6NBQF

T.elongatus ndh (data-set 1)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
Knots found
sequence length
649
structure length
582
Chain Sequence
YAWLIPVLPLLGALIVGFGLIAFSETTSKLRRPSAIFIMALMAIAMGHSLTLFWSQVQGHLPYTQMIEWAAAGNLHIAMGYVIDPLAALMLVIVTTVAFLVMLYSDGYMAHDPGYVRFFAYLSLFGSSMLGLVVSPNLVQVYIFWELVGMCSYLLIGFWYDRKSAAEAAQKAFVTNRVGDFGLLLGMVGLFWATGTFDFAGMGDRLTELVNTGLLSPSLAAILAILVFLGPVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGVFLIARMFPVFEQLPQVMTTIAWTGAFTAFMGATIAITQNDIKKSLAYSTISQLGYMVMGMGVGAYSAGLFHLMTHAYFKAMLFLGSGSVIHSMEGVVGHNPDLAQDMRYMGGLRKYMPITGATFLVGCLAISGVPPFAGFWSKDEILGAVFHANPAMWLLTWLTAGLTAFYMFRMYFMTFEGKFRNVPPERQEHHDHHSHHAAVPHESPWTMTLPLVVLAIPSTLIGFVGTPFNNLFEVFIHELYEAVFIKGCRRLARQVLEVDYNVVDGVVNLTGFVTMVTGEGLKYLQNGRAQFYALIVLLAVLGFVIFSVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex I-like molecule NDH of oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NAD(P)H-quinone oxidoreductase subunit H
total genus 124
structure length 582
sequence length 649
other databases KnotProt 2.0: Artifct K +31
ec nomenclature
pdb deposition date 2018-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00361 Proton_antipo_M Proton-conducting membrane transporter
F PF00662 Proton_antipo_N NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus
F PF01010 Proton_antipo_C NADH-dehyrogenase subunit F, TMs, (complex I) C-terminus
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...