6KJ0A

Bifunctional xylosidase/glucosidase lxyl mutant e529q c2221
Total Genus 256
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
256
sequence length
756
structure length
756
Chain Sequence
QWPAPLANGGKSWASAFKKAKATVTEMTVEELANITSGVIGLCSGVTGAVTRLGIPEFCLQDGPIGPRGVHGSSQFPAGLTVAATWDRTLMYARARGMGQEFHDQGVHLALAPVTGGPLGRTPLNGRGWEGTFADPYACGEASYLSVKGLTDAGVATVSKHWIAYEQETSRNLYIDIDGVSQADIQLPISSNVDDLTMHELYMWSFAEAVRAGTNHIMCSYNRINNTHSCSNAKGLNQLLKTELNFQGGVVSDWGGQWDSVPAAENGLDVAMPGKGFLGALGDFWGATLVELINNGTVSEDLVRDKAVRILTGYYYLGQDTNPPPPFVYNTIGAPTLNATSGYRNVRKPGTAELIKEIGSASVTLLKNTGSLPLKHPQRIAVLGNDATYNVLGPNACGLANSACDIDNLNGTLTTGGGSGSALSPYTITPLEALQKRAIEDNAEIAAVVANSNTTTGAEDAIAALLPDADVTFVFLNRYSEQGADAPDFSLGGDGDNLMDLAVTYSSNVVVVIHTTGVVDIEKWADNPNVTAILVAYLPGQEAGNSLVPVLYGDVAPSGKLPWTWGKSIDDYVPNGVVYTDAYSPQSNFTEGVFIDYRWFDKMGITPRYEFGFGLSYTTFTYSNLIVDHGRWAKDYSSVMETAEPFAEWDGTNSLYDVIFTVFATITNTGNLTGSEVAQLYISIPGDNQPVRQLRGFDKIKDLPVGDSAVVTFPIRRKDVSSWSVVDQLWYVPNGDFLISVGGSSRDLPLNTTWTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta-D-xylosidase/beta-D-glucosidase
publication title Structures of beta-glycosidase LXYL-P1-2 reveals the product binding state of GH3 family and a specific pocket for Taxol recognition.
pubmed doi rcsb
source organism Lentinula edodes
total genus 256
structure length 756
sequence length 756
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-07-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...