGYKIYNTCRHSAVIVRPALSFLTEKSNGTLSVECNYTDYETDMVAVIGPQSSEMVTVIGKLLGFFLMPQISFGATSDKFSDSLVYPSFFRTVPSDIRQVDAMVQLIKKFNWNWVAVVGSEEEYGQQGVQQFSKKAEDMGVCVAYQGLIPIYDDPKPAIQTIINNIQTTEVKVVVVFSLVSPAVSFFEEVIKKNLTGVWIASSSWAISDKVYSLPNIDSIGTVIGFIDETETLELLSPFTEVLFKKIHEASPTYNPCPECWSLSPANVSLVKEESVQRTAFSVYAAVYTVAHALHKLLECNSAACKWSSSTRLYPWKLLEVLKEFSVNISNTSLKFDQNGNPNIGYSVIQRIWENQSLSSVGSYRSANLSINETLFKWYTNNSEKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/immune system
molecule keywords Taste receptor, type 1, member 2a
publication title Structural basis for perception of diverse chemical substances by T1r taste receptors
pubmed doi rcsb
source organism Oryzias latipes
total genus 152
structure length 453
sequence length 470
chains with identical sequence D
other databases KnotProt 2.0: Artifct S -31 +31 -
ec nomenclature
pdb deposition date 2017-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...