6EMUA

Crystal structure of dual specific trm10 construct from thermococcus kodakaraensis.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
Knots found
sequence length
175
structure length
170
Chain Sequence
WPYFIIDLYHWDKHTQKEKGKIALQVNQSYGLLRDYFELAVTWANEEFREMFHGPLDRITTYGGPTSEFLKENGINEVVLLDPWAEEVLSEKDFDVKAFIIGGIVDTNKKKTTPKIGEELESAGIKVRRRKIVLRGDVVGVPDRINRILGIILKMMVEGKSMDEAVYEMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical analysis of the dual-specificity Trm10 enzyme fromThermococcus kodakaraensisprompts reconsideration of its catalytic mechanism.
pubmed doi rcsb
molecule keywords tRNA (guanine(9)-/adenine(9)-N1)-methyltransferase
molecule tags Rna binding protein
source organism Thermococcus kodakarensis
total genus 57
structure length 170
sequence length 175
chains with identical sequence B, C
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.218: tRNA (adenine(9)-N(1))-methyltransferase.
pdb deposition date 2017-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04252 RNA_Me_trans Predicted SAM-dependent RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...